Loading...
HomeMy WebLinkAboutPlaceWorksLA QUINTA AREA PLAN FOR THE HIGHWAY 111 CORRIDOR PROPOSAL TO CITY OF LA QUINTA | NOVEMBER 16, 2018 LA QUINTA AREA PLAN FOR THE HIGHWAY 111 CORRIDOR PROPOSAL TO CITY OF LA QUINTA | NOVEMBER 16, 2018 SUBMITTED TO: CITY OF LA QUINTA Design and Development Department Attn: Danny Castro, Design and Development Director 78-495 Calle Tampico La Quinta CA 92253 760.777.7099 | dcastro@laquintaca.gov SUBMITTED BY: PLACEWORKS Karen Gulley Managing Principal, Design 3 MacArthur Place, Suite 1100 Santa Ana CA 92707 714.966.9220 | kgulley@placeworks.com WITH: LSA ASSOCIATES RGA LANDSCAPE ARCHITECTS SPECTACLE DESIGN Contents 1. COVER LETTER ...................1 2. STATEMENT OF QUALIFICATIONS ....3 3. PROJECT UNDERSTANDING AND APPROACH .....................9 4. SCOPE OF WORK ................11 5. SCHEDULE/TIMELINE .............17 6. REFERENCES ....................19 7. COST PROPOSAL ................21 APPENDIX A. RESUMES ............A-1 APPENDIX B. WORK SAMPLES .......B-1 APPENDIX C. NON-COLLUSION AFFIDAVIT FORM ..............C-1 3 MacArthur Place, Suite 1100 | Santa Ana, California 92707 | 714.966.9220 | PlaceWorks.com November 15, 2018 City of La Quinta Design and Development Department Attn: Danny Castro, Director 78-495 Calle Tampico La Quinta, CA 92253 Subject: Proposal for Development of an Area Plan for the Highway 111 Corridor Dear Mr. Castro: On behalf of PlaceWorks, RGA Landscape Architects, LSA Associates, and Spectacle Design, we are very excited to submit this proposal to develop an Area Plan for the Highway 111 Corridor. We recognize that the Corridor’s economic strength and resilience is paramount to the City of La Quinta. This project is an incredible opportunity to reimagine and strengthen La Quinta’s identity along Highway 111 and within the broader Coachella Valley. It represents a critically needed effort to set the stage to revitalize and redefine the image of La Quinta as perceived from the corridor. Our focus will be on creating a stronger sense of place through repurposing underutilized areas, increasing safety and mobility, bringing consistency to the design and regulatory framework, and capturing lost market opportunities from those traveling through the corridor. Our design solutions will also leverage the CV Link investment to grow the market and create new destinations. The Highway 111 Corridor Area Plan must effectively build an economic development strategy based on market realities, community assets, and the values and identity of La Quinta within the Coachella Valley. PlaceWorks has assembled a team of talented individuals with local experience, relevant corridor/infill planning and design expertise, and a passion for developing creative yet implementable solutions. PlaceWorks is a multi-disciplinary planning, design, and environmental firm that focuses on corridor and infill planning and has developed tools to effectively analyze conditions, test design concepts, and create market-based plans that respect the culture of the community. As the prime consultant, we will draw on our decades of experience leading teams in an organized manner that is responsive and cooperative with both the City and the public. Due to her experience managing complex projects and her direct expertise in design and corridor planning, our team will be led by Karen Gulley, Managing Principal of PlaceWorks. She will be supported by Planning Lead, Brooke Peterson, who has led similar corridor revitalization efforts, and Design Lead, Sheila Cedervall, who participated as a primary contributor to the La Quinta Highway 111 ULI Technical Assistance Panel (TAP). Steve Gunnells, Chief Economist of PlaceWorks, will test and build upon the economic development strategies contained in the ULI TAP. An industry leader in the development of water efficient landscape design and the sustainability of landscapes, RGA has contributed to many significant and iconic developments in the desert for more than 40 years. LSA has extensive experience in the City and surrounding desert locations, including serving as a primary contributor to the La Quinta Highway 111 TAP, CV Link, and the La Quinta Village Complete Streets project. Yolanda Sepulveda of Spectacle rounds out our team by bringing the branding and placemaking elements that will lay the foundation for the project. We are thrilled at this opportunity to work again with the City of La Quinta and to be part of remaking and reimagining the Highway 111 Corridor. We are willing and able to sign the City’s Agreement for Contract Services with no exceptions to the the terms and conditions contained in the Request for Proposals. As an officer of the firm, I am authorized to negotiate contracts on behalf of PlaceWorks and to bind the team to the contents of this submittal. Please do not hesitate to contact me if you have any questions. This proposal shall remain valid for 90 days from the November 16, 2018 due date. My complete contact information is: Karen Gulley, Managing Principal | PlaceWorks, Inc. | 3 MacArthur Place, Suite 1100 | Santa Ana, CA 92707 | 714.966.9220 x2347 | 714.966.9221 (fax) | kgulley@placeworks.com. We understand the significance of this effort and look forward to discussing our approach with you in greater detail. We appreciate the opportunity to bid on this very important project and look forward to your response. Respectfully submitted, PLACEWORKS Karen Gulley Managing Principal 1. Cover Letter 3PROPOSAL FOR SERVICES | PLACEWORKS 2. Statement of Qualifications PLACEWORKS PlaceWorks has a 43-year legacy of working on high-profile projects for public, private, and not-for-profit sectors throughout California. Our talented, multidisciplinary team thrives on working with communities to tackle complex problems and develop custom, comprehensive solutions. PlaceWorks is all about places and how they work economically, environmentally, aesthetically, and culturally. We are passionate about collaborating with clients and stakeholders. Just as each place we work in is distinctly different, so is our thinking and our products. PLACEWORKS CORE SERVICES Community Planning ƒCorridor Planning and Design ƒCommunity Engagement ƒUrban Infill Design and Planning ƒTransit-Oriented Design and Planning ƒComprehensive Planning, including General Plans and Specific Plans ƒHousing Research and Analysis ƒZoning and Form-Based Code ƒActive Transportation Planning ƒClimate Action and Resiliency Planning ƒHazard Mitigation Planning ƒTransferable Development Rights ƒMunicipal Services ƒGeographic Information Systems ƒCreative Media ƒEnvironmental Services Design ƒTran sit-Oriented Design ƒDowntown Planning and Design ƒInfill Design and Planning ƒDesign Standards/Guidelines ƒStakeholder Charrettes ƒSite Planning and Large-Scale Planning and Design ƒStrategic Plans Economic/Market/Fiscal Planning ƒEconomic and Market Analysis ƒEconomic Development Planning ƒSite Selection and Development ƒFeasibility Studies ƒFiscal and Financial Analysis Landscape Architecture ƒSustainable Landscape Design ƒStreetscape Design ƒParks and Trails Planning ƒUrban Agriculture and Urban Forestry ƒStorm Water Management Planning PlaceWorks Staff PlaceWorks has assembled a highly qualified team to complete the La Quinta Highway 111 Corridor Area Plan Development project. Full resumes are provided in Appendix A. Karen Gulley, Principal | Principal-in-Charge/Project Manager. Karen will be responsible for leading the team and maintaining quality control. Karen’s strengths include handling the day-to-day manage- ment of large project teams, where information sharing, issue management, problem solving, and policy development require extensive coordination. Karen’s vast corridor planning experience includes Anaheim’s Beach Boulevard Corridor Specific Plan, the Groves at Loma Linda Specific Plan, and the Atascadero Downtown Revitalization Corridor Plan. Brooke Peterson, AICP, Associate Principal | Planning Lead. Brooke is experienced with general plans, community plans, corridor and specific plans, master plans, redevelopment, mixed-use development, public health, and urban greening projects focusing on facilitating authentic and effective public engagement and successfully navigating the tensions between the community, governmental, and private interests. She has a passion for creating not just healthy and livable communities but places with authenticity and vibrancy. Brooke’s recent experience includes serving as project manager for San Diego’s Morena Boulevard Corridor TOD Specific Plan. Sheila Cedervall, ASLA, Senior Associate | Design Lead. Sheila is an urban designer and landscape architect with more than 25 years of experience bringing vibrant, cohesive, and environmentally friendly communities to life. Her experience includes all phases of design—from establishing the initial vision to working closely with local authorities to gain project approval. She also specializes in sustainable building practices with an emphasis on water-wise landscape design. Sheila wrote and produced the ULI TAP Report for the La Quinta Highway 111 Corridor. Matt Gelbman, AICP, Associate Designer | Assistant Project Manager. Matt has experience developing solutions to address the unique development challenges that communities face in a variety of contexts from small, coastal downtowns to the regional scale with a commitment to thorough research to understand places and what makes them work. Matt currently assists Karen on the Atascadero Downtown Corridor Plan. Steve Gunnells, Chief Economist | Market and Fiscal Analysis. Steve works with communities to bridge the gap between long-range planning policies and economic development; with community organizations and special districts to fund and implement priority projects; and with developers to guide project decision-making and obtain entitlements based on sound economic/market analysis. His work was in important factor in the success of corridor plans for the cities of Anaheim, Santa Ana, Los Alamitos, and Clovis. 4 CITY OF LA QUINTA | DEVELOPMENT OF AN AREA PLAN FOR THE HIGHWAY 111 CORRIDOR 2. Statement of Qualifications Michael Nilsson, AICP CTP, Senior Transportation Planner. Mike understands how to link land use, environmental, and mobility policies to create high- quality sustainable environments. His 15 years of public- and private-sector experience cover urban and mobility planning, policy, and outreach; CEQA/NEPA environmental review; and project funding/implementation. Working with regional and municipal government agencies, private developers, nonprofit organizations, and advocacy organizations, he has guided a diverse array of complex, innovative projects from vision to reality, including cap parks, pedestrian plans, and complete-/green-street projects. Mike plays a key role on the Atascadero Downtown Corridor Plan, and did as well as on Anaheim’s Beach Boulevard Corridor Specific Plan. Yue Zhang, Project Designer | Design. Yue specializes in graphic and document design, and illustrations that include maps, 3D models, and renderings. Proficient with graphics programs such as the Adobe Creative Suite, AutoCAD, SketchUp, GIS, and 3D Max. RELATED EXPERIENCE Our corridor expertise combined with our staff’s participation on the ULI Highway 111 Corridor Study Technical Assistance Panel make us uniquely qualified for this project. We understand that communities need design, policy, and financial tools to reclaim corridors. PlaceWorks has extensive experience in repositioning commercial corridors to best compete in local and regional economies. With our long history of working with the public, business community, governments, and private developers, we know how to craft marketable solutions to address corridor redesign, multimodal transportation options, economic development, and community health. Morena Boulevard Corridor TOD Specific Plan and EIR A Refined TOD Planning and Development Program Project Type Corridor/TOD Specific Plan and EIR Client City of San Diego Date Completed February 2018 Services Provided Community Planning, Urban Design, Economic Analysis, Environmental Analysis, Community Outreach Led by Karen Gulley and Brooke Peterson, PlaceWorks managed this corridor specific plan along Morena Boulevard as the second phase of what was expected to be a two-phased process. When the first phase (led by others) failed amid an explosion of public opposition, PlaceWorks was called upon to begin again from scratch and prepare a refined planning and development program to effectively facilitate redevelopment of the project area. The greatest challenges were erasing negative impressions made by poor planning concepts/products and navigating the sea of mistrust engendered during Phase 1. We managed an extensive public outreach program that included ample opportunities for community feedback and other public input. The project ultimately encompassed preparation of a specific plan with site design concepts and illustratives, visual simulations, new development standards and design guidelines, and a brand new mobility network. “In addition to demonstrating a clear understanding of the perspectives of both clients, City of Fullerton and CSUF, and the challenges of the area, they brought a unique combination of public policy knowledge and private development expertise. Their commitment to two very different clients is reflected in the quality of work throughout the process, timely responses, and customized solutions. They worked efficiently and kept the deadlines that were set. I would highly recommend their services.” − Charles G. Kovac City of Fullerton 5 2. Statement of Qualifications PROPOSAL FOR SERVICES | PLACEWORKS El Camino Real On the Go! A Corridor Plan with VMT Reduction Strategies Project Type Corridor Plan Client City of Atascadero Date Completed In Progress Services Provided Market Demand Analysis, Community Workshops, On-line Surveys, Urban Design and Mobility Analysis, Alternative Land Use and District Concepts, Mobility Improvement Recommendations, Land Use and Architecture Recommendation, Streetscape Design El Camino Real is the gateway to the City of Atascadero’s Downtown. The look, feel, and content of this 5-mile corridor has a significant bearing on the City’s regional identity, local character, and economic health. And although it has great potential to be a vibrant downtown for shopping, dining, and small businesses, with its high vacancies and non-descript buildings it has been slow to recover since the Great Recession and currently struggles to compete with nearby Paso Robles and other commercial areas. PlaceWorks was selected by the City to develop the El Camino Real Corridor Plan, the goal of which is to identify future land uses and guide urban design concepts with circulation improvements. This project will set a new course for El Camino Real with a combination of strategic public realm investments and incentives for new development. We are providing the City with a custom strategy and set of tools to transform this automobile-oriented, regional corridor into a multi-modal economic hub. Elements of the corridor plan include the formation of new districts; modernization of zoning regulations; dynamic site design concepts for key areas; contemporary architectural style guidelines that also honor local history; streetscape design; and bicycle and pedestrian improvements to address safety concerns. The plan will also include strategies for business attraction, retention, and investment. PlaceWorks is excited to be leading this project to revitalize El Camino Real and change the course of the economy in the City of Atascadero. The Groves at Loma Linda Planning for Public Support Project Type Specific Plan Client Planning PLUS/P+ for City of Loma Linda Date Completed June 2018 Services Provided Site Planning, Housing Product Selection, Project Visioning, Community Outreach, Design Guidelines, Landscape Design, Park Planning, Circulation Planning, Trail Planning, Zoning Standards, Implementation Located in the heart of the community, this 300-acre site is the City’s largest remaining vacant area with development potential. Previous attempts to master-plan and subdivide the property failed due to strong public opposition. PlaceWorks was brought in to lead an outreach process with City leaders and the community, resulting in opposing sides working together to define a vision and development plan for the area. The project was complicated by skepticism of adopted General Plan direction to provide high density residential and mixed-use. PlaceWorks focused on educating City officials and the community on quality housing and mixed-use product types that could be integrated with open spaces, trails, and commercial uses to create a variety of active places within the project. The community understood the value of creating gathering spaces for friends and family, which only exist in nearby cities. They also wanted a portion of the area reserved for large estates. The Plan was designed to provide both. PlaceWorks designated an internal “main street” with design standards that will a ensure a high quality, clustered environment, while also designating an enclave of custom and semi-custom homes. By collaborating and building trust with the community, PlaceWorks was able to plan for specific areas of increased density and intensity, leaving 68 acres for open space, trails, and parks, including an oak woodland preserve, a historic park, and a 30-acre central park for which concept designs were prepared. The Plan also included detailed design guidelines to address specific architecture and future site design concerns. The Specific Plan was approved unanimously by Planning Commission and City Council. Local leaders and the general community trusted PlaceWorks with an incredible amount of land for this small City. Today, development is in progress on large portions of the site. 6 CITY OF LA QUINTA | DEVELOPMENT OF AN AREA PLAN FOR THE HIGHWAY 111 CORRIDOR 2. Statement of Qualifications Harbor Mixed-Use Transit Corridor Specific Plan Corridor Revitalization Strategy and Vision Project Type Corridor Planning, EIR, Market Analysis Client City of Santa Ana Southern California Association of Governments Date Completed October 2014 Services Provided BRT/TOD Station Planning, Land Use/Corridor Planning, Public Outreach, Zoning, Specific Plan Development, Market Analysis, Infrastructure Analysis, EIR PlaceWorks helped the City of Santa Ana evaluate zoning designations along transit corridors throughout Santa Ana to expand land use options and establish an urban fabric that takes advantage of transportation improvements. A com- bination of vacant and underutilized land, bus rapid transit investments, future fixed guideway facilities, and desirable freeway and regional access make Harbor Boulevard an ideal candidate for reinvestment and new development opportunities. PlaceWorks subsequently developed the Harbor Mixed-Use Corridor Plan and laid the foundation for a more livable corridor through form-based zoning that allows new housing and mixed- use development opportunities; the safe integration of cars, buses, bicycles, and pedestrians along a six-lane roadway; and design guidelines that create a stronger identity for residents and businesses. PlaceWorks conducted an extensive outreach program consisting of over 20 public meetings, including an idea fair and bus tour, neighborhood meetings, focus groups with property/business owners and developers, a joint workshop with the Circulation Element Update, and three study sessions with the Planning Commission. After adoption, the plan immediately drew interest from multiple developers for new residential and mixed-use projects. Beach Boulevard Corridor Specific Plan and EIR The Heart of West Anaheim Project Type Specific Plan and Environmental Impact Report Client City of Anaheim Date Completed In Progress Services Provided Specific Plan, Community Outreach, EIR The Beach Boulevard Specific Plan is the result of a focused and comprehensive effort involving the City of Anaheim and the West Anaheim Community. This plan guides future development along a 1.5-mile stretch of Beach Boulevard between the cities of Buena Park and Stanton. Supported by modern development standards, economic and sustainable community development incentives, and capital improvements, the plan holistically addresses the future of Beach Boulevard—the heart of West Anaheim. Designated by the Southern California Association of Governments as a “high quality transit corridor,” Beach Boulevard still functions primarily for motor vehicles. Nonmotorized modes of transportation such as walking and biking are not well integrated along the street. The intent of the plan is to create a new regulatory environment, land use plan, development incentives, and streetscape enhancements to improve conditions along the boulevard and attract economic investment to the area. The planning process included the community at every stage. Its vision and guiding principles were created with the community and reflect the themes that emerged throughout the process. Public involvement included the formation of a community advisory committee; a series of pop-up events, including workshops at three local high schools; stakeholder interviews; and a developer roundtable. An online component included a dedicated project web page and web-based survey. 7 2. Statement of Qualifications PROPOSAL FOR SERVICES | PLACEWORKS SUBCONSULTANTS A multi-faceted project requires a comprehensive approach, and PlaceWorks has selected three talented and unique firms as partners in preparation of the Corridor Area Plan. Traffic analysis will be performed by LSA of Palm Springs. RGA of Palm Desert will bring a wealth of local experience to the provision of landscape architecture services, and Spectacle will contribute wayfinding and branding concepts to round out our capacity of services. LSA ASSOCIATES (TRANSPORTATION & MOBILITY) LSA Associates has a 42-year legacy of experience in traffic engineering and transportation planning that has resulted in sustained relationships with key regional stakeholders who rely on the firm’s expertise in these disciplines. Innovative in land use, mobility access and transportation planning strategies and solutions, LSA recognizes that the Highway 111 Corridor’s economic resilience is paramount to the City. LSA made detailed mobility recommendations as part of the ULI effort, addressing all modes of travel and travel needs in the Corridor. LSA’s understanding of the City’s vision ensures a well- supported and thoughtfully executed plan to position the Corridor for long-term viability. LSA has extensive experience in the City and surrounding desert locations, as well as with other local, federal, and private agencies. Notable experience includes being a primary contributor to the ULI TAP report and the La Quinta Village Complete Streets project. As a result of the intensive data collection and interpretation for the City, this experience gives LSA a hands-on, real-time understanding of the current and future conditions along the Corridor. LSA Staff Tony Petros, Principal | Transportation and Mobility Lead. Tony manages the preparation and review of comprehensive traffic and parking studies, operational and engineering analyses, Project Study Reports/Project Reports, complete streets and modal analyses, and long-range and strategic planning efforts. Great emphasis is placed on the coordination of transportation projects with municipal and agency administrators and other stakeholder interests. Tony has built successful and long-standing relationships with public agencies such as OCTA, LA Metro, SANDAG, SCAG, RCTC, and the California High-Speed Rail Authority, and maintains outstanding relationships with various cities and counties throughout Southern California. Arthur Black, Associate | Mobility Strategy Analyst. Arthur’s primary responsibilities include the production of technical reports for the transportation function of LSA. This role involves the preparation of traffic and parking studies, operational analysis, and transportation planning research. His transportation planning research has included parking generation rates, transit planning, traffic calming, internal trip capture, and transit mode share. He is following the implementation of SB 743, including attending meetings at SCAG with Chris Calfee, Senior Counsel for the Governor’s Office of Planning and Research. Ashley Barden, Transportation Analyst. Ashley assists with the production of transportation documentation for a variety of projects throughout California. Her primary responsibilities include research and analysis for the completion of traffic impact analyses, transportation plans, and evaluations. Her technical expertise extends through transportation analysis to environmental studies and planning. RGA LANDSCAPE ARCHITECTS (Landscape Design) RGA has 40 years of experience in providing landscape architectural services in the southern California region. RGA is an award-winning firm noted for its elegant yet practical outdoor spaces, and they are recognized as experts in the design of water efficient landscapes and the selection of plant material appropriate for sustainable environments. RGA has been the project landscape architects for over 2,000 projects in the southwest. RGA has provided landscape architectural services for nearly 50 median island and streetscapes projects in the Coachella Valley, including sections of Highway 111, Fred Waring Drive, Tahquitz Canyon Way, Gene Autry Trail, Ramon Road, Cook Street, Eldorado Drive, Dinah Shore, and Calle Tampico. RGA Staff Ronald B. Gregory, ASLA, Principal Landscape Architect. Ron loves the desert and has found it rewarding to create a landscaped environment where there was basically only sand before. In the mid- 1980s, he embraced the need for water efficient design and has since worked at providing sustainable designs for an appreciative clientele. He has been Principal in Charge for well over 2,000 landscape projects in the Coachella Valley. 73061 El Paseo, Suite 210 • Palm Desert, CA 92260 • 760-568-3624 • FAX 760-773-5615 • www.rga-pd.com CA Lic. #1532 • AZ Lic. #13754 • NV Lic. #94 JARVIS PAYNE Position: Associate Landscape Architect When Jarvis joined RGA in January 2018, he brought with him over 30 years of designing and managing landscape development projects throughout the West Coast, including bio tech corporate campuses in metropolitan Portland, Oregon, a new Oregon State University campus in Bend, Oregon, and a waterfront park in Sacramento, California. Jarvis excels at taking complex public development projects from initial design concepts, then preparing detailed construction documentation, and finally overseeing the construction of a successful landscape development project. After graduating from the University of Washington with a Bachelor of Landscape Architecture, Jarvis relocated to the Bay Area to work with a San Francisco based landscape architectural firm and gained extensive experience working on Public and Commercial development projects throughout California. Education: B.A. Landscape Architecture – University of Washington Registration: Registered Landscape Architect: •California #4317 •Oregon #761 Previous Professional Experience: From November 2005 to December 2017, Jarvis was with Walker Macy Landscape Architects in Portland, OR. As a senior project manager and designer in this 36-person firm, Jarvis was responsible for managing and designing large scale public and higher education landscape development projects in California, Oregon and Washington. Jarvis managed up to ten support staff, supervised teams of sub consultants, and oversaw all aspects of project design, construction document preparation, and construction administration. Over the previous nine years, Jarvis gained invaluable experience and knowledge at Murase Associates in Portland, Suzman Design Associates in San Francisco, and PGA Design in Oakland. Jarvis developed expertise in park design, public infrastructure, low income housing, and historic landscape preservation. As a designer and senior project manager, Jarvis managed a variety of projects, including a master plan for 540-acre urban nature park, construction document preparation for a 300-acre semi-conductor facility, and a master plan for an expansion at Oakland International Airport. Jarvis Payne, Associate Landscape Architect. With over 30 years’ experience designing and managing landscape development projects throughout the western US, Jarvis excels at taking complex public development projects from initial design concepts, then preparing detailed construction documentation, and finally overseeing the construction of a successful landscape development project. SPECTACLE DESIGN (BRANDING/PLACEMAKING) Spectacle Design is a creative studio specializing in wayfinding, placemaking and branded experiences for the sectors of retail, residential, mixed-use, hospitably, commercial, entertainment, interior and exterior environments. With over 15 years of experience in urban design, and collaborative creation, Spectacle has built partnerships on its ability to assess and succinctly prescribe design strategies that reimagine places that people love. A dynamic and nimble team of urban planners, industrial and graphic designers, Spectacle emerged from a group of people looking to bring the user to the center of the design solution through processes adopted from the Urban Land Institute’s Technical Assistance Panel facilitation and outreach methods. It has established a strong partnership with the Institute and serves 8 CITY OF LA QUINTA | DEVELOPMENT OF AN AREA PLAN FOR THE HIGHWAY 111 CORRIDOR 2. Statement of Qualifications as facilitators and design leads, guiding real estate problem solving for over a dozen communities in Southern California. In addition, it works with private developers and design professionals to help find the heart of communities and reflect that within experiential design solutions, inclusive of wayfinding and branded identities. Spectacle Staff Yolanda Sepulveda, Principal, Wayfinding. Yolanda combines innovative problem solving with creative collaboration to foster a win-win philosophy. Using her in depth knowledge of the built environments in the sectors of retail, residential, and TOD, she leads development teams to reposition assets through re-imagined design elements like wayfinding, public art, signage, exterior and interior features that revive and reintroduce both new and existing assets. Yolanda’s passion and focus is centered on development and the inclusion of users in the process and creation of built environments. Will Heinze, Senior Designer. Will has worked for over 5 years in the realm of experiential design and creating environments that provide clear and navigable places for people to explore. As an industrial designer, he serves as a critical component to the team as he is able to see a vision to a place through the mechanics of what is plausible and constructible. 9PROPOSAL FOR SERVICES | PLACEWORKS 3. Project Understanding and Approach PlaceWorks participated as the Report Writer for the recent ULI Technical Assistance Panel to study the Corridor. After participating in all workshops, study sessions, stakeholder interviews, and the presentation to Planning Commission and City Council, we have a strong understanding of the great opportunity and potential of this area to be the economic hub of La Quinta. Our understanding is that the project should address some of the substantial difficulties inherent in today’s retail market, tailored to meet La Quinta’s specific needs along Highway 111. The Corridor is akin to a freeway, running through the City while providing little relationship with retail businesses lining its sides. Retail transactions within the Corridor currently represent 70% of the City’s annual fiscal budget, therefore fostering stability for existing commerce and attracting new business is vital. We understand that there needs to be a greater sense of arrival or place to entice would-be passersby to stop and invest their time and money, and to create memories in La Quinta. Streetscape improvements, including opening view corridors, improving wayfinding, and “complete streets” modifications would bring new energy, character, and accessibility to the Corridor. The 460-acre area faces several challenges requiring in-depth analysis of both economic data and human psychology. Successful new retail centers are based on creation of experiences compelling enough to attract attention, memorable enough to spend time and money as well as revisit. Currently, much of the Corridor consists of big box retail centers with oversized, asphalt parking areas that do not speak to the unique beauty and heritage of La Quinta. One of the primary challenges facing the Corridor is changing public perception. Existing development along the Corridor is characterized by big box stores and large parking lots, a noticeable departure from the rest of the City’s character such as a charming Old Town, resorts, and well-maintained residential neighborhoods. Existing vehicular traffic numbers show the enormous economic potential of the Corridor, however most vehicles do not stop in La Quinta. The 23% vacancy rate for retail establishments cited in the July 2018 ULI TAP report reveals a growing concern. Consumer spending habits have changed dramatically, a trend likely to result in an increase in vacant brick and mortar stores unless several catalyst mechanisms are put in place. The Corridor Area Plan will encourage and facilitate positive changes necessary to reverse this trend. The following list represents the major influences on the project: ƒAn influx of 600,000 visitors flock to the Coachella Valley during the winter to experience the unique geography, climate, and culture. Reimagining La Quinta’s segment of Highway 111 will help distinguish the City from neighboring communities and build upon its impressive reputation. ƒHighway 111 carries 35,000 to 40,000 vehicles per day, with the Washington Street intersection experiencing one of the highest volumes of traffic in the entire Coachella Valley. Creating a framework to give La Quinta a competitive edge to capture sales and transient occupancy tax is vital to future economic success. ƒThe Corridor area is centrally located within the Coachella Valley and several upscale resorts are planned for construction in the City. This will continue to elevate the brand perception of the City as a noteworthy destination. ƒThe CV Link, a 49-mile multi-modal pathway is projected to attract 15,000 to 16,000 users annually. The first La Quinta segment is scheduled to open in the fall of 2019 and holds great promise to help define La Quinta as a new “cool” area. ƒThe extreme climate, existing landscaping, and large expansive parking areas have resulted in a harsh environment that is not conducive to spending time along this portion of Highway 111. The streetscape plan will address these issues by creating a shaded, colorful garden environment that is water-mandate sensitive and pedestrian-scaled. We can plan to frame views from the Corridor with landscaping while maintaining visual and physical access for motorists ƒEnsuring ongoing economic viability and creating interesting, healthy spaces are central purposes of the Highway 111 Corridor Study. Consumers have higher expectations for retail experiences than in the past. Moving forward, ubiquitous, bland, shopping centers will not compete well against on-line options. The Highway 111 Corridor Area Plan is the important next step to unlocking enormous economic potential and enhance public perception of the City of La Quinta. 10 CITY OF LA QUINTA | DEVELOPMENT OF AN AREA PLAN FOR THE HIGHWAY 111 CORRIDOR 3. Project Understanding and Approach APPROACH Set the stage with branding. Before we can recommend physical changes, design improvements, and land use strategies to address the needs and issues identified above, we need to work with the community to understand its values and how it sees its role in the Coachella Valley. We will undertake a unique visioning and branding process that will enable our team to define the look, feel, color, and use of materials that will create the La Quinta experience. Our goal is to “lay out the welcome mat,” letting people know that they have arrived, quickly assess what is offered, and where they want to go. Setting the stage with branding will support the broader effort to draw-in tourists and create nodes of activity that become destinations. Build on the outreach started with ULI. Local businesses, realtors, city leaders, and others provided valuable insights on issues and opportunities to be explored. Local businesses are clearly concerned about vacancies along the Corridor and the image conveyed to tourists in the area. The pop-up station for Lyft drivers during Coachella is a great example of the creativity of business owners. Our approach is to continue to work closely with these stakeholders and build champions for the implementation of the project recommendations and create property-owner interest in developing destinations. Capitalize on the CV Link. Drawing attention to connections to and from the CV Link will be a vital component of the Corridor Plan. Establishing a contemporary wayfinding system will help solidify the brand of the La Quinta 111 Corridor. Multimodal design should accommodate pedestrians, bicycles, neighborhood electric vehicles, and automobiles. Connecting to the CV Link may also capture the attention of younger, more adventurous visitors. Drawing younger tourists to the Corridor and offering unique experiences in the community is paramount to the project’s long- term success. Modernize the policy and regulatory structure. To effectively analyze the 12 existing Corridor-related Specific Plans, PlaceWorks will create a matrix of standards that will quickly standardize and identify those that are outdated, restrict creativity, or are not compatible with the Corridor vision. New standards will be established that allow for the flexibility to implement the vision to bring new vitality and excitement to the Corridor. Design a sustainable “wow” public realm. Most cities along Highway 111 have created unique landscape environments that announce arrival and tie local activities and uses together. There is ample right-of-way to work with in La Quinta. We relish the challenge of designing a streetscape that balances the needs of retail visibility with character and shade; reflecting the overarching need to make a statement that La Quinta is a physically and culturally “cool” destination. Make it Happen. Any plan is only as good as its implementation. Public realm improvements require upfront capital and ongoing maintenance expenditures. Our approach is to collaborate with City staff and property owners and other stakeholders to explore various ways to fund these costs and build support for the preferred options. But the real success of the plan will be found in new development. We will also work with the City to identify programs and services to facilitate desired development and to support new and expanded businesses. Project samples of related area plans and design guidelines from comparable cities are provided in Appendix B. . 11PROPOSAL FOR SERVICES | PLACEWORKS 4. Scope of Work Based on our understanding of the community, the City’s objectives for this project, and our experience with similar projects, the PlaceWorks Project Team is confident that the following Scope of Work presents the most effective and creative approach to the Highway 111 Corridor Area Plan project. Thiis scope is intended to provide the City with a comprehensive and clear path to adopting a custom Corridor Area Plan. Our scope of work comprehensively addresses all the tasks we think are necessary for this phase of the project to succeed. Although we believe this scope reflects your needs, we emphasize that it is negotiable, and we will work with you to arrive at a final scope that is the best fit for the City. We also understand that refinements along the way may be necessary to address arising needs and public or other stakeholder feedback. TASK 1. PROJECT TEAM COORDINATION This task accounts for the ongoing operational and coordination activities that are essential for keeping the project moving forward on schedule and within budget. Most importantly, this task outlines the strategies that demonstrate our project team’s commitment to being responsive and accessible to City staff. TASK 1.1 PROJECT KICK-OFF MEETING The project kick-off meeting is a critical event—La Quinta staff and the Project Team must work in tight collaboration to prepare a plan with the desired quality and outcome and within the time and budget allowed. The kick-off meeting will allow the Project Team and City staff to: ƒIntroduce key participants; ƒShare expectations for the project; ƒRefine the work program, scope of work, and schedule; ƒIdentify the roles of anticipated stakeholders such as outside agencies, local organizations, and property owners; ƒIdentify available data resources and any current or related projects that must be considered, such as future hotels; ƒFine-tune the outreach process to ensure that there will be meaningful ways to engage the community; ƒEstablish communication protocols for the project; and ƒIdentify potential project issues that may arise and establish strategies to address them. It is anticipated at this time that the kick-off meeting will include key staff from the Community Development Department, the City Manager’s Office, Public Works, and others as deemed appropriate by the City. The kick-off meeting will be attended by representatives from our team, including Karen Gulley as Principal-in-Charge/Project Manager; Matt Gelbman, Assistant Project Manager; Brooke Peterson, Lead Planner; Sheila Cedervall, Lead Designer; and LSA, RGA, and Spectacle Design Task Leads. TASK 1.2 DAY-TO-DAY PROJECT MANAGEMENT PlaceWorks will be responsible for coordination with the City and subconsultants, processing invoices, reviewing and managing deliverables, ensuring quality control, and adherence to the schedule. Karen Gulley, Principal for Design, will serve as Project Manager and oversee the project’s day-to-day operations and subconsultant coordination and provide the leadership at critical milestones in the process. She will be supported by two additional PlaceWorks team members: Matthew Gelbman and Brooke Peterson. Matthew Gelbman will serve as Assistant Project Manager and will provide day-to-day management of subconsultant team members, preparation of deliverables, and outreach events. Brooke will provide senior-level planning and design expertise to support Karen and Matt. Approximately four and a half hours per month over the 8-month project time frame is assumed for project coordination on the project between the Project Manager and Assistant Project Manager. Consistent communication and coordination with the City will be the cornerstone for project success. We recognize this isn’t our plan but yours! PlaceWorks will hold a bi-weekly conference call with you to review the tasks at hand and any topics related to project status, budget, and schedule. This will be our opportunity to discuss issues, obtain direction, or discuss changing project needs. This task also includes coordination with internal Project Team members, Spectacle Design, LSA, and RGA, quality control of deliverables, and monthly project administration (scheduling, budget tracking and invoicing). Project Schedule. We anticipate an 8-month project duration. We will develop a detailed project schedule designed to ensure sustained staff involvement in the process, allow for meaningful and timely public participation, allocate sufficient opportunity for sharing information with staff and decision makers, and provide adequate time for staff to respond to data requests and review products. We will maintain an up-to-date schedule throughout the project to ensure that staff is apprised of project status and that all team members are aware of upcoming meetings and product due dates. A current Microsoft Project schedule will be available at staff’s request at any time. TASK 1.3 CLIENT/PROJECT TEAM MEETINGS The PlaceWorks team has assumed attendance at four in-person collaborative team meetings with the City at key junctures in the process. Topics may include discussion of opportunities and constraints, preparing for public participation activities, development of draft strategies, and review of key products. This task also includes internal consultant team meetings on an as- needed basis. Deliverables: −Kick-off Meeting Agenda, Schedule, Meeting Summary, Data Needs List −Weekly Coordination with the City’s Designated Project Manager −Monthly Invoices −Project Schedule −Up to four (4) Client/Project Team Meeting Agendas and Meeting Notes 12 CITY OF LA QUINTA | DEVELOPMENT OF AN AREA PLAN FOR THE HIGHWAY 111 CORRIDOR 4. Scope of Work TASK 2. SHAREHOLDER ENGAGEMENT PROGRAM PlaceWorks will continue the conversation started with stakeholders as part of the ULI TAP. Key members of the Project Team participated in intensive field meetings and roundtable discussions with stakeholders. We have a deep familiarity with the corridor and the impressions of local stakeholders. In addition to our established relationships, we will solicit participation and input from a broader range of developer and industry stakeholders and reach out to residents in the community. Our project team will conduct an outreach and participation effort to inspire community interest and maximize participation in the planning process. This will ensure that the Corridor Area Plan captures the wants and needs of the community and reflects implementable recommendations. 2.1 COMMUNITY WORKSHOPS Community workshops will serve as an important opportunity for the broader public to participate in the process. PlaceWorks will lead community meetings with careful consideration of meaningful discussion questions that will yield useful input for the project team. We will design a meeting format that helps people provide informed input, and activities that allow everyone to participate in a way that feels comfortable and safe. We propose holding two community workshops as summarized below and detailed further in Tasks 2.1.1 and 2.1.2: ƒWorkshop 1, Visioning for the Corridor, to provide an opportunity to launch the project with the community, reimagine the future of the corridor, and clarify values. ƒWorkshop 2, Defining the Possibilities, for input on options for pedestrian and bicycle mobility, streetscape/public realm improvements, and future design ideas and land uses. For the workshops, we will consider a range of formats that provide more interactive alternatives such as breakout discussions, scenario games, walking tours, prioritization rankings with dots, and other fun activities that get people thinking and sharing. Our primarily goal will be creating discussion activities that feel comfortable to people who have little experience in government outreach participation. For both workshops, PlaceWorks will manage logistics and prepare presentation materials (such as PowerPoint slides), posters, and informational handouts. Our budget assumes that the City will handle expenses related to facility fees, tables and chairs, and refreshments. 2.1.1 Stakeholder Visioning Workshop We believe the City of La Quinta seeks both to revitalize the corridor into a vibrant economic hub as well as define a unique destination within the Coachella Valley. In other words, this project is about more than just capturing the market sector gaps. It is about defining a unique mix of uses and design framework that distinguishes it from the rest of the Valley. This requires the Project Team to be both creative but honestly realistic. To this end, a key component will be focus group events with stakeholders. First, to reimagine and position La Quinta as a unique destination along Highway 111, the Project Team will facilitate a visioning workshop that will engage the creative perspectives of stakeholders, property owners, businesses, residents, City Council and Planning Commissioners as well as support and inform the Audit of Corridor Standards (Task 3). It will be a single day; interactive workshop aimed to clarify and define values and vision that will guide the project and engage community in a unified direction. This workshop will employ visuals and interactive mapping techniques to foster ideas-sharing. This creative space should result in a mission statement that will inform the brand identity and unique establish values moving forward. Yolanda Sepulveda, with Spectacle Design, will serve as lead facilitator with support by PlaceWorks staff. We will work with the City to identify a guest list. Prior to the workshop, we may employ digital polling or other outreach strategies to inform the development of stakeholder visioning materials. 2.1.2 Defining the Possibilities Workshop The second workshop will focus on presenting the draft mobility, design, and zoning recommendations for the Corridor. We envision this workshop to be in the format of an open house with individual stations to present the different topics such as pedestrian and bicycle mobility, Corridor branding/theming, streetscape/ public realm improvements, and design and zoning. The open house format can be an effective way to present information and solicit feedback through one-on-one conversations that build relationships with the community. We will provide highly visual boards with imagery and sketches to convey and help visualize the concepts. Karen Gulley, Principal-in-Charge and Project Manager, will serve as overall facilitator with support by key PlaceWorks and RGA and LSA project team members staffing different stations. 2.2 FOCUS GROUP MEETINGS Following the First Stakeholder Visioning Workshop, we engage businesses, property owners, developers, City officials and staff, and other stakeholders to focus the Area Plan on facilitating private sector investment to implement the vision. Building on the work of the ULI TAP, the first focus group meeting will bring together the business community and City officials and concentrate on the challenges and opportunities of operating shopping, dining, and entertainment businesses in the project area. The purpose of this meeting is to identify economic development programs, services, and incentives to support new and expanded businesses and to identify regulatory, infrastructure, and building space issues that may impact the private sector’s ability to establish the project area as a regional destination. A second focus group meeting will bring together property owners, developers, investors, and retail/entertainment experts. The purpose of this meeting is to generate interest in developing new destinations in the project area and to understand how the City can best facilitate development of new destinations. During this meeting we will also explore what, if any, public uses could compliment private sector efforts to create a there there. 13 4. Scope of Work PROPOSAL FOR SERVICES | PLACEWORKS The final focus group meeting is aimed at implementation of the Area Plan. We will engage property owners and City representatives in discussing the costs to make proposed improvements and maintain those improvements over time. Although waiting for the City to have enough spare cash to make improvements is always an alternative, we intended this meeting to generate support for a landscaping and lighting maintenance district (or similar type of district) and other tools to get the proposed improvements constructed sooner rather than later. PlaceWorks will lead the meetings and be responsible for overall facilitation and organization of presentations by other team members. We assume that the City be responsible for invitations and meeting logistics. 2.3 ONLINE ENGAGEMENT Online opportunities for the public to stay informed about the project are valuable for building trust and transparency in the process. We assume that the City will create and maintain a web page within the City’s existing website for the project. PlaceWorks will assist staff with content updates throughout the project. PlaceWorks will also work with staff to make the final Highway 111Corridor Area Plan, as described in Task 10, available on the website in an accessible, interactive format. PlaceWorks will create a project fact sheet that outlines the project purpose, process, and general project description. The fact sheet will be posted on the web page as well as distributed at outreach events. Task 2 Deliverables: −Agenda, Meeting Summaries, and all workshop boards and materials (x 2) −Periodic content updates for the City to post to the project website −Project Fact Sheet TASK 3. AUDIT OF CORRIDOR DEVELOPMENT STANDARDS PlaceWorks will conduct a detailed audit of City regulatory documents pertaining to the Highway 111 corridor including the Highway 111 Design Guidelines, Zoning Code, and specific plans along the Corridor. We will create a matrix template covering key standards or guidelines that play a role in development along 111, and then populate it based on differences, inconsistencies, best practices/placemaking, and benefit/detriment to the Corridor. We will consider in terms of creativity and economic vibrancy, and barriers to implementation. We will consider including a ranking or scoring related to key design and economic development objectives. LSA will review the audit undertaken by PlaceWorks and confirm its completeness and applicability to the Area Plan vision and planning effort. LSA will also review recently completed traffic analyses (if available from the City) and other regional documents to identify the traffic volume profile in the corridor. This may be limited to average daily trips (ADT) along Highway 111 or may also include peak hour intersection performance at key locations within La Quinta. This audit will inform both the new code and standards recommendations of the Corridor Area Plan as well as inform determination on an approach to rescinding and/or amending the existing specific plans. Task 3 Deliverables: −Draft/Final Audit Matrix and Scoring Criteria TASK 4. COMPLETE STREETS PLAN: IDENTIFICATION OF IMPROVEMENTS The results of the recent TAP indicate a layered network approach to Complete Streets along the corridor. While Highway 111 is a high volume, high throughput, high speed vehicular corridor, opportunities exist to supplement this arterial with other parallel facilities to serve all users, ages and ability levels. PlaceWorks, together with LSA, will prepare a Complete Streets Plan based on the findings of a traffic and safety analysis. 4.1 TRAFFIC AND SAFETY ANALYSIS The key components of the traffic and safety analysis are detailed as follows: Road User County Data LSA will survey and collect mobility data in the project area. Vehicular traffic counts will be collected at up to 8 intersections and 10 roadway segments. Bicycle counts will be collected at all intersections and pedestrians will be surveyed as well. Hourly mobility profiles will be documented graphically by mode and by direction. Intersection delay and level of service will also be documented. Collision Data from Most Current 3 Years LSA will work with the City staff and request collision data along the Corridor for the last three years from the Crossroads database. LSA will create maps identifying collision type, mode, severity and contributing factor. This will inform a comparison of the Highway 111 experience in La Quinta with rates for similar facilities provided by Caltrans. Analysis of Existing Improvement Program Plans LSA will review the most recent City Capital Improvement Program and regional documents such as the Regional Transportation Plan/Sustainable Communities Strategy, the Coachella Valley Association of Governments LRTP, and the Regional Traffic Signal Synchronization Program for plans and programs influencing mobility through Highway 111. LSA will compile the analysis methodology and results in a technical memorandum to be reviewed by PlaceWorks and City staff. This analysis will inform the preparation of the Complete Streets Plan. 14 CITY OF LA QUINTA | DEVELOPMENT OF AN AREA PLAN FOR THE HIGHWAY 111 CORRIDOR 4. Scope of Work 4.2 DRAFT COMPLETE STREETS PLAN With the traffic and safety analysis completed, PlaceWorks will lead a collaborative effort with LSA to preparation the Complete Streets Plan. The objective of the Plan will be to safely accommodate all users within a specified travel corridor while balancing various needs. LSA has already made recommendations in the TAP for a hierarchy of facilities between Washington and Jefferson Streets. We believe the CV Link will provide significant mobility benefits for leisure and purpose cycling and walking. We will use guidance from sources such as Caltrans, Cal-EPA, NACTO and ITE as well as our expertise from working on similar efforts such as Los Gatos Boulevard in the City of Los Gatos and Foothill Boulevard in the City of Glendale to define a tailored Complete Streets Plan. We will create a program that responds to demand within the corridor (as evidenced by the mobility count and profile data), proactively addresses safety concerns, including collision occurrence, climate (heat) and exposure, and sets forth a clear and trackable roadmap for implementation. Goals and Objectives Concurrent with the assessment of existing conditions, PlaceWorks will develop a menu of goals and objectives to guide the Complete Streets Plan for Highway 111. The Plan will incorporate statewide and regional goals for safety, sustainability, resiliency, mobility, accessibility, and equity. The Plan will satisfy statewide and regional goals to improve multi-modal travel, integrate land use and transportation, and reduce greenhouse gas emissions. PlaceWorks and LSA will incorporate locally-driven goals based on feedback from the recently completed TAP effort and input received as part of the stakeholder engagement program for the project. Linking initial project goals and objectives with regional, statewide, and other local goals during the early stages of the project will ensure that the policies developed for the Complete Streets Plan will transfer seamlessly into project and program recommendations, viable funding opportunities, and expedite implementation. Policy Review PlaceWorks will review policy documents relevant to the area and mapping efforts available from the City of La Quinta. Based on the policy review, we will document the standards and guidance used to define Complete Streets in the context of Highway 111. We will also review any GIS layers we currently have on file in the project area. Through our team’s involvement in analyses of pedestrian, bicycle, and transit infrastructure for the TAP, we feel that a significant amount of data from that effort can be used to develop the analysis for the Complete Streets Plan, leading to cost and schedule efficiencies. The PlaceWorks team, at a minimum, will review the following documents/maps as part of this project: ƒSCAG RTP/SCS ƒCVAG LRTP ƒCVAG Active Transportation Plan ƒCVAG’s Regional Traffic Signal Synchronization Project - Traffic Signal Interconnect Master Plan ƒCapital Improvement Program for the Highway 111 Corridor ƒCurrent CV Link alignments Funding Opportunities Summary and Matrix PlaceWorks will outline implementation next steps and perform a survey of regional, state, and federal funding sources, summarized through a funding matrix to implement improvements. We will also complete a comprehensive analysis of locally generated and unconventional funding sources; private foundations, corporate donors, local endowments, development impact fees, public- private partnerships, and grant programs. These funding sources will likely have smaller dollar amounts than federal, state, and regional ones, but they may be less competitive, increasing chances that program and infrastructure elements will get funding. We will then finalize the implementation strategy through a prioritized list of project improvements. The final Complete Streets Plan will be a chapter in the Area Plan, including colored maps illustrating important elements and the hierarchy of facilities in the context of existing land uses. This scope includes coordination with City staff for preparation of a draft Complete Streets Plan and one set of revisions and refinements to deliver the Final Complete Streets Plan based on one consolidated set of comments. Task 4 Deliverables: −Draft/Final Traffic and Safety Analysis Memorandum −Draft Goals and Objectives −Policy Review Memorandum −Funding Summary and Matrix −Draft/Final Complete Streets Plan (chapter) TASK 5. CORRIDOR BRANDING PROGRAM The Project Team, led by Spectacle Design, will prepare a project guidebook. This guidebook will support planning and future development efforts, inform placemaking, signage, entryway monuments, and experiential moments along the corridor. The intent is to set a foundation for increasing visitation and the customer base in La Quinta. The guidebook will include a summary of findings gathered from the visioning session (inclusive of mood and reference images) that capture the brand identity of who La Quinta wants to be within the Highway 111 corridor. This guidebook will inform all other efforts and ensure a consistency in design intent through a crafted experience that can be applied to the public realm and private development. The book will include environmental graphic design examples, prototypical signage style boards that are supportive of wayfinding and placemaking efforts. 5.1 LANDSCAPE AND ENTRY MONUMENT DESIGN FOR MEDIANS AND PARKWAYS The Project Team, led by RGA, will prepare a comprehensive public realm design plan that establishes a new image and identity for the Highway 111 Corridor. Informed by the initial visioning branding efforts this will include a detailed landscape design plan with planting plan diagrams, inorganic material and artwork locations, sections, plant imagery, a plant palette and narratives for the medians, parkways, and other public realm opportunities. 15 4. Scope of Work PROPOSAL FOR SERVICES | PLACEWORKS It will also translate the project guidebook brand program into an entryway monument plan including colors, materials, sections and locations. Task 5 Deliverables: −Draft/Final Project Guidebook (up to 15 pages) −Draft/Final Landscape and Entry Monument Design Plan TASK 6. CORRIDOR DESIGN GUIDELINES AND VISUAL SIMULATIONS PlaceWorks will develop comprehensive Design Guidelines to be evocative of the intended vision, character, and quality of development within the Corridor. The guidelines will emphasize the unique qualities that distinguish La Quinta from other cities in the Coachella Valley. Task 6 will create a framework for the creation of high quality, cohesive, and inspired design, the Design Guidelines and new codes and standards. It is the vehicle for change within the Corridor. The following is a list of sections to be included: 6.1 BUILDING/SITE DESIGN GUIDELINES Optimization of undeveloped properties and unused parking areas within the Corridor is the first step toward creating pockets of urbanization that will serve as catalysts for change. PlaceWorks will explore creative possibilities and develop concepts for two infill sites that will lead the way toward the creation of a dynamic, environments serving as a magnet for seasonal visitors and residents. As part of this task, LSA will also conduct a parking code and utilization review. Creating engaging, memorable experiences is a major part of fostering economic growth. The concepts will inspire potential development that will set a high standard for future endeavors. 6.2 LANDSCAPE/STREETSCAPE GUIDELINES Pedestrian oriented, engaging streetscape design will be the focus of the landscape portion of the Design Guidelines. Cohesive shade, color, and texture as well as environmentally sensitive design will be emphasized. 6.3 TEXT AND GRAPHIC ILLUSTRATIONS Creation of a document that is user-friendly, and simplifies interpretation for the City, while setting a high standard is the goal of Design Guidelines. Text will be clear, concise, and easily understood, while illustrations will include photographs, vignettes, and diagrams to aid in the practical application of the intent of the provisions. 6.4 COMPUTER MODELING/ PHOTOREALISTIC SIMULATIONS Visual simulations bring two-dimensional plans to life and serve an important role in the process of conveying the intended solution. The Project Team recognizes the value of these tools and how the models aid in the design process, allowing decision makers to review realistic alternatives before committing resources for implementation. This scope assumes PlaceWorks, together with RGA, will prepare two photorealistic simulations of the branding, streetscape, landscape and development standard recommendations. Task 6 Deliverables: −Draft/Final Design Guidelines (inclusive of all graphics and illustrations) −Up to two visual simulations of the Corridor TASK 7. NEW CODE AND STANDARD REVISIONS TO THE CITY’S DEVELOPMENT CODE 7.1 MIXED-USE OVERLAY & NON- RESIDENTIAL CODE REVISIONS Standardization of Development Codes within the Corridor was a key recommendation of the TAP report. Flexible standards that allow for market-driven, new ideas will be an important step to assure creative solutions aren’t prohibited. PlaceWorks will conduct a thoughtful analysis of the results of the Task 3 Development Standards Audit to prepare new code and development standards which will apply to all properties within the Corridor area. 7.2 REVISIONS TO EXISTING CORRIDOR SPECIFIC PLANS Along with zoning and development standard revisions, PlaceWorks will also prepare a set of clear recommendations for revisions and/or rescinding existing specific plans within the Corridor. As stated above, standardizing the codes and design standards across all properties within the Corridor will bring consistency to the development that occurs. This scope assumes that City Staff will implement the development standards and other recommendations once the decision to amend or rescind the existing Corridor Specific Plans has been made. Task 7 Deliverables: −Draft/Final Matrix of Development Standards for Mixed Use Overlay and Non-Residential Uses including permitted uses, coverage, FAR, setbacks, height, parking, and signage −Draft/Final Matrix of Development Standards for Residential will include permitted uses, density, setbacks, height, building separations, parking, and lot coverage TASK 8. IMPLEMENTATION PROGRAM PlaceWorks will develop an Implementation Program that establishes the catalyst and momentum for real change within the Corridor. The Project Team will include innovative procedures such as those we incorporated into the Beach Boulevard Corridor Specific Plan for the City of Anaheim for keeping the implementation process living and breathing through mechanisms to adjust and respond to changing conditions over time. The implementation program will include an economic development strategy identifying short-term and longer- term actions to incentivize private sector development and re-investment, facilitating construction and maintenance of public realm improvements, and supporting new and expanded 16 CITY OF LA QUINTA | DEVELOPMENT OF AN AREA PLAN FOR THE HIGHWAY 111 CORRIDOR 4. Scope of Work businesses that transform the project area into a regional destination. All the actions related to mobility and streetscape, identity and branding, infrastructure, and economic development will be organized in a matrix format and include responsibility and potential funding sources. Public financing and innovative partnerships have become vital since redevelopment funds ended in California. Potential sources include formation of assessment districts, public/private partnerships, ground leases for City owned land. Task 8 Deliverables: −Implementation program, including potential sources of funding and responsibility matrix −Recommendations for engaging local artists and formation of a coalition to encourage local talent −Suggestions of tools for public engagement to generate interest in the Corridor, possibly using technology and temporary structures TASK 9. PUBLIC HEARINGS This scope assumes PlaceWorks will attend up to three adoption hearings (one Planning Commission and two City Council) for review and comment on the Area Plan. This task includes preparation for the hearings (PowerPoint shows, presentation boards, etc.) and attendance by the PIC/ Project Manager and Task Leads and subconsultants as determined by the City. Task 9 Deliverables: −Attendance, presentation boards and other materials and PowerPoint for up to three Planning Commission and/or City Council adoption hearings. TASK 10. CORRIDOR AREA PLAN Building off the tasks to date and bringing together the final draft of deliverables prepared in Tasks 3-8, the Project Team will develop the Draft Corridor Area Plan. The plan will bring together the vision, development standards audit findings, complete streets plan, corridor branding program and new guidelines and standards recommendations and graphics. It will incorporate a creative, yet realistic approach to economic development, reinvestment, redevelopment and revitalization. Design recommendations will bring consistency and a defined brand and character to the Corridor. Implementation, economic development strategies and administration of the plan will also be creatively addressed in the Area Plan. PlaceWorks will create a user-friendly graphically rich Area Plan document. The document will contain diagrams, illustrations, tables, and text to convey necessary information in a way that is easy to understand and transfer into City code and ordinances. We will work with City staff to prepare the Area Plan in a format this is well suited for the City–our team is proficient in creating plans in both Adobe In-Design and Microsoft Word. This scope assumes the preparation of a Draft Area Plan for review and comment by City staff. Based on one consolidated set of comments, PlaceWorks will prepare a Final Area Plan for consideration and adoption by decision makers (see Task 9.2). Task 10 Deliverables: −Draft/Final Highway 111 Corridor Area Plan OPTIONAL TASKS In addition to the core scope of work described above, PlaceWorks suggests the following additional tasks should additional budget be available: TASK A. WAYFINDING/SIGNAGE PROGRAM As part of the larger corridor branding program developed for the Area Plan, PlaceWorks will provide guidance for directing cyclists and pedestrians to the proposed CV Link alignment as well as appropriate sidewalks, bikeways, multi-use trails, retail, recreational amenities, and other locations identified along the Highway 111 corridor. One consolidated set of comments from the City will be provided in advance of preparing the final wayfinding sign program for the Highway 111 Corridor Area Plan. Optional Task A Deliverable: −Wayfinding Program TASK B. COST ESTIMATE As an optional task, the PlaceWorks team would provide a cost estimate for the implementation of the landscape design. This will greatly assist the City with phasing the project and setting aside revenues to prepare for future improvements. The cost estimate will also assist with the decision-making process at an early stage to streamline the preparation of construction documents. Optional Task B Deliverables: −Cost Estimate for hardscape improvements, softscape plan, street furniture, and shade structures −Cost estimate for preparation of final landscape plans including design development stage, and construction documents. 17PROPOSAL FOR SERVICES | PLACEWORKS 5. Schedule/Timeline On the following page is a schedule showing our estimated 8-month timeline for completion of the proposed scope of work, showing all work completed by the end of July 2019, follows the cost proposal provided in Section 7. “PlaceWorks has proven its ability to over deliver on quality while staying on schedule and within budget. I heartily recommend PlaceWorks for any work that requires creative, yet realistic, land use and design skills; an ability to generate consensus and enthusiasm among the general public, key stakeholders, and city leadership; and a commitment to the client’s goals and objectives.” − Steven A. Mendoza City of Los Alamitos 18 CITY OF LA QUINTA | DEVELOPMENT OF AN AREA PLAN FOR THE HIGHWAY 111 CORRIDOR 5. Schedule/Timeline 123412341234123412341234123412341.1Project Kick-off MeetingX1.2Day-to-Day Project Management1.3Client/Project Team Meetings2.1Community Workshops (2)2.2Focus Group Meetings (3)2.3Online EngagementTASK 3. AUDIT OF CORRIDOR DEVELOPMENT STANDARDSAudit of Corridor Development StandardsTASK 4. COMPLETE STREETS PLAN4.1Traffic and Safety Analysis4.2Draft Complete Streets PlanTASK 5. CORRIDOR BRANDING PROGRAM5.1Project Guidebook5.2Landscape and Entry Monument Design for Medians and Parkways6.1Building/Site Design Guidelines6.2Landscape/Streetscape Guidelines6.3Text and Graphic Illustrations6.4Computer Modeling/Photorealistic Simulations (2)7.1Mixed-Use Overlay & Non-Residential Code Revisions7.2Revisions to Existing Corridor Specific PlansImplementation ProgramTASK 9. PUBLIC HEARINGS/WORKSHOPSAdoption Hearings10.1Draft Corridor Area Plan10.2Final Corridor Area Plan City Review PeriodMeetingsDeliverable/ProductNotes:TASK 6. CORRIDOR DESIGN GUIDELINES AND VISUAL SIMULATIONSTASK 7. NEW CODE AND STANDARD REVISIONS TO THE CITY'S DEVELOPMENT CODETASK 8. IMPLEMENTATION PROGRAM2019JANUARYFEBRUARYMARCHAPRILTASK 10. CORRIDOR AREA PLANTASK 1. PROJECT TEAM COORDINATIONTASK 2. STAKEHOLDER ENGAGEMENT PROGRAMMAYJUNEJULY2018DECEMBERDETAILED PROJECT SCHEDULELa Quinta Highway 111 Corridor Area Plan 19PROPOSAL FOR SERVICES | PLACEWORKS 6. References Provided below are descriptions of each of our team members most relevant project experience along with client contact information for references. Project Client Contact Description of Services PLACEWORKS Morena Boulevard Corridor Specific Plan and EIR CITY OF SAN DIEGO Laura C. Black, AICP | Deputy Director, Planning Department 9485 Aero Drive, San Diego, CA 92123 619.533.4549 | lblack@sandiego.gov PlaceWorks managed the specific plan and EIR for a transit-oriented specific plan along Morena Boulevard in San Diego to facilitate reinvestment and development of a post-World War II suburban character neighborhood to support two future light rail stations. El Camino Real On the Go! CITY OF ATASCADERO Phil Dunsmore | Community Development Director 6500 Palma Avenue, Atascadero, CA 93422 805.470.3488 | pdunsmore@atascadero.org A 5-mile corridor plan to revitalize the main north-south thoroughfare providing the primary access to services, the downtown core, and surrounding neighborhoods in the City of Atascadero. The Groves at Loma Linda PLANNING PLUS/P+ for CITY OF LOMA LINDA Melanie Traxler | Contract Planner 2701 Prospect Avenue, La Crescenta, CA 91214 818.248.7158 | mtraxlerpplus@aol.com A specific plan for a 300-acre undeveloped parcel within the heart of Loma Linda. PlaceWorks was brought in to lead an outreach process with city leaders and the community working together to define a vision and development plan for the area. Harbor Mixed-Use Transit Corridor CITY OF SANTA ANA AND SCAG Sergio Koltz | City of San Juan Capistrano (formerly City of Santa Ana) 32400 Paseo Adelanto, San Juan Capistrano, CA 92675 949.443.6331 | planningdept@sanjuancapistrano.org PlaceWorks helped the City of Santa Ana evaluate zoning designations along transit corridors throughout Santa Ana to expand land use options and establish an urban fabric that takes advantage of transportation improvements. PlaceWorks subsequently developed the Harbor Corridor Plan and laid the foundation for a more livable corridor. Beach Boulevard Corridor Plan and EIR CITY OF ANAHEIM Susan Kim, AICP | Principal Planner 200 South Anaheim Boulevard, Room 162, Anaheim CA 92805 714.765.4958 | skim@anaheim.net A plan to guide future development along a 1.5-mile stretch of Beach Boulevard between the cities of Buena Park and Stanton. The intent of the plan is to create a new regulatory environment, land use plan, development incentives, and streetscape enhancements to improve conditions along the boulevard and attract economic investment to the area. LSA ASSOCIATES (Transportation Planning) City of La Quinta Technical Assistance Panel CITY OF LA QUINTA Frank Spevacek | City Manager 78-495 Calle Tampico, La Quinta, CA 92253 760.777.7030 | gperez@la-quinta.org Generating more than 70% of the sales tax revenue for the City, land uses along the Highway 111 corridor are a significant contributor to the financial security of the community. LSA conducted baseline research into all modes of travel: vehicular, Sunline transit, cycling, and CV Link and pedestrians to describe the existing setting. LSA linked this setting to a general planning environment including housing, commercial/retail activities, auto sales and new foreseeable development initiatives. La Quinta Village Complete Streets GHD Lindsey Van Parys, PE QSD/QSP | Project Manager 943 Reserve Dr., Suite 100, Roseville, CA 95678 916.782.8688 | lindsey.vanparys@GHD.com LSA assisted the City of La Quinta with environmental compliance for a project to convert La Quinta Village into a bicycle and pedestrian friendly, “Complete Street” atmosphere. The three major streets will be reduced from four lanes to two and will include bicycle facilities and on-street parking. In addition, five roundabouts will be constructed to link the road diet segments together. 20 CITY OF LA QUINTA | DEVELOPMENT OF AN AREA PLAN FOR THE HIGHWAY 111 CORRIDOR 6. References Project Client Contact Description of Services RGA LANDSCAPE ARCHITECTS (Landscape Architecture) Fred Waring Drive Median Islands CITY OF PALM DESERT Diane Hollinger | Landscape Specialist 73510 Fred Waring Drive, Palm Desert, CA 92260 760.776.6444 | dhollinger@cityofpalmdesert.org Redesign of median islands and adjacent parkway on both sides of Fred Waring Drive for a distance of 2.5 miles. Project included coordination with two city governments (Palm Desert and Indian Wells) and two water districts (Coachella Valley Water District and Imperial Irrigation District). Tahquitz Canyon Way Median Islands CITY OF PALM SPRINGS Marcus Fuller | Assistant City Manager 3200 E. Tahquitz Canyon Way, Palm Springs, CA 92262 760.322.8380 | marcus.fuller@palmsprings-ca.gov This median island and streetscape enhancement project included development of four design “zones” over a 3-mile corridor from downtown Palm Springs to the airport, with each of the zones reflecting the character of its neighborhood. Included coordination with many stakeholders and government agencies. SPECTACLE DESIGN (Branding and Placemaking) San Ysidro Port of Entry US GENERAL SERVICES ADMINISTRATION David Leites | Supervisory Architect 50 United Nations Plaza, San Francisco, CA 94102-4912 415.522.3284 | David.leites@gsa.gov Through facilitation of a design workshop focused on identify assets, points of interest community pride and missed opportunities, Spectacle engaged a diverse group of stakeholders to participate in a design exercise aimed at honoring local pride and capturing a local perspective. These solutions are now public on the GSA website for any agency on either side of the border to implement. ULI Strategic Plan, Toolkit URBAN LAND INSTITUTE Kendra Chandler | Executive Director 23 Corporate Plaza, Suite 150, Newport Beach, CA 92660 714.342.2965 | Kendra.chandler@uli.org In an effort to define an identity for the ULI Orange County/Inland Empire District Council, Spectacle worked with governance and key leaders within ULI OC/IE to map a strategy session and facilitate a dialogue of diverse perspectives that would inform an overall work program and refreshed identity. Toolkit Link West Grove Retail Corridor Downtown Revitalization CITY OF GARDEN GROVE Lisa Kim | City Manger 11222 Acacia Parkway, Garden Grove, CA 92840 714.741.5100 | lisak@ci.garden-grove.ca.us Spectacle helped to organize visioning workshops and perform a community asset audit to address issues of community sentiment, land owner challenges, and City staff hurdles that had prevented progress in the Valley View Business Corridor. Spectacle worked with ULI to assemble a panel and conduct a TAP that would get to the heart of the problem that had left retail unsuccessful. Short- and long-term strategies addressing these hurdles were presented to the City and will be published with ULI. 21PROPOSAL FOR SERVICES | PLACEWORKS 7. Cost Proposal Our estimated budget identifying each task, projected hours, and rates for completion, including any reimbursable costs, is $252,408 OPTIONAL TASKS Our scope and estimated budget identify two optional task— preparation of a Wayfinding Program and preparation of a Cost Estimate. The cost for these optional tasks would be $17,929 and $1,638 respectively in addition to the overall cost proposal detailed on the following page. THE PLACEWORKS TEAM La Quinta Highway 111 Corridor Area Plan DETAILED COST PROPOSAL RGA LANDSCAPE ARCHITECTURE (Landscape Design)5%5%5% KAREN GULLEY BROOKE PETERSON SHEILA CEDERVALL MATT GELBMAN YUE ZHANG STEVE GUNNELLS MIKE NILSSON RON GREGORY JARVIS PAYNE ESTER WANG BELINDA CRADDOCK YOLANDA SEPULVEDA Title:Managing Principal Associate Principal Senior Associate Associate Plnr/ Designer Project Designer Chief Economist Senior Associate Principal Landscape Architect Associate Administrative Manager Principal Associate Assistant Planner Principal Senior Associate Role:Principal-in- Charge/Project Manager Planning Lead Design Lead Assistant Project Manager Project Designer Principal Economist Transportation Planner Principal Landscape Architect Lead Designer Design Assistant/ Drafter Project Administration Project Manager Transportati on Engineer Planning/ Engineering Word Processing Graphics Project Manager Designer Task Task Description Hourly Rate:$225 $180 $195 $145 $105 $215 $175 $125 $85 $200 $150 $100 $80 $225 $185 $90 $135 $145 $180 $140 Task 1. Project Team Coordination 1.1 Project Kick-off Meeting 6 4 4 6 20 $3,794 4 4 8 $1,470 4 4 $945 1 1 $189 33 $6,398 1.2 Day-to-Day Project Management 24 8 32 $6,691 0 $0 0 $0 0 $0 32 $6,691 1.3 Client/Project Team Meetings 24 12 36 $7,283 0 $0 0 $0 8 8 $1,512 44 $8,795 Task 1. Subtotal 54 4 4 26 0 0 0 0 0 88 $17,768 4 4 0 0 8 $1,470 4 0 0 0 0 4 $945 9 0 9 $1,701 109 $21,884 Task 2. Stakeholder Engagement Program 2.1 Community Workshops 16 6 6 36 16 80 $13,005 4 4 8 $1,470 8 8 16 $3,444 46 38 84 $14,280 188 $32,199 2.2 Focus Group Meetings 8 12 16 36 $7,120 4 4 8 $1,470 0 $0 0 $0 44 $8,590 2.3 Online Engagement 4 28 32 $5,059 0 $0 0 $0 0 $0 32 $5,059 Task 2. Subtotal 28 6 6 76 16 16 0 0 0 148 $25,184 8 8 0 0 16 $2,940 8 8 0 0 0 16 $3,444 46 38 84 $14,280 264 $45,848 Task 3. Audit of Corridor Development Standards Audit of Corridor Development Standards 4 16 50 70 $11,251 6 36 42 $6,930 4 10 20 34 $4,778 0 $0 146 $22,958 Task 3. Subtotal 4 16 0 50 0 0 0 0 0 70 $11,251 6 36 0 0 42 $6,930 4 10 20 0 0 34 $4,778 0 0 0 $0 146 $22,958 Task 4. Complete Streets Plan 4.1 Traffic and Safety Analysis 0 $0 0 $0 4 24 40 68 $9,387 0 $0 68 $9,387 4.2 Draft Complete Streets Plan 4 6 32 8 8 58 $9,231 2 4 6 $1,050 4 6 0 16 26 $4,547 0 $0 90 $14,828 Task 4. Subtotal 4 0 0 6 0 0 32 8 8 58 $9,231 2 4 0 0 6 $1,050 8 30 40 0 16 94 $13,934 0 0 0 $0 158 $24,215 Task 5. Corridor Branding Program 5.1 Project Guidebook 0 $0 0 $0 0 $0 30 50 80 $13,020 80 $13,020 5.2 Landscape and Entry Monument Design for Medians and Parkways 6 30 4 40 $7,936 6 60 66 $10,710 2 4 2 8 $1,439 0 $0 114 $20,084 Task 5. Subtotal 6 0 30 4 0 0 0 0 0 40 $7,936 6 60 0 0 66 $10,710 2 4 2 0 0 8 $1,439 30 50 80 $13,020 194 $33,104 Task 6. Corridor Design Guidelines & Visual Simulations 6.1 Building/Site Design Guidelines 8 10 30 8 12 68 $12,107 1 9 9 19 $2,573 4 8 16 2 4 34 $4,904 0 $0 121 $19,583 6.2 Landscape/Streetscape Guidelines 8 4 12 $2,183 2 32 18 52 $7,350 0 $0 0 $0 64 $9,533 6.3 Text and Graphic Illustrations 18 32 40 90 $12,322 2 6 18 26 $3,255 2 4 0 6 $1,250 0 $0 122 $16,826 6.4 Computer Modeling/Photorealistic Simulations (2)2 32 34 $3,886 2 4 32 38 $4,410 0 $0 0 $0 72 $8,296 Task 6. Subtotal 10 28 38 44 84 0 0 0 0 204 $30,498 7 51 77 0 135 $17,588 6 12 16 2 4 40 $6,153 0 0 0 $0 379 $54,239 Task 7. New Code and Standard Revisions to the City's Development Code 7.1 Mixed-Use Overlay & Non-Residential Code Revisions 4 8 32 44 $7,120 2 6 8 $1,365 0 $0 0 $0 52 $8,485 7.2 Revisions to Existing Corridor Specific Plans 2 10 8 20 $3,478 0 $0 0 $0 0 $0 20 $3,478 Task 7. Subtotal 6 18 0 40 0 0 0 0 0 64 $10,598 2 6 0 0 8 $1,365 0 0 0 0 0 0 $0 0 0 0 $0 72 $11,963 Task 8. Implementation Program Implementation Program 4 10 18 16 48 $8,925 2 6 8 $1,365 2 4 2 8 $1,439 0 $0 64 $11,729 Task 8. Subtotal 4 10 0 18 0 16 0 0 0 48 $8,925 2 6 0 0 8 $1,365 2 4 2 0 0 8 $1,439 0 0 0 $0 64 $11,729 Task 9. Public Hearings / Workshops Adoption Hearings 12 12 $2,754 0 6 6 $945 8 8 $1,890 0 $0 26 $5,589 Task 9. Subtotal 12 0 0 0 0 0 0 0 0 12 $2,754 0 6 0 0 6 $945 8 0 0 0 0 8 $1,890 0 0 0 $0 26 $5,589 Task 10. Corridor Area Plan 10.1 Draft Corridor Area Plan 2 10 20 6 6 44 $6,538 2 0 12 14 $1,680 0 $0 0 $0 58 $8,218 10.2 Final Corridor Area Plan 2 2 8 12 $1,520 2 0 12 14 $1,680 0 $0 0 $0 26 $3,200 Task 10. Subtotal 2 12 0 22 8 0 0 6 6 56 $8,058 4 0 24 0 28 $3,360 0 0 0 0 0 0 $0 0 0 0 $0 84 $11,418 Task A. Wayfinding/Signage Program (Optional) Wayfinding Program 4 8 16 50 28 8 114 $16,249 2 8 10 $1,680 0 $0 0 $0 124 $17,929 0 $0 0 $0 0 $0 0 $0 0 $0 Task A. Subtotal (Optional Task)4 0 8 16 50 0 28 8 0 114 $16,249 2 8 0 0 10 $1,680 0 0 0 0 0 0 $0 0 0 0 $0 124 $17,929 Task B. Cost Estimate (Optional) Cost Estimate 0 $0 1 4 6 2 13 $1,638 0 $0 0 $0 13 $1,638 Task B. Subtotal (Optional Task)0 0 0 0 0 0 0 0 0 0 $0 1 4 6 2 13 $1,638 0 0 0 0 0 0 $0 0 0 0 $0 13 $1,638 Labor Hours Total 130 94 78 286 108 32 32 14 14 788 $132,202 41 181 101 0 323 $47,723 42 68 80 2 20 212 $34,020 85 88 173 $29,001 1496 $242,946 Labor Dollars Total $29,250 $16,920 $15,210 $41,470 $11,340 $6,880 $5,600 $1,750 $1,190 $132,202 $8,200 $27,150 $10,100 $0 $47,723 $9,450 $12,580 $7,200 $270 $2,900 $34,020 $15,300 $12,320 $29,001 $242,946 PlaceWorks Percent of Total Labor 8.7%6.3%5.2%19.1%7.2%2.1%2.1%0.9%0.9%2.7%12.1%6.8%0.0%2.8%4.5%5.3%0.1%1.3%5.7%5.9% Subconsultants Reimbursable Expenses $0 $2,625 $1,575 $263 $4,463 PlaceWorks Reimbursable Expenses $5,000 REIMBURSABLE EXPENSES TOTAL $9,462 PlaceWorks 2% of Labor for Office Expenses $2,592 Labor Hours Total with Optional Tasks 134 94 86 302 158 32 60 22 14 902 $148,451 44 193 107 2 346 $51,041 42 68 80 2 20 212 $34,020 85 88 173 $29,001 1633 $262,512 Labor Dollars Total With Optional Tasks $30,150 $16,920 $16,770 $43,790 $16,590 $6,880 $10,500 $2,750 $1,190 $148,451 $8,800 $28,950 $10,700 $160 $51,041 $9,450 $12,580 $7,200 $270 $2,900 $34,020 $15,300 $12,320 $29,001 $262,512 PlaceWorks Percent of Total Labor with Optional Tasks 8.2%5.8%5.3%18.5%9.7%2.0%3.7%1.3%0.9%2.7%11.8%6.6%0.1%2.6%4.2%4.9%0.1%1.2%5.2%5.4% GRAND TOTAL $252,408 GRAND TOTAL WITH OPTIONAL TASKS $271,975 Optional Tasks, not listed in Scope of Work NOTES: Subconsultant costs are billed at cost plus 5%. Reimbursable expenses are billed at our current rates plus 2% of labor for office expenses. Mileage is billed at the current IRS-approved rate. PlaceWorks Hours TOTAL TASK BUDGET TOTAL LABOR HOURS LSA Associates Labor Total (incl. 5% mark-up) RGA Landscape Architecture Labor Total (incl. 5% mark-up) SPECTACLE Labor Total (incl. 5% mark-up) PlaceWorks Labor Total with 2% SPECTACLE Hours SPECTACLE (Corridor Branding) RGA Landscape Architecture Hours LSA ASSOCIATES (Transportation & Mobility) TECHNICAL EDITING WP/ CLERICAL PLACEWORKS (Prime Consultant) LSA Associates Hours APPENDIX A. Resumes A-1PROPOSAL FOR SERVICES | PLACEWORKS Appendix A. Resumes Provided on the following pages are full resumes for each proposed staff member. A-3 KAREN GULLEY Principal Karen has a talent for strategy and innovative problem solving that has been honed by over 25 years of experience. Her skill with all facets of community planning and design for private and public sector clients expands the opportunities for creative solutions. As Principal, she has developed a solid practice in transit-oriented development (TOD), infill development, and corridor revitalization. She specializes in assisting local communities with evaluating the potential for transit-oriented development associated with Metrolink, BRT, and urban circulation. Her work ranges from vision plans to implementation strategies, each developed in a collaborative effort with city staff, transit agencies, and the public. Karen also has extensive experience in specific plans, conceptual design studies, infill development strategies, general plans, military base reuse plans, and project implementation and entitlement. She has developed strong capabilities in inter- governmental coordination and project management. She regularly facilitates public meetings and workshops and is adept at establishing a rapport with her audience and communicating complex and often controversial issues clearly and accurately. She is an expert at developing tailored solutions in coding and design, project processing, negotiating conditions of approval, responding to political considerations, and handling communication between stakeholders. HIGHLIGHTS OF EXPERIENCE TRANSIT PLANNING/TRANSIT-ORIENTED DEVELOPMENT »Metro Green Line Extension | Norwalk CA »West Carson Specific Plan | County of Los Angeles CA »Irwindale TOD Specific Plan | Irwindale CA »Morena Boulevard TOD Specific Plan | San Diego CA »Bellflower Station TOD Specific Plan | Bellflower CA »Bellflower Station Design Study | Bellflower CA »Riverside Reconnects Streetcar Feasibility Study | Riverside CA »Fullerton College Connector Study | Fullerton CA »San Bernardino TOD Overlay | San Bernardino CA »Western Riverside BRT Route Planning and Station Area Studies | Western Riverside County CA »TOD: visioning, planning and design, and strategic implementation projects for the cities of Corona, Perris, Riverside, Hemet, San Bernardino, Temecula, March AFB, Montclair, Fontana, Brea, Fullerton, La Habra, Placentia, and Azusa as part of SCAG’s Compass Blueprint Demonstration Program »WRCOG Non-Motorized Transportation Plan | Western Riverside County CA »North Orange County Cities Go Local Program | Orange County CA CORRIDOR PLANNING »Beach Boulevard Specific Plan | Anaheim, CA »Harbor Boulevard Specific Plan | Santa Ana CA »Midtown Corridor Specific Plan | Long Beach CA »Katella and Los Alamitos Boulevard Corridor Plan | Los Alamitos CA »I-5 Freeway Expansion Analysis, I-5 Corridor Phase One, and Freeway Overlay Zone | Santa Fe Springs CA EDUCATION »BA, Economics, University of California, Santa Cruz »Masters Program, Urban & Regional Planning, California State Polytechnic University, Pomona (all but thesis) CERTIFICATIONS »Certificates from the International Association for Public Participation ̶Planning for Effective Public Participation ̶Strategies for Dealing with Opposition and Outrage in Public Participation AFFILIATIONS »American Planning Association »Urban Land Institute Team member since 1991 A-4 KAREN GULLEY Principal kgulley@placeworks.com »Corridor revitalization: planning and implementation projects for the cities of Glendora, Covina, Azusa, San Dimas, Irwindale, and Chino as part of SCAG’s Compass Blueprint Demonstration Program »Arrow Highway Corridor, Multi-Jurisdictional Planning in Corridors | San Gabriel Valley CA INFILL & REDEVELOPMENT »Brea Core Visioning and Specific Plan | Brea CA »CollegeTown Specific Plan | Fullerton CA »Crafton Hills College Village Plan | Yucaipa CA »Mixed Use Overlay Zones | Anaheim CA URBAN PLANNING »Southeast Area Specific Plan | Long Beach CA »Advanced Technology Education Park (ATEP) Framework Plan | Tustin CA »Tustin Legacy Specific Plan Update | Tustin CA »Carson Vision Plan | Carson CA COMPREHENSIVE PLANNING »WRCOG Economic Development and Sustainability Framework Plan | Western Riverside County CA »Rancho Cucamonga General Plan Update and EIR | Rancho Cucamonga CA »Economic Development Strategic Plan | San Bernardino County CA »Fontana General Plan Update & Zoning Code Consistency Program | Fontana CA LARGE-SCALE LAND PLANNING »MCAS Tustin Reuse Plan/Specific Plan | Tustin CA »Harmony Specific Plan | Highland CA »DeAnza Special Study, Mission Bay | San Diego CA »Kennecott Master Plan | Salt Lake County UT PLAN IMPLEMENTATION »WRCOG EXPERIENCE Feasibility Study | Western Riverside CA »Tustin Legacy Master Developer | Tustin and Irvine CA »Villages of Columbus Planning & Entitlements, MCAS Tustin | Tustin CA »Heritage Fields Development Plan Environmental Review | Irvine CA SPEAKING »“Guiding Infill Development: What Planning Commissioners Need to Know” | OC Association of Planning Officials Forum, 2016 »“Got a College? New Town/Gown/Industry Collaboration” | 2015 APACA State Conference; 2015 WRCOG Visioning Workshop »“Effective Elements of Corridor Planning” | APA San Diego Chapter, 2013 »“Campus and Community Life Coming Together” | 2011 APACA State Conference ARTICLES »“Repositioning Urban Corridors to Attract New Residential and Commercial Markets,” Urban Land, 2010 »“Sowing the Seeds of Regional Planning,” Urban Land, 2007 »“Reshaping the American Commercial Strip,” Urban Design Group Journal, Winter 2003 AWARDS »2015 Transportation Planning Award of Merit, APACA Orange Section | Fullerton College Connector (Streetcar) Study »2013 Best of the Best Award, ULI Orange County/Inland Empire | WRCOG Sustainability Framework »2009 Compass Blueprint Achievement Award in Prosperity, SCAG | Coachella’s South East SOI Sustainability Project A-5 BROOKE PETERSON, AICP Associate Principal Brooke’s career includes a wide variety of long-range policy planning, development project planning, urban design, and environmental planning experience for the public and private sectors. She has worked on general plans, community plans, corridor and specific plans, master plans, redevelopment, mixed-use and TOD development, regional energy plans, public health, urban greening, and public engagement. Brooke expertly leads high-profile, controversial projects such as the Morena Corridor Specific Plan and De Anza Revitalization Plan for Mission Bay in San Diego. She was project manager for the National City Comprehensive Plan Update EIR, which included the General Plan and Zoning Code Update, Climate Action Plan, and five development projects; Los Angeles County’s West Carson TOD Specific Plan; and the La Mesa Downtown Village Specific Plan. She heads PlaceWorks’ contract with the City of San Diego for planning as-needed services, which primarily entails the preparation of community, specific, and master plans. Brooke has expertise with land use–transportation integration, context-sensitive development, energy-efficient land use planning, stakeholder and public outreach, and facilitating issue resolution. She has also served as a direct extension of staff for a number of agencies to amend community plans, zoning ordinances, and design guidelines; manage consultants; and prepare findings and staff reports. HIGHLIGHTS OF EXPERIENCE »City of San Diego Planning As-Needed Services | San Diego CA »National City General Plan, Zoning Code Update, EIR, and Climate Action Plan | National City CA »Morena Boulevard Corridor Specific Plan and EIR | San Diego CA »De Anza Revitalization Plan | San Diego CA »La Mesa Downtown Village Specific Plan and MND | La Mesa CA »Mill Creek Specific Plan | Chino CA »Goodman Birtcher Specific Plan | Eastvale CA »Blackwater Training Camp Major Use Permit | San Diego County CA »Scripps Cypress Pointe Residential Development | San Diego CA »Washington Boulevard Light Rail Transit Corridor Study | Pico Rivera, Santa Fe Springs, Whittier CA »West Carson TOC Specific Plan and EIR | West Carson CA »Lake Elsinore General Plan and EIR | Lake Elsinore CA »Brawley General Plan Update | Brawley CA »County of Imperial General Plan Land Use and Circulation Element Update »Waterman Gardens Master Planning | San Bernardino CA »Upland Downtown Specific Plan | Upland CA »On-Call Visual Simulations Project – Imperial Beach | San Diego CA »On-Call Planning & Environmental Services | El Centro CA »San Diego Regional Energy Infrastructure Study | San Diego Region CA »Community Energy Partnership Program | San Diego Region CA »Irvine Sustainable Operations Strategic Plan | Irvine CA EDUCATION »Master of City and Regional Planning, California State University, San Diego »BA, Biology, Occidental College »Certificate in “Planning for Effective Public Participation,” International Association for Public Participation CERTIFICATIONS »American Institute of Certified Planners »Certificate in “Planning for Effective Public Participation,” International Association for Public Participation AFFILIATIONS »American Planning Association »San Diego Environment + Design Council »California Urban Forests Council »Urban Land Institute »Lambda Alpha International Team member since 2009 A-6 BROOKE PETERSON Associate Principal bpeterson@placeworks.com SPEAKING ENGAGEMENTS »“Strategic Thinking in the Planning Profession: Critical Thinking in a Political Environment” | 2015 APA California Annual State Conference | Oakland, CA »“Implementing Complete Streets in San Diego” | 2012 APA California Annual State Conference | Rancho Mirage, CA »“Ethical Dilemmas in Planning” | 2010–2015 APA CA Annual State Conferences | Oakland, Anaheim, Visalia, Rancho Mirage, Santa Barbara, and Carlsbad CA »“Linking Public Health and Planning” | 2008 Society for Public Health Education Annual Meeting | San Diego CA »“Integrating Community Forestry into Long-Range Planning” | 2008 California Urban Forests Conference | Ventura CA »“Introduction to CEQA” | 2007 California Urban Forests Conference | Lompoc CA ACTIVITIES »Board Member At-Large, Lambda Alpha International-San Diego | 2016 to present »President, APA California | 2012 to 2014 »Co-Chair, San Diego Environment + Design Council | 2013 to 2015 »San Diego Association of Governments (SANDAG) Mid-Coast Corridor Working Group | 2009 to 2012 »Board of Directors, APACA San Diego Section | 2003 to 2011 »Section Director, APACA San Diego Section | 2008 to 2011 »Public Information Officer, APA California | 2011 »County of San Diego-General Plan Update Interest Group Committee | 2008 to 2011 »President and Board Development Chair, California Urban Forest Council | 2003 to 2010 LEADERSHIP AND COMMUNITY »Board Member At-Large, Lambda Alpha International-San Diego | 2016 to present »Advisory Committee, CAL FIRE Urban and Community Forestry | 2011 »Board Member, Council of Design Professionals | 2011 to present »Chair, City of San Diego-Clairemont Community Planning Committee | 2004 to 2013 »City of San Diego-Community Planning Chairs Committee | 2006 to 2013 »Horton Plaza Park Advisory Committee | 2011 »Mayor’s Wireless Communications Facilities Policy Stakeholders Review Committee | 2009 to 2010 AWARDS »2013 Best of the Best Award, ULI Orange County/Inland Empire | WRCOG Sustainability Framework A-7 SHEILA L. CEDERVALL, ASLA, LEED AP Senior Associate Sheila is an urban designer with more than 25 years of experience bringing vibrant, cohesive, and environmentally friendly communities to life. Her experience includes all phases of design—from establishing the initial vision to working closely with local authorities to gain project approval. Sheila also specializes in sustainable building practices with an emphasis on water-wise landscape design. Sheila has considerable experience with the public sector and expertise in both landscape design and urban planning. Her work at PlaceWorks has included design concepts and park planning for several master planned communities—including Arbor Vista in Temecula, Harmony in Highland, Mill Creek in Chino, and Ramona Creek in Hemet. She also completed concepts for a new urban town center for the City of Menifee. Before coming to PlaceWorks, she completed several transit-oriented projects encouraging multimodal methods of transportation, including SoCo Walk in Fullerton and the Transit District of the Great Park Communities in Irvine. She also participated in the design of the Dana Headlands Nature Interpretive Center, a “Net Zero Energy” structure. HIGHLIGHTS OF EXPERIENCE »Ramona Creek Conceptual Landscape Plan | Hemet CA »Menifee Town Center Conceptual Streetscape Design | Menifee CA »Harmony Recreation Center, Parks, and Landscape Plan| Highland CA »Blue Greenway Trail Conceptual Design and Theming | San Francisco CA »Mill Creek Conceptual Park Plan | Chino CA »Arbor Vista Master Landscape and Park Plan | Temecula CA OTHER EXPERIENCE MASTER PLANNING »Hollywood Park | Inglewood CA »ParcLand Cossing | Chandler AZ »The Quorum | San Marcos CA »Rawabi Rumah | Riyadh, Saudi Arabia »The Villages of Columbus | Tustin CA »Arbor Ridge | Beaumont CA »Fagan Canyon | Santa Paula CA »Aquabella | Moreno Valley CA »One Ford Road | Newport Beach CA »The Garden District | Livermore CA »University Glen | Cal State Channel Islands CA RENEWABLE ENERGY »Community Center Nature Interpretive Center | Dana Point CA »Trevor Pearson Studio | Los Angeles CA »LEED Platinum Private Residence | Newport Beach CA EDUCATION »BS, Landscape Architecture, West Virginia University REGISTRATIONS »California Licensed Landscape Architect No. 5859 CERTIFICATIONS »LEED-Accredited Professional: Building, Design & Construction AFFILIATIONS »Urban Land Institute »American Society of Landscape Architects »US Green Building Council Team member since 2011 A-8 SHEILA L. CEDERVALL Senior Associate scedervall@placeworks.com TRANSIT-ORIENTED DESIGN »SoCo Walk | Fullerton CA »Great Park Communities Transit Oriented District | Irvine CA RESORT »The Reserve | Indian Wells CA »Peninsula at Hawaii Kai | Hawaii Kai, Hawaii »Marbella Club | Palmas Del Mar, Puerto Rico »Los Suenos Resort| Herradura, Costa Rica PUBLICATIONS »“Fill’er up, with the Sun,” San Clemente Journal, February 2011 »“Not for Rooftops Alone,” San Clemente Journal, March 2010 A-9 MATT GELBMAN, AICP Associate Matt has nearly 10 years’ experience working on a range of comprehensive planning projects throughout southern California and beyond. His most recent work includes providing comprehensive planning support for several community plan updates in San Diego, assisting with the Port of San Diego Master Plan Update (and Local Coastal Plan), and helping to create the Regional Transit Oriented Development Strategy for the San Diego Association of Governments. Matt also worked on zoning code updates for the cities of South Gate and Imperial Beach and has experience with planning public transportation, bicycle, and pedestrian projects. Matt is a skilled facilitator for public outreach, risk communication, and public- participation training. He specializes in online public outreach and has developed numerous websites and interactive online engagement tools. Matt is committed to thorough research in order to understand places, what makes them work, and the problems they face. He strives for the best possible communication through written, visual, and verbal methods to share findings and recommendations with decision makers and the public. HIGHLIGHTS OF EXPERIENCE »Southwest Village Specific Plan | San Diego CA »3Roots San Diego Master Planned Development Permit | San Diego CA »Morena Boulevard Corridor Specific Plan and EIR | San Diego CA »Clairemont Mesa Community Plan Update | San Diego CA »De Anza Cove Revitalization Plan | San Diego CA »Fiesta Island Amendment to Mission Bay Park Master Plan | San Diego CA »On-Call Contract Planning & CEQA Staff Assistance | Wildomar CA »El Camino Real Corridor Study | Atascadero CA »Active Transportation / Regional Commuter-Based Access Plan | Lake Elsinore CA »West Carson TOD Specific Plan and EIR | Los Angeles County CA »West Athens-Westmont TOD Specific Plan | Los Angeles County CA »Citrus Trails Master Plan | Loma Linda CA PRIOR EXPERIENCE »SANDAG Regional Transit Oriented Development Strategy | San Diego CA »South Gate Zoning Code Update | South Gate CA »Commercial / Mixed-Use Zones and Regulations Review | Imperial Beach CA »Best Practices for Implementation of SCAG’s Sustainable Communities Strategy | Los Angeles CA »Kearny Mesa Community Plan Update | San Diego CA »Midway-Old Town Community Plan Update | San Diego CA »High Speed Rail Station Area Master Plan | Fresno CA »TOD Feasibility Study | Rancho Cucamonga CA »Pacific Electric Right-of-Way / West Santa Ana Branch Corridor Alternative Analysis Planning Study | Los Angeles and Orange counties CA »SANDAG Regional Bike Map Update | San Diego CA »Main Street Promenade, Phase II | Lemon Grove CA »Comprehensive Active Transportation Strategy / Trails Master Plan | Carlsbad CA »Hurricane Sandy Housing Recovery Strategy | New York NY EDUCATION »Master of Urban and Regional Planning, University of California, Irvine »BA, Sociology, minor in Economics, Boston University CERTIFICATIONS »American Institute of Certified Planners AFFILIATIONS »American Planning Association »Founding Board Member, Encinitas Preservation Foundation Team member since 2016 A-10 MATT GELBMAN Associate mgelbman@placeworks.com PUBLICATIONS »“LiDAR Scanning for Historic Preservation: A Summary of the Historic Encinitas Boathouses Project,” Urban Design and Preservation Division Newsletter [APA], Summer 2011 A-11 STEVE GUNNELLS Chief Economist Steve’s career spans the spectrum of community planning and economic development. As PlaceWorks’ in-house economist, he plays a role in a great many of the firm’s active projects. He focuses on crafting plans, policies, and development projects that are grounded in regional and global economic realities. He helps his clients leverage market forces to achieve their goals. And most importantly, he uses his grasp of economics and real estate markets not only to overcome existing challenges but to help communities create visionary plans that capitalize on the possibilities, not just past trends. Steve works with communities to bridge the gap between long-range planning policies and economic development—with community organizations and special districts to fund and implement priority projects—and with developers to guide project decision-making and obtain entitlements based on sound economic and market analysis. Steve has also served as the field director for a consulting team on a World Bank project in Yemen, an Economic Development Fellow with the International Economic Development Council, a county planning director in Virginia, and a planning and economic consultant in Michigan and Ohio. HIGHLIGHTS OF EXPERIENCE ECONOMIC AND MARKET ANALYSIS »Logistics Industry Analysis | San Bernardino County CA »TDR Bank Benefits Analysis | Santa Fe County NM »Fiscal Impact Analysis, New Jersey Highlands Water Quality Protection and Regional Planning Act | Chester NJ »Economic Analysis, Collier County Rural Fringe Mixed-Use District TDR Restudy | Naples FL »Evaluation of Irvine Business Complex TDR Program | Irvine CA »Market Analysis for the Downtown Redding Specific Plan | Redding CA »Market Analysis, Southwest Fresno Specific Plan | Fresno CA »Economic, Market, and Fiscal Analysis | San Clemente CA »Market Analysis and Mixed-Use Development Feasibility Study | Chino CA »Downtown Market Assessment and TOD Feasibility Study | Fontana CA »Washoe County Economic Forecast and Analysis | Washoe County NV »Fresno Marketplace | Fresno CA »Dole Foods Atwater Plan and Market Analysis | Atwater CA ECONOMIC DEVELOPMENT PLANNING »Economic Development Element and Economic Development Strategic Action Plan | Corcoran CA »Re-envisioning Chino: Implementing the 2025 General Plan | Chino CA »Economic Development Feasibility Study for the California Community Foundation | El Monte CA »North Hemet Revitalization Plan | Riverside County CA »Economic Development Recommendations for the Southeast Industrial Area, SCAG Compass Blueprint Demonstration Project | Fullerton CA »Coachella Commercial Entertainment District Planning Study | Coachella CA EDUCATION »MSc, Development Management, London School of Economics »Master of Urban and Environmental Planning, University of Virginia »BA, Urban Planning, Virginia Tech AFFILIATIONS »American Planning Association »Urban Land Institute Team member since 2007 A-12 STEVE GUNNELLS Chief Economist sgunnells@placeworks.com COMPREHENSIVE PLANNING »San Bernardino Countywide Plan | San Bernardino County CA »Bloomington Community Plan | Bloomington CA »Westminster General Plan and EIR | Westminster CA »CollegeTown Specific Plan | Fullerton CA »Yucca Valley General Plan and EIR | Yucca Valley CA »San Clemente General Plan and EIR | San Clemente CA »Menifee General Plan and EIR | Menifee CA »Industry General Plan Update and EIR | Industry CA »Clovis General Plan Update and EIR | Clovis CA »Economic Development Element, El Monte General Plan | El Monte CA »Economic Development Element, The Ontario Plan | Ontario CA »Strategic Plan Update: Community Profile and Environmental Scan | Torrance CA URBAN AND REGIONAL PLANNING »Sustainability Plan Framework, Western Riverside COG | Riverside County CA »2015–2050 Growth Forecast Update | Kern Council of Governments »San Joaquin Valley Demographic Forecasts 2010 to 2050, Fresno COG | San Joaquin Valley CA »Life on State Corridor Plan, Wasatch Front Regional Council | Multi-jurisdictional, Salt Lake County UT »5600 West BRT Phase I Station Area Plan | Salt Lake County UT »Development Options around Transit Stations, SCAG Compass Demonstration Project | Azusa CA PRIOR EXPERIENCE »Downtown Development Plan, Buena Vista Charter Township | Saginaw County MI »Downtown Development Plan and Tax Increment Financing Plan, Lyon Charter Township | Oakland County MI »Development Plan and Tax Increment Financing Plan, Van Buren Charter Township | Wayne County MI »Tax-Increment-Financing Plan, Detroit Armory Redevelopment | Oak Park MI »Economic Development Program | Richmond County VA »Overall Economic Development Program | Westmoreland County VA »Urban Development, Management, and Tourism Assessment, World Bank | Republic of Yemen AWARDS »2013 Best of the Best Award, ULI Orange County/Inland Empire | WRCOG Sustainability Framework »2012 SCAG Compass Blueprint Recognition Award, Achievement in Sustainability | Re-envisioning Chino: Implementing the 2025 General Plan »Michael A. Hoffman Award (co-recipient), Council of Virginia Archaeologists | Acquisition and Preservation of the Morgan Jones Kiln Site, a National Register Site SPEAKING ENGAGEMENTS »“Rail and TOD: Getting on the Right Track” | 2015 ULI OC/IE District Council | Santa Ana CA »“Economic Development for Planners” | 2011 Southern California Association of Governments’ Toolbox Tuesdays | Los Angeles CA »“TOD and Downtown Development Opportunities” | 2010 Downtown Fontana Technical Advisory Roundtable | Fontana CA »“Mixed-Use Development: Myth or Must” (Panelist) | 2009 Developer Conference, Multifamily Executive Conference | Las Vegas NV A-13 MICHAEL NILSSON, AICP CTP Senior Associate, Active Transportation Michael Nilsson understands how to link land use, environmental, and mobility policies to create high-quality sustainable environments. His 15 years of public- and private- sector experience cover urban/mobility planning, policy, and outreach; CEQA/NEPA environmental review; and project funding/implementation. Working with regional and municipal government agencies, private developers, nonprofit organizations, and advocacy organizations, he has guided a diverse array of complex, innovative projects from vision to reality, including cap parks, pedestrian plans, and complete-/ green-street projects. He has participated in the successful adoption of parking management plans, zoning ordinances, and transportation infrastructure projects, many of which have received awards from the American Planning Association, Southern California Association of Governments, and the Westside Urban Forum. During his tenure as a mobility planner for the City of Glendale, Michael oversaw more than 30 miles of bicycle facilities and $11 million of planning and infrastructure improvements to increase pedestrian and bicycle safety. He helped the community realize its vision for a vibrant, walkable downtown and transit-oriented development around the Metrolink/Amtrak station. HIGHLIGHTS OF EXPERIENCE TRANSPORTATION PLANNING »Southwest Otay Mesa Specific Plan| San Diego CA »Lake Elsinore Active Transportation Plan | Lake Elsinore CA »Irwindale Active Transportation Plan | Irwindale CA »Active Transportation/Safe Routes to School Plan |Avenal CA »Regional Bicycle and Pedestrian Count Web Portal/Database Implementation Plan | San Francisco Bay Area CA »Bicycle and Pedestrian Master Plan | Los Gatos CA »Tejon Ranch Centennial Specific Plan | Gorman CA »Orange County Active Transportation Plan | Orange County CA »Countywide Trails Data Inventory | Los Angeles County CA »Transit to Parks Strategic Plan | Los Angeles County Metropolitan Transportation Authority GRANT WRITING »Long Beach Caltrans Sustainable Communities Planning Grant Application for the City of Long Beach »Glendale Caltrans Sustainable Communities Planning Grant Application for the City of Glendale »US Department of Transportation’s Smart City Challenge Grant | City of Long Beach CA »CA State Department of Parks’ Youth Soccer Recreation Grant for City of South Gate | LA County Department of Public Health »CA State Department of Parks’ Youth Soccer Recreation Grant for City of San Fernando | LA County Department of Public Health ENVIRONMENTAL ANALYSIS »Morena Corridor Specific Plan EIR | San Diego CA EDUCATION »BS, Urban and Regional Planning, California State Polytechnic University, Pomona CERTIFICATIONS »AICP Certified Transportation Planner »American Institute of Certified Planners AFFILIATIONS »American Planning Association Team member since 2015 A-14 MICHAEL NILSSON Senior Associate, Active Transportation mnilsson@placeworks.com PRIOR EXPERIENCE BICYCLE, PEDESTRIAN, MOBILITY PLANNING »Citywide Safety Education Initiative | Glendale CA »Citywide Pedestrian Plan | Glendale CA »Harvard Street Green Streets Demonstration Project | Glendale CA »Tropico Center TOD Plan | Glendale CA »Circulation Element: Complete Streets Update | Glendale CA »Safe and Healthy Streets Plan | Glendale CA COMMUNITY PLANNING »South Glendale Community Plan | Glendale CA »North Glendale Community Plan | Glendale CA »Montebello Hills Specific Plan | Montebello CA »East Orange Master-Planned Community | Orange CA POLICY PLANNING »South Brand Preferential Parking District Ordinance | Glendale CA »Space 134 Freeway Cap Park Vision Plan | Glendale CA »Citywide Environmental Graphics Manual | Glendale CA »Downtown Specific Plan Parking Standards Ordinance | Glendale CA »Downtown Specific Plan Transportation Demand Management Ordinance | Glendale CA »Hillside Zoning Ordinance | Brea CA »East Orange General Plan Amendment | Orange CA ENVIRONMENTAL ANALYSIS »Bicycle Transportation Plan | Glendale CA »Glendale Beeline Maintenance Facility | Glendale CA »Glendale Clean Energy Compressed Natural Gas Fueling Facility | Glendale CA »South Glendale Community Plan and EIR | Glendale CA SPEAKING ENGAGEMENTS »“Tailoring Ridesource Innovations to Connect the First and Last Mile in Your City” | 2016 APA California State Conference | Pasadena CA »“Complete Streets,” 2015 California League of Cities Planning Commissioner Training Academy | Newport Beach CA »“Summer in the City,” 2014 APA-LA Tour of Downtown Glendale | Glendale CA »“The ABC’s of Cap Parks,” 2014 APA National Planning Conference | Atlanta GA »“Biketopia in Autopia,” 2012 Pro Walk Pro Bike Conference | Long Beach CA »“Parking and Livable Communities,” 2010 Rail-volution Conference | Portland OR »“Right Sizing Parking,” 2010 Rail-volution Conference | Portland OR AWARDS »2018 Transportation Award of Excellence, APACA Central Section | Avenal Active Transportation and Safe Routes to School Plan »2017 Project of the Year, American Public Works Assn., S. California Chapter | Glendale Harvard-Louise Green Streets »2015 Implementation Award of Excellence, APA California Chapter & APACA Los Angeles Section | Glendale Downtown Specific Plan/Mobility Study »2014 Urban Design Award of Merit, APACA Los Angeles Section | Glendale Space 134 Vision Plan »2014 Transportation Award of Merit, APACA Los Angeles Section | Glendale Safe & Healthy Streets Plan »2014 Public Outreach Award of Merit, APACA Los Angeles Section | South Glendale Community Plan »2013 Honor, Master Planning, Westside Urban Forum | Space 134 Vision Plan »2012 Compass Blueprint President’s Award, SCAG | Safe & Healthy Streets Plan »2012 Comprehensive Planning Award of Merit, APACA Los Angeles Section | North Glendale Community Plan A-15 YUE ZHANG Project Designer Yue has more than 5 years’ experience in site planning and residential design. Her projects range from large-scale city planning to specific site plan and landscape design. Yue is passionate about site planning and how she can help clients and residents create a sustainable living environment. As a designer at PlaceWorks, Yue is involved in site analysis, design, production, coordination, and submittal processes. She specializes in landscape design, graphics, document design, 3D modeling and rendering, and lighting analyses. Yue was the major research assistant in 2012 Landscape Architecture Foundation Case Study Investigation Program, in which she evaluated the performance benefits of four streetscape projects. During her master program, she presented a feasibility analysis for using constructed wetland system to treat and reclaim wastewater in City of Mount Pleasant, UT. This study will guide the construction of Mount Pleasant city wastewater treatment facilities. HIGHLIGHTS OF EXPERIENCE »PA 61 Otay Mesa Landscape Plan | San Diego CA »THE GROVES at Loma Linda Specific Plan | Loma Linda CA »Solar Array View Simulation | Capistrano Unified School District »Water Tank Shadow Study | Woodside CA »Newhall Ranch Master Plan | County of Los Angeles CA »CollegeTown Specific Plan | Fullerton CA »Natomas Residential Design | Sacramento CA »Skyline Ranch Master Plan | Santa Clarita CA »Harbor Boulevard Corridor Plan and Vision | Santa Ana CA »Harmony Specific Plan EIR | Highland CA »Mill Creek Specific Plan | Chino CA »Ramona Creek Specific Plan | Hemet CA »Renaissance Rialto Specific Plan | Rialto CA »Tesoro Viejo Master Plan | Madera County CA »Tesoro Del Valle Master Plan | Santa Clarita CA »Oxford Place Development | Toronto CA »Glenwood Housing Foundation Landscape Design | Laguna Beach CA »Santa Ana High School Lighting Study | Santa Ana CA »Garey High School Lighting Study | Pomona CA »Pomona High School Lighting Study | Pomona CA »Westlake Village Site Plan | Westlake Village CA PUBLICATIONS »“On the Research Front: 2012 Landscape Architecture Foundation Case Study Investigation and the Case of the Streetscape,” Conference Notes for Council of Educators in Landscape Architecture, 2012. SPEAKING ENGAGEMENTS »“Design of a Constructed Wetland for Wastewater Treatment and Reuse in Mount Pleasant, Utah” | 2012 Spring Runoff Conference | Logan UT EDUCATION »MA, Landscape Architecture, Utah State University »BEng., Landscape Architecture, Southwest Jiaotong University AFFILIATIONS »American Society of Landscape Architects Team member since 2012 A-17 ANTHONY L. PETROS PRINCIPAL / TRANSPORTATION EXPERTISE Transportation Planning and Impact Analysis Parking Analysis EDUCATION Cornell University, Master of Regional Planning (M.R.P.) Candidate, 1985. University of California, Irvine, B.A., Social Ecology, 1983. University of California, Irvine, B.S., Biological Sciences, 1982. PROFESSIONAL EXPERIENCE Principal, LSA, Irvine, California, 1984–Present. Intern, Special Assistant to Chairman, City of Irvine Planning Commission, 1981–1982. Research Assistant, California State Department of Health Services, Hazardous Waste Management Branch, Abandoned Sites Project, 1980– 1981. PROFESSIONAL AFFILIATIONS City of Newport Beach, City Councilmember, District 2, 2012– 2016 Institute of Transportation Engineers, Member Orange County Traffic Engineers Council PROFESSIONAL RESPONSIBILITIES Mr. Petros’ primary responsibilities include the management and supervision of the transportation function of LSA in California. This role includes the preparation and review of comprehensive traffic and parking studies, operational and engineering analyses, Project Study Reports/Project Reports, complete streets and modal analyses, and long-range and strategic planning efforts. Emphasis is placed on the coordination of transportation projects with municipal and agency administrators and other stakeholder interests. Communication and consensus-building efforts are of paramount concern. Mr. Petros has prepared and/or supervised a variety of transportation projects, including the 2014 Long Range Transportation Plan (LRTP) and the Orange County Sustainable Communities Strategy (OCSCS) for the Orange County Transportation Authority (OCTA). While at LSA, Mr. Petros has also been involved in many General Plan work efforts, including the development of the General Plan Circulation Elements of Calaveras County and the Cities of Garden Grove, Buena Park, Laguna Hills, Calabasas, Arcadia, and Loma Linda. Mr. Petros has overseen the preparation of neighborhood traffic analyses in the Cities of Tustin, Whittier, Lakewood, and San Clemente, as well as in the Del Monte Forest. His range of experience covers large-scale land development, capital projects, and smaller detailed operational analyses. PROJECT EXPERIENCE City of La Quinta Technical Assistance Panel (TAP) La Quinta, California LSA was a primary contributor to the Highway 111 AP effort on behalf of the City of La Quinta. Generating more than 70% of the sales tax revenue for the City, land uses along the Highway 111 corridor are a significant contributor to the financial security of the community. Selected as the Mobility Lead, LSA conducted baseline research into all modes of travel: vehicular, Sunline transit, cycling and CV Link and pedestrians to describe an existing setting. LSA linked this setting to a general planning environment including the housing stock, housing starts and sales, commercial/retail activities, auto sales and new foreseeable development initiatives. LSA then interviewed property owners, developers, transit providers, CVAG administrators and City officials to gain a contextual appreciation for the social and political realities in the City and along the corridor. As a result of this intensive data collection and interpretation, LSA has a hands on, real time understanding of the current and future conditions along Highway 111 in La Quinta. LSA will use this special knowledge to start our efforts in determining the proper Mobility solution to an Area Plan. LSA provided a series of recommendations in the TAP report, including Complete Streets strategies, augmented intersections and monument signage, integration of land use and mobility across parcel lines and individual lots, enhanced landscaping and landscape maintenance in the public right of way and acknowledgment of new technology and innovation that will enhance accessibility to land uses in the corridor. OCTA 2014 Long-Range Transportation Plan Orange County, California Mr. Petros served as the overall Project Manager working with the OCTA to prepare the 2014 LRTP, which is Orange County’s contribution to the Southern California Association of Governments (SCAG) Regional Transportation Plan. It identifies the mobility projects and programs desired and necessary to meet A-18 ANTHONY L. PETROS PRINCIPAL / TRANSPORTATION PROFESSIONAL AFFILIATIONS (CONTINUED) Newport-Mesa Unified School District Measure A Oversight Committee, Inaugural Chairman County of Orange, Housing & Community Development Commission City of Newport Beach, Bicycle Safety Committee City of Costa Mesa Chamber of Commerce, Past President City of Costa Mesa Residential Rehabilitation and Redevelopment Commission, Past President PROJECT EXPERIENCE (CONTINUED) Orange County’s transportation needs now and in the future, taking into account multiple considerations, such as current transportation policies and commitments, stakeholder input, and revenues available to implement the LRTP. The LRTP also considered the linkages created by the recent Senate Bill (SB) 375 regulation and requirements for the OCSCS. As the author of the inaugural OCSCS, Mr. Petros and LSA have unparalleled experience in comprehending the details of SB 375 linkages and developing meaningful strategies and plans. As the prime consultant who developed the long-range transportation strategies for the LRTP, Mr. Petros was positioned to provide maximum benefit to the OCTA in the development of efficient and actionable policies and plans for this assignment. Orange County Sustainable Communities Strategy Orange County, California Orange County has accepted delegation for the preparation of an OCSCS to demonstrate compliance with Senate Bill 375. This landmark legislation is part of the broader California Global Warming Solutions Act of 2006 and links land use and transportation to reduce vehicle miles traveled and greenhouse gas emissions. Mr. Petros serves as the Project Manager for the OC SCS effort, and while leading a multidisciplinary team, was responsible for coordinating with agency staff, elected officials, technicians, and scientists in the development of a comprehensive strategy for Orange County. Mr. Petros and his team developed and documented many best management practices used by agencies to address land use and transportation planning. Newport Beach Bicycle Master Plan Newport Beach, California Mr. Petros oversaw the conceptualization, creation, and adoption of the Newport Beach Bicycle Master Plan. Acting as chairman of the Bicycle Safety committee, Mr. Petros guided the committee and the public through the evaluation of bicycle issues in the City of Newport Beach. He helped define safety thresholds and project definitions and led consultant procurement, public outreach, and meeting facilitation to raise awareness of the benefits of active transportation and the potential safety issues of implementing various strategies. Hundreds of stakeholders regularly attended the committee meetings to voice their opinions and concerns. Mr. Petros also led the efforts to engage Caltrans in design alternatives along Pacific Coast Highway. As a result of these combined efforts, Newport Beach adopted a 20-year master plan identifying $22 million in projects and programs to satisfy the 4E principles of bicycle planning. Portola Avenue / I-10 Interchange Palm Desert, California Mr. Petros served as the Principal in Charge of the traffic volume development and operational analysis of the proposed Portola Avenue/Interstate 10 interchange located in Palm Desert. The adjacent BNSF Railway constrained the design. The operational analysis tested three alternative alignments. LSA first developed forecast traffic volumes for project opening and 2030 horizons based on model data from the 2025 Comprehensive Transportation Plan model. This data was accepted in the first round of review. The operational analysis includes a detailed simulation of each design alternative, including mainline operations. A-19 ARTHUR BLACK ASSOCIATE / SENIOR TRANSPORTATION PLANNER EXPERTISE Transportation Planning Parking Demand and Shared Parking Studies Transit Systems EDUCATION California State Polytechnic University, Pomona, Masters of Urban and Regional Planning, 2012. Grove City College, Pennsylvania, B.S., Industrial Management, 1999. PROFESSIONAL CERTIFICATIONS / REGISTRATIONS American Planning Association Institute of Transportation Engineers Orange County Transportation Engineers Council PROFESSIONAL EXPERIENCE Senior Transportation Planner, LSA, Irvine, California, December 2006–Present. Logistical Support, United States Marine Corps, 4th Light Armored Reconnaissance Battalion, Camp Pendleton, California, 2002–2009. PROFESSIONAL RESPONSIBILITIES Mr. Black’s primary responsibilities include the production of technical reports for the transportation function of LSA in Irvine, California. This role involves the preparation of traffic and parking studies, operational analysis, and transportation planning research. Mr. Black has also assisted in the management of the Orange County Sustainable Communities Strategy, the La Pata Avenue EIR, and the administration of two of Orange County’s Growth Management Areas. Mr. Black has prepared reports for development and transportation projects, among them the LT Platinum Center, Shea Baker Ranch Area, and Interstate 5 (I-5) widening between Interstate 605 (I-605) and Interstate 710 (I-710). Mr. Black has also prepared parking studies ranging from the Laguna College of Art + Design to the West Civic Center in the City of Westminster. Mr. Black’s transportation planning research has included parking generation rates, transit planning, traffic calming, internal trip capture, and transit mode share. Mr. Black is following the implementation of Senate Bill 743 including attending meetings at the Southern California Association of Governments with Chris Calfee, Senior Counsel for the Governor’s Office of Planning and Research. PROJECT EXPERIENCE 2014 and 2018 Long Range Transportation Plan Orange County Transportation Authority Orange County, California Mr. Black was a member of the team assisting OCTA in the preparation of the 2014 Long Range Transportation Plan (LRTP). The LSA team was also selected by OCTA to prepare the 2018 LRTP. With the 2014 LRTP, the LSA Team built on the Orange County Sustainable Communities Strategy (OCSCS) to integrate land use planning into the LRTP. The 2014 LRTP also presented transportation planning for multiple travel modes and added the goal of supporting mode choice. The 2018 LRTP will continue to build on the idea of developing transportation networks that offer viable alternatives. Metrics are being added to allow OCTA to track progress towards sustainability and qualify for funding through new State and federal programs. Orange County Sustainable Communities Strategy Orange County, California Mr. Black assisted with the preparation of the Orange County Sustainable Communities Strategy (OCSCS) for the Orange County Transportation Authority (OCTA). This document is a subregional component to the regional SCS prepared by Southern California Association of Governments and is included in the Regional Transportation Plan. The SCS addresses the relationship between transportation and land uses and identifies strategies for reducing greenhouse gas emissions from cars and light trucks. Mr. Black’s responsibilities included collecting and organizing comments received from OCTA, the Orange County Council of Governments, and community stakeholders to ensure appropriate comments were addressed in future revisions to the document. A-20 ARTHUR BLACK ASSOCIATE / SENIOR TRANSPORTATION PLANNER PRESENTATIONS Center for the Study of the Inland Empire, Empire Symposium (California State Polytechnic University, Pomona), “May the [Work] Force Be With You: How the Inland Empire Can Win at Close by, Affordable Housing,” November 7, 2007. TEACHING “Transportation Plan for the 2010 Winter Olympics in Vancouver, British Columbia,” Institute of Transportation Engineers Southern California Section Newsletter 2009–2010, Issue No. 7, April 2010. PROJECT EXPERIENCE (CONTINUED) Coachella Valley Music and Arts Festival Indio, California Mr. Black prepared a report for festival organizers in the City of Indio detailing trip and parking generation rates, queue lengths, and delays caused to local roadways. In addition, Mr. Black presented suggestions for improving the parking process and reducing the number of vehicles traveling to the festival by providing alternatives. General Plan Land Use and Urban Design Elements Traffic Analysis Long Beach, California The City of Long Beach updated its Circulation Element recognizing that the mobility of people is not always improved by facilitating automobile travel. As such, the City is transitioning away from performance measures focused on automobile level of service. Until that transition is complete, however, an analysis of potential impacts to automobile level of service at intersections was required for the updated Land Use and Urban Design Elements. Mr. Black performed this analysis by examining the anticipated increases in socioeconomic factors and equating the increase in those factors to an increase in traffic volume. Growth Management Area Administration Orange County, California Mr. Black assisted with the organization effort for Technical Advisory Committee and elected officials meetings for Growth Management Areas 2 and 10 for 4 years. Mr. Black’s responsibilities included coordination with the appropriate cities’ staff to create a comprehensive picture of land use changes and the subsequent future needs of the transportation network. Savi Ranch Mobility Plan Yorba Linda, California Mr. Black examined mobility within the Savi Ranch area of Yorba Linda as part of the City of Yorba Linda’s Vision Plan. The Mobility Plan examined existing conditions including traffic volumes, accessibility for all travel modes, accident statistics, and signage. Mr. Black calculated how much additional development could be located within Savi Ranch before the single intersection entry/exit would reach capacity and presented options for increasing capacity. Suggestions were also made regarding improved accessibility and internal circulation for pedestrians and bicycles as well as new wayfinding to improve internal circulation. Banning Ranch Newport Beach, California Mr. Black provided the project applicant with traffic and parking analyses answering questions that arose during California Coastal Commission (CCC) review of the project. Mr. Black prepared a travel demand management plan and recalculated traffic volumes when CCC staff recommended changes to land use locations and downgrading Bluff Road from a regional to a local road. Mr. Black used these traffic volumes to forecast traffic queuing and to redesign the roadway and intersections. A-21 ASHLEY BARDEN ASSISTANT TRANSPORTATION PLANNER EXPERTISE Environmental Studies and Planning Transportation Analysis EDUCATION Sonoma State University, B.A., Environmental Studies and Planning, 2018. PROFESSIONAL EXPERIENCE Assistant Transportation Planner, LSA, Irvine, California, 2018– Present. PROFESSIONAL RESPONSIBILITIES As an Assistant Transportation Planner at LSA, Ms. Barden assists with the production of transportation documentation for a variety of projects throughout California. Her primary responsibilities include research and analysis for the completion of traffic impact analyses, transportation plans, and evaluations. Ms. Barden’s technical expertise extends through transportation analysis to environmental studies and planning. PROJECT EXPERIENCE I-5 Widening Project (I-405 to SR-55) Orange County, California Ms. Barden is currently assisting with the preparation of the Initial Study/ Environmental Assessment for this highway project. Irvine Water Park Traffic Evaluation Irvine, California Ms. Barden assisted with the completion of the Irvine Water Park Traffic Evaluation for the possible development of a Wild Rivers Water Park in the Great Park region of Irvine. Mission Viejo Bike Master Plan Mission Viejo, California Ms. Barden assisted in the creation of the Mission Viejo Bike Master Plan, which includes connections to schools, recreational facilities, and public transit throughout the City. A-22 EDUCATION B.A. Landscape Architecture: University of CA Berkeley Post Graduate Studies: UCLA Extension • CAD Design • Southern California Island Biology • Japanese Garden Architecture Harvard Graduate School of Design • Golf Course Design REGISTRATIONS Registered Landscape Architect California #1532 Nevada #94 Arizona #13754 PROFESSIONAL AFFILIATIONS Planning Commissioner, City of Palm Desert Vice President, Desert Section, Southern California Chapter, American Society of Landscape Architects RONALD B. GREGORY, A.S.L.A. President and Principal in Charge RGA Landscape Architects, Inc. Ron Gregory is president and founder of RGA Landscape Architects, Inc. He started the firm in Palm Desert in 1977 after having worked a variety of positions in the Los Angeles area, starting as a landscape architectural assistant with the City of Burbank park department, working hard with a landscape contracting firm in Montebello, and enjoying the creativity of landscape architectural studios in Los Angeles and Venice. Schooled in landscape architecture at the University of California at Berkeley, Ron came to love the desert and found it rewarding to create a landscaped environment where there was basically sand before. In the mid-eighties, he embraced the need for water efficient design and has since worked at providing sustainable designs for an appreciative clientele. EXPERIENCE Ron has been Principal in Charge for well over 2,000 landscape projects in the Coachella Valley, including these similar projects: Tahquitz Canyon Way Median Islands - Palm Springs, CA This median island and streetscape enhancement project included development of four design “zones” over a 3-mile corridor from downtown Palm Springs to the airport, with each of the zones reflecting the character of its neighborhood. Included coordination with many stakeholders and government agencies. Gene Autry Trail / Ramon Road Median Islands - Palm Springs, CA Median design on approx. 3.5 miles of Gene Autry Trail and nearby portions of Ramon Road. Medians included design and placement of “statement” sculptures to reflect the nearby Palm Springs Airport tensile roof structure and mountain ranges surrounding the valley. Fred Waring Drive Median Islands and Parkways - Palm Desert, CA & Indian Wells, CA Redesign of median islands and adjacent parkway on both sides of Fred Waring Drive for a distance of 2.5 miles. Project included coordination with two city governments (Palm Desert and Indian Wells) and two water districts (Coachella Valley Water District and Imperial Irrigation District). Dinah Shore Drive Median Islands and Parkways – Rancho Mirage, CA Medians and adjacent parkways from DaVall to Los Alamos incorporating drought tolerant landscape in an area susceptible to high winds and drifting sand. A-23 73061 El Paseo, Suite 210 • Palm Desert, CA 92260 • 760-568-3624 • FAX 760-773-5615 • www.rga-pd.com CA Lic. #1532 • AZ Lic. #13754 • NV Lic. #94 JARVIS PAYNE Position: Associate Landscape Architect When Jarvis joined RGA in January 2018, he brought with him over 30 years of designing and managing landscape development projects throughout the West Coast, including bio tech corporate campuses in metropolitan Portland, Oregon, a new Oregon State University campus in Bend, Oregon, and a waterfront park in Sacramento, California. Jarvis excels at taking complex public development projects from initial design concepts, then preparing detailed construction documentation, and finally overseeing the construction of a successful landscape development project. After graduating from the University of Washington with a Bachelor of Landscape Architecture, Jarvis relocated to the Bay Area to work with a San Francisco based landscape architectural firm and gained extensive experience working on Public and Commercial development projects throughout California. Education: B.A. Landscape Architecture – University of Washington Registration: Registered Landscape Architect: • California #4317 • Oregon #761 Previous Professional Experience: From November 2005 to December 2017, Jarvis was with Walker Macy Landscape Architects in Portland, OR. As a senior project manager and designer in this 36-person firm, Jarvis was responsible for managing and designing large scale public and higher education landscape development projects in California, Oregon and Washington. Jarvis managed up to ten support staff, supervised teams of sub consultants, and oversaw all aspects of project design, construction document preparation, and construction administration. Over the previous nine years, Jarvis gained invaluable experience and knowledge at Murase Associates in Portland, Suzman Design Associates in San Francisco, and PGA Design in Oakland. Jarvis developed expertise in park design, public infrastructure, low income housing, and historic landscape preservation. As a designer and senior project manager, Jarvis managed a variety of projects, including a master plan for 540-acre urban nature park, construction document preparation for a 300-acre semi-conductor facility, and a master plan for an expansion at Oakland International Airport. A-24 YOLANDA SEPULVEDA PRINCIPAL As principal of Spectacle* design, Yolanda combines innovative problem solving with creative collaboration to foster a win-win philosophy, for clients, projects, and the firm. Utilizing her success in facilitation, community workshops and presentations, Yolanda is able to synthesize and define themes, ideas and solutions that strengthen the collaborative process. Graduating with a degree in Urban Planning from the College or Architecture and Environmental Design at Cal Poly San Luis Obispo, Ms. Sepulveda has spent the bulk of her career in real estate, spanning all three sectors of public, private, and non-profit. Using her in depth knowledge of the built environments in the sectors of retail and residential and TOD, Yolanda leads development teams to reposition assets through re-imagined design elements like wayfinding, public art, signage, exterior an interior features that revive and reintroduce both new and existing assets. The end goal being to create an urban form that invites the community or user to explore and create memorable moments that communities take pride in. Yolanda’s passion and focus is centered on development and the inclusion of users in the process and creation of built environments. She currently serves on the Executive Board for the Urban Land Institute (ULI) as chair of Outreach and Innovation. Ms. Sepulveda proudly serves her community as Commissioner for the Arts and Culture Commission, representing District 3 in the City of Pasadena. WILL HEINZE SENIOR DESIGNER With a degree in Industrial Design, Will believes in an empathetic design approach that puts the user experience first. He is driven by the idea that the strongest elements of a design can be the intangibles—the way visuals and materials make you feel, the experience of using a product or navigating a place—when design and user are simply in sync. Will has worked for over 5 years in realm of experiential design and creating environments that provide clear and navigable places for people to explore. As an industrial designer, Will serves as a critical component to the team being able to see a vision go a place through the mechanics of what is plausible and constructible. This skill has allowed for traditional 2D ideas to be imagined through actual 3D technology, providing clients with the ability to see how envisioned experiences are going to look before being built. Wills ability to empathize with users and fulfill design solutions to serve those needs has made him a key leader and client partner. His ability to listen and observe have made his an asset to the team and clients appreciate his sense of detail. Graduating with a degree in industrial and product design from Arizona State, Will has traveled and worked internationally in Europe, always seeking solutions from real world adventures, rooted in his own sense of curiosity and love of seeing people enjoy spaces. APPENDIX B. Work Samples B-1PROPOSAL FOR SERVICES | PLACEWORKS Appendix B. Work Samples The following work samples are provided on enclosed thumb drive, with the exception of the Daybreak project fly-through product prepared by PlaceWorks, which is available only via the link below. ƒBeach Boulevard Corridor Specific Plan, City of Anaheim | PlaceWorks ƒThe Groves at Loma Linda Specific Plan, City of Loma Linda | PlaceWorks ƒDaybreak Master Plan Fly-Through | PlaceWorks* ƒULI Technical Assistance Panel Report for La Quinta Highway 111 Corridor Study, Urban Land Institute | TAP included LSA and PlaceWorks (report writer) ƒOrange County/Inland Empire ULI Strategic Plan Toolkit 2017 | Spectacle Design * Click to follow link to: http://download.placeworks.com/ROC/2018-09-19_RenoVideo.wmv Orange County | Inland Empire Strategic Plan Toolkit 2017 A Resource for Planning Compiled from the District Council’s Strategic Plan Workshop 2017 Texas based artists Werk Alvarez and Isaias Crow created this 30-foot-high mural on the rear of a building in the 300 block of East Fourth Street, in a narrow alley off Spurgeon Street in the culinary arts hub known as 4th Street Market in Santa Ana, California. ULI TECHNICAL ASSISTANCE PANEL JUNE 23, 2018 CITY OF LA QUINTA HIGHWAY 111 CORRIDOR STUDY HEARING DRAFT | OCTOBER 19, 2018 BEACH BOULEVARD SPECIFIC PLAND R A F TD R A F TD R A F TD R A F TD R A F TD R A F TD R A F TD R A F TD R A F TD R A F TD R A F T BEACH BOULEVARDD R A F T BEACH BOULEVARD THE GROVES AT LOMA LINDA Specific Plan (Hearing Draft, June 12, 2018) City of Loma Linda APPENDIX C. Non-Collusion Affidavit Form PLACEWORKS.COM ULI TECHNICAL ASSISTANCE PANEL JUNE 23, 2018 CITY OF LA QUINTA HIGHWAY 111 CORRIDOR STUDY PANELISTS Manuel Bouza, MG2 Andrew Bowden, Land Concern Sheila Cedervall, PlaceWorks Vaughan Davies, Perkins Eastman Stephen Nieto, Southwest Concepts Anthony Petros, LSA Associates Sergio Ramirez, City of Lang Beach Robert Reicher, The Reicher Company Carl Rieger, Eastdil Secured Spencer Wampole, The Wampole Group PARTICIPANTS ULI OC/ IE LEADERSHIP John R. Williams, Chair, Denise Ashton, Vice Chair, CO-CHAIRS Oscar Uranga, IMG Carol Mentor McDermott, Entitlement Advisors ULI STAFF & SUPPORT Kendra Chandler, Executive Director ULI OC/IE Stacy Greer, District Council Manager, ULI OC/IE Katie Holst, Senior Associate, ULI OC/IE CITY OF LA QUINTA Frank Spevacek, City Manager Gabriel Perez, Planning Manager Karla Campos, Finance Director Brian McKinney, City Engineer STAKE HOLDERS Carter McLarand, Shopoff Realty Kevin McCune, LQ Planning Commission Pablo Rodriguez, Coldwell Banker Tom Kirk, CVAG Martin Magana, CVAG Les Johnson, City of Indio Josh Bonner, Greater CV Chamber of Commerce David Gassaway, City of Indian Wells Jack Tarr, Lee and Associates Maggie Montez, Lee and Associates Michael Proctor, LQ Planning Commission Robert Wright, LQ Planning Commission, East Valley Coalition Brian Tracy, Retail Net Lease Properties Michael Walsh, Rivco Housing Authority Anita Petke, Sunline Transit Agency Philip Bettencourt, LQ Planning Commission James Brownyard, Desert Valley Builders Association Steven Chaffee, Harsch Investment Properties Jeff Robinson, Coldwell Banker Brian Tracy, Retail Net Lease Properties GUIDING PRINCIPLE 7KHÀQDORXWFRPHRIHYHU\7$3LVWKDWLWLV transparent, objective, and unique.. TABLE OF CONTENTS 1. INTRODUCTION..........................................1 The Urban Land Institute..........................2 The TAP Process........................................2 Scope of Work.........................................4 2. OBSERVATIONS..........................................5 Study Area Characteristics.....................6 Market Findings........................................9 Implications / Conclusions....................17 Focus Groups.........................................21 CV Link....................................................22 3. RECOMMENDATIONS..............................25 Land Use Analysis..................................27 Urbanization Mechanisms.....................28 Landscape Design.................................34 Public Policy Recommendations.........40 Finance Recommendations.................41 4. IMPLEMENTATION.....................................43 Current Trends........................................44 Final Analysis...........................................46 5. BIOGRAPHIES...........................................49 LIST OF FIGURES 1. THE TAP PROCESS..........................................1 2. REGIONAL CONTEXT MAP...........................5 3. HWY 111 STUDY AREA..................................7 4. STUDY AREA SURFACE PARKING.................8 5. 10 MILE RADIUS TRADE AREA........................9 6. ECOMMERCE VS STORES...........................10 7. HWY 111 RETAIL LOCATIONS.....................12 8. AUTO DEALERSHIP LOCATIONS.................13 9. ECOMMERCE SALES BY CATEGORY.........16 10. PROPOSED CENTER LA QUINTA.................19 11. PROPOSED CV LINK ALIGNMENT..............22 12. PRELIMINARY STUDIES.................................24 13. PHASED CATALYST SITES.............................27 14. PEDESTRIAN THEMED DISTRICTS.................29 15. EVENT DISTRICT OPPORTUNITIES................31 16. STREET CONNECTIONS...............................34 17. LANDSCAPE FRAMEWORK.........................35 18. HWY. 111 SECTION......................................35 19. HWY. 111 INTERSECTION TREATMENT........36 20. INTERIOR GREEN STREET SECTION..............37 21. PLANTS: TREES & SHRUBS............................38 22. PLANTS: SUCCULENTS & GROUND COVER...................................39 LIST OF TABLES 1. RENTABLE RETAIL SPACE ............................11 TECHNICAL ASSISTANCE PANEL 1 1. INTRODUCTION Technological advancements have brought many changes in the way we live our daily lives. This trend is likely to continue as major shifts continue to come forth. These changes have affected consumer spending habits, with more and more single purchase “chore shopping” moving online, disrupting the traditional big box retail shopping model. This disruption of spending habits raises many questions about the future of retail and the subsequent loss of municipal sales tax revenues. Digital commerce is likely to take over a larger share of retail transactions in the future, as advantages like same day delivery, one-tap purchases, and no charge shipping become the norm. However, strategically SRVLWLRQHG PXQLFLSDOLWLHV FDQ EHQHÀW IURP anticipating future trends. The City of La Quinta approached the Urban Land Institute (ULI) in January 2018 about the possibility of conducting a Technical Assistance Panel (TAP) to study several aspects of the Highway 111 Corridor. Because sales taxes collected from purchases within the Corridor account for 70 percent of WKH &LW\·V DQQXDO ÀVFDO EXGJHW WKH &LW\ contracted with ULI to evaluate the 460-acre area surrounding Highway 111 (Study Area), and recommend potential mechanisms to position it for long term economic viability. Twelve panelists participated in the ULI study, representing a wide range of professions within the real estate development industry, including architecture, landscape architecture, urban planning, marketing, WUDQVSRUWDWLRQ HQJLQHHULQJ ÀQDQFH ODQG development and policy planning. The panelists began their work April 25th, when they gathered for a site tour conducted by City staff members and interviewed local stakeholders. 7KH ÀQGLQJV DQG UHFRPPHQGDWLRQV RI WKH TAP were presented May 30, 2018 during a Study Session attended by the La Quinta City Council and Planning Commission, as well as members of the public. This report represents D VXPPDU\ RI WKH 7$3 ÀQGLQJV DQG LGHDV developed during the process as well as recommendations for future implementation strategies. 2 HIGHWAY 111 CORRIDOR STUDY THE URBAN LAND INSTITUTE THE TAP PROCESS Technical Assistance Panels have been a part of the ULI Advisory services since 1947. Most TAPs are organized at the local level (vs. a national panel) with members volunteering their time as a way of giving back to the community. The process provides the public sector with a tool to solve complex real estate and land use issues in a uniquely objective, transparent way. Local professionals are selected who collectively have varied experience and knowledge applicable to the particular problems to be considered. Panels are organized as one-day or two-day projects, depending on the complexity of the scope RIZRUN)LJXUHDWULJKWVKRZVDVLPSOLÀHG diagram of the TAP process. 7KH ÀQDO SUHVHQWDWLRQ DQG UHSRUW LV D MRLQW effort between ULI and the public agency. An implementation strategy is produced based on sound information, community realities, and best practices so that the community receives the best possible result. The Urban Land Institute (ULI) was founded in DVDQRQSURÀWUHVHDUFKDQGHGXFDWLRQ organization. ULI is the oldest and largest network of cross-disciplinary real estate and land use experts in the world The mission of the organization is to provide leadership in the responsible use of land in creating and sustaining thriving communities worldwide. As a nonpartisan organization, ULI has long been recognized as one of America’s most respected and widely quoted sources of objective information on urban planning, growth and development. Representing membership of over 30,000 worldwide public and private sector professionals ULI is active in all aspects of land use planning, and real estate development. Our members form a spectrum of land use and development disciplines, including developers, investors, designers, public RIÀFLDOV SODQQHUV DWWRUQH\V HQJLQHHUV academics and students. ULI Orange County/Inland Empire is one of the largest District Councils in the world. TECHNICAL ASSISTANCE PANEL 3 Panelists Present Findings THE TAP PROCESS FIGURE 1 Establish a Scope of Work Create the Final Report Meet with Stakeholders Due DiligenceBrainstorm Incorporate Feedback from Presentation Develop Potential Solutions TAP Request is Submitted 4 HIGHWAY 111 CORRIDOR STUDY SCOPE OF WORK 1. What are funding or partnership strategies for improving Corridor aesthetics should the City consider? What is the right design to improve aesthetics and promote business visibility and access? 2. There is concern about the future viability of commercial along Highway 111, the largest tax revenue generator for the City. a. What are the appropriate size and mix of uses? b. What can the City do to promote a vibrant business community? c. How can the City assist commercial uses as e-commerce continues to consume more market share? 3. How could rapidly changing technologies affect the Corridor (autonomous and electric vehicles, Uber / Lyft)? 4. Is vertical mixed use development in the corridor the highest and best use from a City Economic Viability standpoint? 5. What opportunities should City consider when CV Link multi-use trail is constructed? :KDWDUHWKHFRVWVDQGEHQHÀWVRID complete streets redesign of the Highway 111 Corridor? 7. What policy, land use and development strategies could be implemented now to position the Corridor for the future? The purpose of the La Quinta TAP effort is to evaluate the Highway 111 Corridor (Study Area) and position it for long-term economic viability. The City is considering the following options for future Corridor planning from the least to most intensive in scope: Option 1: Update Existing Highway 111 Design Guidelines (landscape, lighting and entry ways). Option 2: Create a Corridor Area Plan which would provide a set of Design Guidelines, WUDIÀF DQDO\VLV DQG FRGH UHYLVLRQV WR JXLGH development along the Corridor. Option 3:&UHDWHD+LJKZD\6SHFLÀF3ODQ WKDWFRQVROLGDWHVDOOWKHH[LVWLQJ6SHFLÀF3ODQV into one plan. The City recently adopted a mixed use overlay for the Study Area, with the La Quinta 2035 General Plan (LQGP). The LQGP’s goals and policies call for innovative land uses and mixed use development for the Highway 111 Corridor area. The option that is chosen will carry out the intention of this overlay by specifying the details necessary to implement the vision of the LQGP. The TAP effort is intended to be instrumental in guiding City leaders in best practices and information to make an informed decision on the best path forward for Highway 111 Corridor planning efforts. CITY OF LA QUINTA TAP QUESTIONS TO BE CONSIDERED: TECHNICAL ASSISTANCE PANEL 5 La Quinta is one of seven cities of the Coachella Valley, which is surrounded on three sides by mountains. This geography creates a unique climate characterized by the warmest winters west of the Rocky Mountains, and hot, dry summers. The valley’s population varies seasonally from 200,000 in July to around 800,000 by January. Another 3.5 million conventioneers, festival visitors and tourists descend on the valley annually (please refer to Figure 2, Regional Context Map). 2. OBSERVATIONS REGIONAL CONTEXT MAP FIGURE 2 La Quinta is situated near several world-class destinations including the Indian Wells Tennis Garden, Empire Polo Club, Silver Rock Resort, as well as the annual Coachella Music Festival. These destinations draw an enormous volume of visitors from around the globe needing food and lodging, and having discretionary income to spend. These characteristics provide unique opportunities for potential economic development. 6 HIGHWAY 111 CORRIDOR STUDY The Study Area encompasses approximately 460 acres on both sides of the Highway 111 Corridor, directly south of the Coachella Valley Stormwater Channel. Highway 111 is the major arterial through La Quinta, acting as the gateway to the City and setting the tone for a visitor’s experience of the City (please refer to Figure 3, Highway 111 Study Area). The Study Area is surrounded predominantly by single family residential development. La Quinta High School is across the channel, accessible by bridges along Adams Street and Dune Palms Road. The Highway 111 Corridor is a critical, centrally located component of intra regional travel through the Coachella Valley, accommodating 35,000-40,000 vehicles per day. The intersection of Highway 111 and Washington Street is one of the highest volume intersections in the Coachella Valley, carrying over 70,000 vehicles per day. Seventy percent of the total 2016 La Quinta sales tax revenue ($5,785,466.00) was generated by Corridor businesses. :LWKLQWKH&RUULGRUVHYHQW\ÀYHUHWDLOVHUYLFH and restaurant establishments are currently located within twenty-one commercial and RIÀFHFHQWHUVHPSOR\LQJXSWRSHRSOH Existing establishments include Home Depot, Lowe’s, Walmart, Kohl’s, Cost Plus World Market, Kohl’s, Trader Joe’s, Sprouts, Best Buy, and Century Theaters. Ensuring the Corridor’s economic resilience is essential to the City’s future. Other uses within the Study Area include Coral Mountain Apartments, Storquest Self Storage, a vacant Sam’s Club location, and several vacant lots including a parcel owned by the City. A large portion of the Study Area is composed of surface parking lots, as shown in Figure 4, Study Area Existing Parking. Parking in some cases was installed in excess of the minimum amount required by local City zoning ordinances. This higher ratio was stipulated by the retailer in most cases to meet peak demand. A major feature of the Study Area is the adjacent CV Link, a forty-nine mile long regional, multi modal pathway planned for the Coachella Valley. The trail will extend along the Coachella Valley Channel from Palm Springs to Thermal. The La Quinta segment of the CV Link is projected to attract 13,500- 16,000 pedestrians, bicyclists, and other users annually. STUDY AREA CHARACTERISTICS Existing placemaking elements, natural features, and monuments along the Highway 111 Corridor. TECHNICAL ASSISTANCE PANEL 7 HIGHWAY 111 STUDY AREA FIGURE 3 8 HIGHWAY 111 CORRIDOR STUDY STUDY AREA SURFACE PARKING FIGURE 4 Parking lots, potential development opportunities within the Study Area. TECHNICAL ASSISTANCE PANEL 9 MARKET FINDINGS 10 MILE RADIUS TRADE AREA BOUNDARY FIGURE 5 10 MILES A marketing report prepared by the Panel GHÀQHV VHYHUDO HFRQRPLF FKDUDFWHULVWLFV RI WKH&RDFKHOOD9DOOH\´7UDGH$UHDµDGHÀQHG boundary within a ten-mile radius, as shown above in Figure 5. The following section refers to data both within the Trade Area and within the City of La Quinta as noted below. DEMOGRAPHICS A common perception of Coachella Valley residents is that active adults over the age of 65 constitute the majority of the population. However, data shows that this age group represents only 24.6% of all residents, with those age 20 - 64 at 50.9% and the population below age 19 at 24.6%. Those dwelling full time within the Trade Area consist of 298,600 people, which is projected to increase by 6%, or approximately 18,200 SHUVRQVRYHUWKHQH[WÀYH\HDUV7KHVKDUHRI the population aged 65+ will increase slightly to 25.6 by 2023. Median household income within the trade area is $58,500 per year, and the median home value is $377,450. Average incomes and home values are projected to remain JHQHUDOO\ÁDWRYHUWKH\HDUSHULRG Data from the 2010 US Census showed owner- occupied homes at 48.9% of the total, with renter units at 21.7% and vacant homes at 29.4%. Seasonal homes make up 20.5% of the dwelling units, with other housing constituting 7KLVVHDVRQDOÁX[LVDIDFWRUWKDWKDVDQ effect on the economy in the trade area, with the reduction of summer population resulting in reduced retail activity. 10 HIGHWAY 111 CORRIDOR STUDY Retail activity plays a key role in the overall economic climate of Coachella Valley. Space inventory for retail totals 30.9 million square feet, of which 4.4 million square feet (14.4%) is currently available for lease. Average asking rent across Coachella Valley is $20.56 per square foot per year, ranging from $13.74 in Coachella to $27.00 in Indian Wells. Retail construction activity across Coachella Valley has been limited since 2008, when more than 1.5 million square feet of space was delivered. In 2014, nearly 1.0 million square feet were completed, but deliveries in all other years during the period were well below 200,000 square feet per year. Net absorption of retail space has been modest, averaging about 123,000 square feet annually valley wide and 9,400 square feet annually in the Trade Area over the past 10 years. Retail vacancy rates peaked around 13% in 2011, but have slowly decreased since then, currently standing at 11%. Retail purchases (including food and beverage) by residents of Coachella Valley will total over $7.4 billion during 2018, according to Environics. According to a 2015 Visitor Survey, all Coachella Valley tourist parties spent an average of $121 per day on dining and $115 on retail expenditures. On-line purchases currently represent 8.3% of total retail sales (excluding automotive and fuel sales). Please refer to Figure 6 above, Ecommerce Versus Brick and Mortar Sales. This share is expected to increase to 10.8% by 2020, meaning 89.2% of retail sales will still occur in traditional settings. ECOMMERCE VS BRICK AND MORTAR SALES FIGURE 6 RETAIL FINDINGS: OVERALL COACHELLA VALLEY TECHNICAL ASSISTANCE PANEL 11 Overall availability rate in La Quinta is 13.5%, but the rate varies by type of center. Highest availability rates are found in Neighborhood Centers (20.0%), Power Centers (18.1%) and Strip Centers (15.0%). The majority of available square footage is found in Power Centers (283,000 square feet) and Neighborhood Centers (116,000 square feet). Average rent in La Quinta is $23.00 per square foot per year, third-highest (after Indian Wells and Rancho Mirage) of any city in Coachella Valley. Although the Study Area includes a full range of business types among its tenants, by far the largest share of businesses are in retail trade and food services. Of the 465 businesses and 5,651 employees, retail trade accounts for 19% of businesses and 44% of employees, while food services are 14% of businesses and 25% of employees. The Auto Centre of LaQuinta is composed of three dealerships (refer to Figure 8, Auto Dealership Locations). These establishments employ 172 people, comprising 3.04% of the labor force within the Study Area. The sales tax revenue generated by this sector makes La Quinta (particularly the Highway 111 Corridor) plays an important role in the retail world of Coachella Valley. Residents of the GHÀQHG7UDGH$UHDZLOOVSHQGDQHVWLPDWHG $4.9 billion in retail sales (including food and beverage) during 2018, equal to about two thirds of all Coachella Valley retail sales. According to a 2015 Visitor Survey, tourist parties staying in La Quinta spent an average of $178 per day on dining and $515 on retail expenditures, well above overall Coachella Valley tourist averages. Figure 7, Highway 111 Retail Locations depicts the retail locations within the Study Area. Space inventory in La Quinta totals 3.9 million square feet (3.5 million square feet located in the 111 Corridor), equal to 12.6% of all retail space in Coachella Valley. Of the total La Quinta inventory, about 523,000 square feet (13.5%) is currently available for lease. Power centers along Highway 111 contain 1.6 million square feet of rentable building area, equal to 40% of the total La Quinta retail space inventory; over 60% of available Corridor retail space is in power centers. SUMMARY OF RETAIL FINDINGS: CITY OF LA QUINTA Center Type Rentable Building Area (SF) Total Available Space (SF) Availability Rate Average Weighted Rent (Annual) General Retail 421,742 51,046 12.1% $21.00 General Retail (Community Center) 564,503 13,660 2.4% $29.93 General Retail (Neighborhood Center) 578,621 115,599 20.0% $17.91 General Retail (Power Center) 1,559,072 282,590 18.1% $21.33 General Retail (Regional Mall) 649,230 43,934 6.8% $26.87 General Retail (Strip Center) 107,066 16,023 15.0% NA Grand Total 3,880,234 522,852 13.5%$23.00 RENTABLE RETAIL SPACE WITHIN LA QUINTA TABLE 1 12 HIGHWAY 111 CORRIDOR STUDY HIGHWAY 111 RETAIL LOCATIONS FIGURE 7 • Two clusters: 111 Corridor and La Quinta Village • 35,000 - 45,000 vehicles per day along 111 Corridor • 70% of City sales tax revenue • 75 retail, service, and restaurant facilities in 21 developments RETAIL LOCATIONS The vacant former Sam’s Club building offers an opportunity for a “Retailtainment” center. TECHNICAL ASSISTANCE PANEL 13 AUTO DEALERSHIP LOCATIONS FIGURE 8 Three automotive dealerships have a prominent presence along Highway 111 in La Quinta. Hyundai of La Quinta Torre Nissan Chevrolet of La Quinta 14 HIGHWAY 111 CORRIDOR STUDY GOLF / SPORTS ARCADE THEMES BarCades (Dave & Busters, Punch Bowl) Top Golf / Glow Golf Miniature Golf (Indoor) Ping Pong (Susan Sarandon) Bowling Alleys (Lucky Strike, ect.) Duck Pin Bowling Indoor Go Cart Tracks Indoor Shooting Galleries NOUVEAU THEATERS IMAX Children’s Themed Theaters Hipster / Art House Theaters ATHLETIC SPACES Aquatic Parks Trampoline Rooms Indoor Rock Climbing Indoor Skydiving Velodromes (indoor cycling) Culture / Performing Arts Space Art Galleries Museum Space Live Theater Space Dinner Theaters Cirque Space Stand Up Comedy Clubs Live Music Venues Float Rooms POTENTIAL RETAILTAINMENT USES Experiential retail centers attract patrons with playful, participatory environments. TECHNICAL ASSISTANCE PANEL 15 a substantial contribution to the City’s annual budget. Visually, the aesthetic character of the Corridor at the dealership locations is dominated by a view of cars, with vehicles parked within the landscaped area. HOSPITALITY FINDINGS The commercial lodging inventory in La Quinta is limited, consisting of just four properties with a total of 1,095 rooms. The vast majority of available hotel rooms within La Quinta (nearly 800, accounting for 73%) are at a single property, the iconic Waldorf Astoria La Quinta Resort and Club (a Hilton brand). Two of the RWKHUSURSHUWLHVERWKXQGHU+LOWRQÁDJVDUH limited service, which, in most markets typically cater to business travelers or budget-oriented leisure travelers. Room rates (Average Daily Rate - ADR) in all SURSHUWLHVYDU\VLJQLÀFDQWO\E\WLPHRI\HDU with high season rates (November through May) often twice those in low season. In addition, weekend rates are higher than weekday rates by about 12%, on average. Due to limited number of rooms, localized performance information about room rates and occupancy levels is only available for the 2,400 combined total rooms in the cities of Indian Wells (3 properties, 1,305 rooms), and La Quinta (4 properties, 1,095 rooms). Occupancy rates in La Quinta/Indian Wells (LQ/IW) are second-lowest of all Coachella Valley submarkets. Weekend occupancy rates in LQ/IW average 76% annually (compared to the Valley average of 79%), while weekday rates in LQ/IW average 51% (compared to 55% valleywide). ADR within La Quinta facilities is $218 ($209 weekday, $233 weekend), about $50 lower than overall Coachella Valley rates for both weekday and weekend. The vast majority of trips were for leisure purposes, a fact that points to an opportunity to encourage tourism and promote the hospitality industry within the City. Entrance to the Waldorf Astoria La Quinta Resort and Club, an iconic hospitality property. 16 HIGHWAY 111 CORRIDOR STUDY RESIDENTIAL FINDINGS RENTAL APARTMENTS The rental market in Coachella Valley is multi- faceted, including rental apartments, single family homes and mobile homes. Apartment developers generally have shunned Coachella Valley for more productive areas closer in to the employment and population EDVHV RI ,QODQG (PSLUH 7KH ODVW VLJQLÀFDQW market rate apartment project in Coachella Valley was delivered in 2010 in Palm Springs. Coachella Valley contains 9,500 affordable apartment units, including over 800 delivered since 2010, mostly in Indio and Coachella. The newest apartment project in La Quinta (built in 2014), 176-unit Coral Mountain Apartments, is an affordable housing community. Average apartment occupancy across Coachella Valley is 97.9%, with average rents of $1.16 per square foot per month. Although nearly one in four Trade Area residences are renter-occupied, rental apartment project choices in La Quinta are limited. Among 12 apartment projects in La Quinta, the 1,696 units (including 898 affordable) showed an average occupancy of 98.4%, with average rents of $0.73 per square foot per month for affordable units and $1.41 for market rate. FOR-SALE HOUSING The Trade Area for-sale market is dominated by resales, which accounted for over 87% of all residential transactions in the most recent 3-month period. New homes captured less than 3% of transactions in the same period. Average transaction price was $473,294, an average of $204.89 per square foot. Nearly 90% of all transactions were priced between $300,000 and $400,000. Over three of four sales transactions were for detached homes. Five new home projects were active in La Quinta during Second Quarter 2018. Average price for new home projects in La Quinta is $730,000 ($251 per square foot). Visitor survey data (collected in 2015 by the Greater Palm Springs CVB, from hotel guests only) show that those staying in La Quinta hotels spent well above average amounts during their visits to Coachella Valley. Average daily Dining spending for La Quinta guest parties was $178, compared to $121 for valleywide guests. Average daily shopping spending for La Quinta guest parties was $515, compared to $115 for valleywide guests. TECHNICAL ASSISTANCE PANEL 17 IMPLICATIONS / CONCLUSIONS GENERAL MARKET TRENDS Tourism is the leading economic force in Coachella Valley, with tourists directly spending more than $5.1 billion in 2017. &RXQWLQJGLUHFWDQGLQGLUHFWEHQHÀWVWRXULVP led to $7 billion in business sales in the Valley. Approximately 22% of all Valley jobs are tied to tourism. Home values are forecast to grow RQO\PRGHVWO\RYHUWKHQH[WÀYH\HDUV Ecommerce will be highest for media, sporting, and hobby goods as shown in Figure 9, Ecommerce Share of Sales By Category. Food DQG EHYHUDJH VDOHV ZLOO QRW EH VLJQLÀFDQWO\ impacted by ecommerce. RETAIL CONDITIONS & OPPORTUNITIES Retail activity is strong throughout the Valley. In 2018, retail sales are expected to total $7.4 billion across Coachella Valley, including $4.9 ELOOLRQLQWKH7UDGH$UHDGHÀQHGE\DPLOH radius circle around the La Quinta Highway 111 Corridor. The 111 Corridor accounts for over 70% of La Quinta’s retail activity. Existing businesses in the 111 Corridor range over a wide spectrum of NAICS codes, but two categories, retail and food service dominate, with a combined 33% of establishments and 69% of employees in the Corridor. ECOMMERCE SHARE OF SALES BY CATEGORY FIGURE 9 18 HIGHWAY 111 CORRIDOR STUDY Non-retail attractions and facilities can play an important role in the future viability of retail along the corridor. The future of retail will be heavily dependent on freestanding experiential facilities, as well as those incorporated within the retail spaces themselves. Some of the currently vacant parcels in the Corridor could be developed (even on an interim basis) as attractions and public use spaces, with the goal of bringing potential customers for the retail spaces that already exist or may exist in the future along the Corridor. While certain categories of retail are over- represented in the Trade Area, there are opportunities for additional facilities in a number of retail categories, including new, experiential versions of traditional retail including: building and gardening materials and supplies, specialty food stores, sporting goods, hobby, musical instruments and book stores, drinking establishments, and full service restaurants. Some, but not all, of this opportunity might be accommodated in existing vacant space. HOSPITALITY CONDITIONS & OPPORTUNITIES Commercial lodging facilities are limited in /D4XLQWDZLWKMXVWIRXUSURSHUWLHVLGHQWLÀHG including two limited service hotels, one boutique, and one major resort. The hospitality business is strongly leisure-oriented and cyclical, both in terms of seasonality (high season is November through April/May) and day of week. La Quinta properties tend to perform on par and compete with other properties throughout Coachella Valley. The 22-acre approved Shopoff development LQWKH&HQWUHRI/D4XLQWD6SHFLÀF3ODQDUHD includes a 125-room limited service hotel along with residential development (refer to Figure 10, Centre of La Quinta Conceptual Site Plan). Other planned hospitality projects include SilverRock Luxury Resort, a proposal scheduled to open in October 2019 that will bring the Montage and Pendry brands to La Quinta. The La Quinta Resort property accounts for 73% of all the available hotel rooms within La Quinta TECHNICAL ASSISTANCE PANEL 19 PROPOSED CENTRE OF LA QUINTA FIGURE 10 RESIDENTIAL CONDITIONS & OPPORTUNITIES Coachella Valley has seen modest population and housing growth since the Great Recession, DQGJURZWKZLOOEHPRGHUDWHRYHUWKHQH[WÀYH years. Existing apartment projects, particularly affordable communities, tend to run close to or at 100% occupancy, with relatively low rents that are resistant to upward pressure due to the lower-wage nature of the area’s economic base. The proposed Shopoff development in the &HQWUH RI /D 4XLQWD 6SHFLÀF 3ODQ DUHD includes small lot single family and multi-family homes ranging from 1,500 to 2,059 square feet. This project will introduce market rate for- sale homes to the Study Area, within walking distance of the centrally located retail establishments. 20 HIGHWAY 111 CORRIDOR STUDY • Tourism is the leading economic force in Coachella Valley. • Experiential retail continues to grow, providing a tool to attract brick and mortar business lost to cyber shopping. • Other retail opportunities: farmer’s market, new generation hobby, music & book stores that incorporate participatory experiences, building and gardening supplies, drinking establishments, and full service restaurants. • La Quinta’s hospitality properties perform on par & compete with others in Coachella Valley. Currently hospitality demand exceeds supply. • 5HVLGHQWLDOJURZWKZLOOUHPDLQPRGHUDWHRYHUWKHQH[WÀYH\HDUV • Demand for higher-end rental apartments is limited due to competition from a shadow inventory of homes and condominiums for rent. • Existing apartments run at approximately 100% occupancy with lower rents due to lower-wage nature of the area’s economic base. MARKETING REPORT KEY FINDINGS Tourism is the major economic driver of the Coachella Valley, an under served market segment. TECHNICAL ASSISTANCE PANEL 21 FOCUS GROUPS The Technical Assistance Panel met with focus group members during an outreach session held at La Quinta City Hall on April 25, 7ZHQW\ÀYHPHPEHUVRIWKHFRPPXQLW\ participated including several Planning Commissioners, staff members from public agencies of other communities, and local property owners and businessmen. A desire for the Panel to address the Study Area with a long range viewpoint was voiced, in light of rapidly changing technology. The fact that these advances are having an effect on consumer behavior and spending habits was discussed. Ultimately, this change in spending habits may affect the future economic viability of the City. Big box retail has been successful in the past; however with the recent bankruptcy and closure nationwide of many retailers, the importance of careful consideration other types of retail and other uses was emphasized. A great deal of interest in activating the pedestrian character of the Study Area was expressed, with a high emphasis on multi- modal transportation and connections to CV Link. The fact that many communities have successfully incorporated electric bike sharing makes this option a desirable opportunity to engage community members who may not otherwise participate in enjoyment of the trail. Additional discussion included methods of dealing with the extreme climate conditions to increase pedestrian activity such as providing shading, seating and drinking fountains. It was suggested that a pedestrian scaled enhanced mobility district would likely draw a multiple consumer mind set rather than single purpose big box shoppers who will likely purchase on- line in the future. Concerns about maintenance were also voiced, with participants citing a lack of visibility as one of the challenges. A central maintenance mechanism was suggested to achieve a uniform level of aesthetic quality throughout the Study Area. Suggested alternative uses were daycare, dog park, indoor tennis center or other sports to bring people for other reasons than retail. Flexible space, including sub-leasing of tenant space during festivals was suggested to capture tourist spending. Incentives to encourage hospitality uses were suggested, which have been successful in other neighboring (and competing) communities within the Coachella Valley. Suggested incentives include relaxing of parking standards, and phased payment of development fees. 22 HIGHWAY 111 CORRIDOR STUDY CV LINK PROPOSED CV LINK ALIGNMENT FIGURE 11 A new spine for alternative transportation in the Coachella Valley, the CV Link is a planned ÀIW\PLOHPXOWLPRGDOIDFLOLW\WKDWZLOOWUDQVYHUVH the northern edge of the Study Area adjacent to the Whitewater River Channel. Ultimately connecting nine cities and three tribal governments, the CV link will accommodate pedestrians, bicycles, and low speed electrical vehicles such as golf carts and neighborhood electric vehicles. The proposed alignment of the CV link is featured in Figure 11 above. By bringing national recognition to the Coachella Valley, this healthy and sustainable transportation URXWHZLOOEHQHÀW/D4XLQWDHFRQRPLFDOO\E\ attracting tourists and overnight visitation. Health based competitive events can be SITE anchored by the trail that will draw nationwide attendance from runners and cyclists. The CV Link will also provide a safer, free alternative to navigation of existing roadways. Local residents will enjoy a connection to schools, jobs, neighborhoods, entertainment, shopping, and public parks. Dual pathways separating pedestrians from low speed electric vehicles and cyclists will enhance safety for all types of multi-modal transportation. This new amenity has the potential to transform La Quinta if public attention is directed to it by DZD\ÀQGLQJV\VWHP(QKDQFHGFRQQHFWLRQV to existing and proposed properties within the Study Area are also key to capitalizing on this important feature. 1RWHWKHÀQDO&9/LQNURXWHZLOOEH chosen once the environmental review is complete. The CVAG (Coachella Valley Association of Governments) has expressed intent that the City of Rancho Mirage be omitted from the project. TECHNICAL ASSISTANCE PANEL 23 Artist’s rendering of typical segment of CV Link, including EV charging station. 7KH&9/LQNLVDPDMRULQÁXHQFHRQWKH6WXG\$UHDKDVDKLJKGHJUHHRIFRPPXQLW\VXSSRUW TECHNICAL ASSISTANCE PANEL 25 3. RECOMMENDATIONS The Design Team panel members, including architects and landscape architects, met April 18th for a brain storming session in La Quinta to evaluate the existing conditions of the Study Area. Current trends in urbanization were touched on as potential solutions were discussed. 7KHWHDPVWDUWHGZLWKGHÀQLQJWKHGLVWDQFH of a comfortable walk given the climate conditions. Walkability diagrams were delineated, and because of the scale of the Study Area, it was determined that the best approach would be to create pockets RIDFWLYLW\ZKHUHLQWHQVLÀFDWLRQFRXOGRFFXU more rapidly than other, more established areas that are currently contributing to the local economy. Focusing on engaging both sides of the Corridor and the most effective ways to tie into the CV Link, a number of rough sketches were completed (see Figure 12, Preliminary Studies 7KHVHURXJKLGHDVZHUHWKHQUHÀQHG into three land use exhibits, depicted in Figures 13, 14, and 15. As the team members tested their concepts and presented them to the larger group, a clear direction began to emerge, as described on the following pages. 26 HIGHWAY 111 CORRIDOR STUDY PRELIMINARY STUDIES FIGURE 12 TECHNICAL ASSISTANCE PANEL 27 7KH'HVLJQ7HDPLGHQWLÀHGDUHDVZLWKLQWKH Study Area that have the most potential for development. These were then evaluated in terms of readiness and were assigned within three phasing categories. Sites that could be immediately ready for new opportunities were categorized as “Short Term Catalyst Sites”. Development of these sites could act as a springboard toward energizing and revitalizing the entire Corridor, and are shown in yellow in Figure 13 above. Included in these areas are the vacant former PHASED CATALYST SITES FIGURE 13 TE TE TE 352326('3('(675,$1%5,'*( /(*(1'/(*(1' SHORTERM CATALYST SITE MIDTERM CATALYST SITE LONGTERM CATALYST SITE LAND USE ANALYSIS Sam’s Club building, the City owned parcel to the east, the movie theater back parking area, the central vacant lot adjacent to the CV Link, and the area connecting the One Eleven Shopping Center to the CV Link. Of these four, the Sam’s Club building has the highest potential of being repurposed since it has recently been purchased. 0LGWHUPFDWDO\VWVLWHVKDYHEHHQLGHQWLÀHG in orange above, consisting of parking areas or other under utilized spaces that could be activated after the other sites come forward. 28 HIGHWAY 111 CORRIDOR STUDY $576 (17(57$,10(1 7 ',6 7 5 ,&7 0 ,1 : $ / . .5(7$,/ 5(&5($&(1785<029,( 7+($7(56 7$5*(7 /2:(6 .2+/6 352326(' 3('(675,$1 %5,'*( PEDESTRIAN THEMED DISTRICTS As the Design Team studied potential catalyst sites, three areas emerged as separate districts, each within a separate 5-minute walking distance. These three Districts are depicted in Figure 14 at right, Pedestrian Themed Districts. The western portion of the Study Area was themed as an Arts and Entertainment District anchored by the Century Movie Theater. The north-south connections are vital to the overall functionality of the site, and a pedestrian bridge over Highway 111 was proposed, to link the entire Arts District to the CV Link. A circular multi-modal “Green Street” was proposed joining both sides of the Corridor featuring VDIHZHOOGHÀQHGHQKDQFHGSDYHPHQWDQG shaded walkways to provide for uses such as an outdoor farmer’s market, pedestrian oriented pop-up art festival or a culinary extravaganza. URBANIZATION MECHANISMS The red sites indicate long term catalyst areas that could become available at a time in the future when less surface parking is needed because a dramatic increase in ride hailing and ride sharing has occurred. As noted in Section 2, the majority of the Study Area is currently used for surface parking, which is the antithesis of vibrant space. Many of these areas exceed the City’s minimum parking requirements and were included to ÀOODQHHGRQSHDNVKRSSLQJGD\VWKDWRFFXU once or twice a year. These spaces represent a “land bank” of opportunity. Managing these areas collectively, rather than individually, could be the key to regaining this space, and taking advantage of an important opportunity for activating the Corridor.Enlargement of the central core area. The Arts and Entertainment District. TECHNICAL ASSISTANCE PANEL 29 PEDESTRIAN THEMED DISTRICTS FIGURE 14 $576 (17(57$,10(1 7 ',6 7 5 ,&7 +2 63,7$/,7< 0,; ( '  8 6(',675,&7 0 , 1 : $ / .  0 , 1 : $ / . 0 , 1  : $ / .  0 , 1 : $ / . .5(7$,/ 5(&5($7,2 1 ',6 7 5 ,&7 &(1785<029,( 7+($7(56 7$5*(7 /2:(6 67$7(5%526 6,1*/()$0,/< 5(6,'(17,$/ 6,1*/()$0,/< 5(6,'(17,$/ 6,1*/()$0,/< 5(6,'(17,$/ 6,1*/()$0,/< 5(6,'(17,$/ 08/7,)$0,/< 5(6,'(17,$/08/7,)$0,/< 5(6,'(17,$/ :$/0$57 &25$/02817$,1 $3$570(176 +20('(327 &267&2 352326(' 5(6,'(17,$/ '(9(/230(17 +27(/ .2+/6 632576 ),(/'6 632576 ),(/'6 632576 ),(/'6 /$48,17$ +,*+6&+22/ 352326('3('(675,$1 %5,'*())$$00,/< (1(177,,$/ /(*(1' COACHELLA VALLEY WASH GREEN SPACE OPPORTUNITY CV LINK HWY 111 MAJOR NS STREETS BUILDING EDGE OPPORTUNITY EXISTING BUILDINGS SHARED STREET / SHADED WALK PLAZA / COURTYARDS ENHANCED INTERSECTION PEDESTRIAN ACCESS TO CV LINK 30 HIGHWAY 111 CORRIDOR STUDY RETAIL AND RECREATION DISTRICT The central portion of the site includes the vacant Sam’s Club building and another vacant parcel adjacent to the CV Link. This area was envisioned as a retail and recreational site. The vacant parcel would be a great place for family activities like a splash park that would draw visitors from the CV Link. The Sam’s Club building has many potential indoor recreation uses including Top Golf, volleyball, or indoor soccer or batting cages. The Sam’s Club parking area is a potential ORFDWLRQIRUDQLQWHQVLÀHGUHWDLOWDLQPHQWDUHD ,IFRUUHFWO\LPSOHPHQWHGWKLVLQWHQVLÀHGXVH could draw tourists to the corridor, especially if vibrant night life and innovative lighting was offered. 0 , 1 : $ / . 0 , 1 : $ / .5(7$,/ 5(&5($7,2 1 ',6 7 5 ,&7 08/7,)$0,/<08/7, )$0,/< :$/0$57 &2 $ 352326(' 5(6,'(17,$/ '(9(/230(17 +27(/ +2 63,7$/,7< 0,; (' 8 6(',675,&70 , 1  : $ / . 0,/< 17,$/ &25$/02817$,1 $3$570(176 +20('(327 &267&2 The Retail and Recreation District. HOSPITALITY AND MIXED USE DISTRICT The eastern portion of the Study Area, centered on a vacant City owned site, was LGHQWLÀHGE\WKH'HVLJQ7HDPDVD+RVSLWDOLW\ and Mixed Use District. The central parcel is a potential location for a boutique hotel that could be connected to a major community open space amenity such as an urban plaza. Once established, the hotel would spark XUEDQ LQWHQVLÀFDWLRQ SRVVLEO\ OHDGLQJ WR vertical mixed use development featuring market rate housing. A pedestrian connection to the CV Link would bring more attention to this location, positioning it as a prime tourism destination once the other areas of the Corridor have been activated. A hotel in this location would bring additional support to the existing and future retail, since tourists tend to spend more on dining and shopping than year-round residents.The Hospitality and Mixed Use District. TECHNICAL ASSISTANCE PANEL 31 EVENT DISTRICT OPPORTUNITIES FIGURE 15  0 , 1  : $ / . 0,1: $ / . 0 , 1  : $ / . .  0 , 1  : $ / . 0 ,1:$/.  *5((123(1 63$&( *5((123(1 63$&( *5((123(1 63$&( 685)$&( 3$5.,1*/276 &20081,7< /2&$/(9(176 &20081,7< /2&$/(9(176 ,1'225 (9(176 T L 352326(' 3('(675,$1%5,'*( /(*(1'/(*(1' EVENTS DISTRICT GREEN OPEN SPACE - EVENTS SUITABLE FOR PARK OR PASSIVE SETTING SURFACE LOTS - EVENTS SUITABLE FOR VAST ASPHALT PARKING LOTS COMMUNITY BASED EVENTS - EVENTS RELATED TO LOCAL AND COMMUNITY BASED EVENTS INDOOR EVENTS - EVENTS INSIDE VACANT BIG BOX RETAIL POTENTIAL EVENT DISTRICTS The Study Area has great potential to host events which would energize retail activity. The designers overlaid a central “Events District” over the recreation and retail area. Surface parking areas are large enough to house a typical “retailtainment”area of urban LQWHQVLÀFDWLRQ ,PDJHU\ RI WZR H[DPSOHV “Container Park” in Las Vegas, and “The Camp” in Costa Mesa, are included in on pages 32 and 33. These examples feature under-utilized parking lots repurposed into lively centers featuring restaurants, specialty retail, artisan spaces, and entertainment. The team envisioned creating a connection IURPWKLVFHQWUDOKXEWRWKHVSRUWVÀHOGVDFURVV the channel adjacent to the high school via the existing Adams Street Bridge. This bridge includes an artful placemaking design UHÁHFWLYH RI WKH GHVHUW ,W LV UHFRPPHQGHG that the pedestrian experience be enhanced through street furniture, shade structures, and other mechanisms to bring a sense of human scale the Corridor. A secondary local gathering space is planned behind the movie theater to activate the connection to the existing residential neighborhood. Valet parking is a tool often implemented to increase the available parking and works well for many retailtainment projects during peak demand and holidays. %HFDXVHRIWKHVFDOHRIWKHVLWHZD\ÀQGLQJLVD vital tool to facilitate pedestrian connections and unify all of the major features. These monuments and signs would be one of the components that establishes a new identity for the Corridor, creating a perception of La Quinta as the new, thriving, “cool” place. 32 HIGHWAY 111 CORRIDOR STUDY Container Park, a retailtainment center constructed from shipping containers in Las Vegas, Nevada TECHNICAL ASSISTANCE PANEL 33 Images of The Camp, a retailtainment example in Costa Mesa, California 34 HIGHWAY 111 CORRIDOR STUDY STREET CONNECTIONS FIGURE 16 REETS CENTURY MOVIE THEATERS TARGET PROPOSED PEDESTRIAN BRIDGE LOWES STATER BROS. SINGLE FAMILY RESIDENTIAL SINGLE FAMILY RESIDENTIAL SINGLE FAMILY RESIDENTIAL SINGLE FAMILY RESIDENTIAL MULTI-FAMILY RESIDENTIAL MULTI-FAMILY RESIDENTIAL WALMART WOLF WATERS APARTMENTS HOMEDEPOT COSTCO PROPOSED RESIDENTIAL DEVELOPMENT HOTEL KOHLS SPORTS FIELDS SPORTS FIELDS SPORTS FIELDS LA QUINTA HIGH SCHOOL INGINGGLE FLAMILY RERESISIDENTIAL LEGEND COACHELLA VALLEY WASH CV LINK HWY 111 PRIMARY NS STREETS SECONDARY NS STREETS TERTIARY STREETS TREE LINED / SHADED STREETS MAJOR INTERSECTION MINOR INTERSECTION LANDSCAPE DESIGN $ XQLÀHG ODQGVFDSH DHVWKHWLF LV LPSHUDWLYH for the future success of the Study Area. The SilverRock Resort serves as a potential source of inspiration for the level of quality to be emulated within the Corridor. Figure 16, Street Connections sets a hierarchy of street types for thematic treatments, setting forth a pattern for design that could create a more engaging and aesthetically-pleasing experience. Figure 17, Landscape Framework depicts a conceptual overall planting plan featuring Date Palms as a central unifying element. Figure 18 shows a typical section of Highway 111 with meandering sidewalks of both sides and a central median. Inclusion of a variety of drought tolerant plant species will not only result in water savings, but will also serve as an inspiration for adjacent business owners. The use of native, environmentally friendly plant species has a positive effect on the overall ecology of a space, resulting in long range HQYLURQPHQWDOEHQHÀWV In addition to plantings, shade structures would enhance the pedestrian experience, offering respite from the desert sun. Thematic street lights, benches, trash receptacles, bus stops, and signage will reinforce the design concept. Pages 32 and 33 include imagery of typical shading, paseo treatments, and corner treatments. TECHNICAL ASSISTANCE PANEL 35 LANDSCAPE FRAMEWORK FIGURE 17 HIGHWAY 111 SECTION FIGURE 18 **************************************************************************************************************************************************************************************************************************** ***************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************** ********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************** ************************************************************************************************************************************************************************************************************************************************************************************************************************************* S PROPOSED PEDESTRIAN BRIDGE ********************************************** **************************************************************************************************************************************************** ***************************************************** *********************************************** ************************************************************************************************************************************************************************************************************* ********************************************************************************************************************************************************************************************************************** ****************************************************************************************************************************************************************************************************************************************************** ********************************************************************************************************************************************************************************************************************************** ******************************************************************************************************************************************************************************************************************************************** *************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************** *************************************************************************************************************************************************************** *************************************************************************** **************************************************************************************************************************************** ********************************************************************************************************************************** ********************************************************************** ******************************************************************************************************************************************************************* * **************************************************************************************************** ************************************************************************************************************************************************************************************************************************************** ******************************************* ************************************************* ********************************************************************************** **************************************************** ************************************************************ **************************************************************************************** **************************************** **************************************** **************************************************************************************************** ****************************************************************************************************************** **************************************************************************************************************************************************************************************************************** *************************************** *************************************************************************************************************************************************************************************************************************************************************** ******************************************************************************************************** ****************************************************** ************************************************************************************************************** ************************************* ************************************************************************ ******************** CENTURY MOVIE THEATERS TARGET LOWES STATER BROS. SINGLE FAMILY RESIDENTIAL SINGLE FAMILY RESIDENTIAL SINGLE FAMILY RESIDENTIAL SINGLE FAMILY RESIDENTIAL MULTI-FAMILY RESIDENTIAL MULTI-FAMILY RESIDENTIAL WALMART WOLF WATERS APARTMENTS HOMEDEPOT COSTCO PROPOSED RESIDENTIAL DEVELOPMENT HOTEL KOHLS SPORTS FIELDS SPORTS FIELDS SPORTS FIELDS LA QUINTA HIGH SCHOOL LEGEND COACHELLA VALLEY WASH HWY 111 - STREET TREES NS STREETS ROUNDBOUT PALMS TREE LINED / SHADED STREETS PARKLET SPACES GREEN STREETS MAJOR INTERSECTIONS MINOR INTERSECTIONS **************************************************************************************************************************************** 36 HIGHWAY 111 CORRIDOR STUDY HIGHWAY 111 INTERSECTION TREATMENT FIGURE 19 Example of a palm lined arterial street. Example of corner treatment. TECHNICAL ASSISTANCE PANEL 37 INTERIOR GREEN STREET SECTION FIGURE 20 Example of a paseo lined with palms Example of a shade structure. 38 HIGHWAY 111 CORRIDOR STUDY PLANT PALETTE - TREES & SHRUBS FIGURE 21 TREES SHRUBS TECHNICAL ASSISTANCE PANEL 39 PLANT PALETTE - SUCCULENTS & GROUNDCOVER FIGURE 22 SUCCULENTS GROUNDCOVERS 40 HIGHWAY 111 CORRIDOR STUDY PUBLIC POLICY RECOMMENDATIONS A community’s ability to change destiny begins with intentionality. In large and small cities nationwide, it has been demonstrated that local leadership can be the force that creates a better future. The process of bringing forth positive outcomes has already begun in La Quinta with the advent of the CV Link. Capitalizing on the momentum of this asset is one of the keys to the future success of the Study Area. The creation of a Mixed Use Overlay District for the Corridor within the 2035 General Plan was a major step in the direction of revitalization of WKH6WXG\$UHD,QRUGHUWRLPSOHPHQWDXQLÀHG vision, it is recommended that preparation of a Corridor Area Plan be authorized (Option 2 of the three suggested by the City on page 4). This will be the quickest and most cost effective vehicle for expanding the vision started with the TAP process. This option would allow for writing standards and guidelines to facilitate WKHFUHDWLRQRIDXQLÀHGLGHQWLW\6HYHUDONH\ components should be covered including: • Enact new Development Regulations, including an allowance for reduced parking standards. • Policy for preferred architectural form for a XQLÀHGYLVLRQDQGFRPSDWLEOHIRUPV • $OORZDQFHIRUÁH[LELOLW\RIXVHVWRPHHWUDSLGO\ changing needs including pods of mixed use urbanization. • +LULQJRIDQDWLRQDOO\UHFRJQL]HGÀUPWRLQLWLDWH DXQLÀHGEUDQGLQJWKHPHQDPLQJORJRIRU the Corridor area. • Implementation of a commercial signage program including multi-tenant signs. • ,QLWLDWLRQ RI D XQLÀHG ZD\ÀQGLQJ DQG PRQXPHQWV SURJUDP UHÁHFWLQJ WKH FHQWUDO theme of the Study Area. • Engage pedestrians and connect both sides of the Corridor to the CV link with an overpass that would serve as a major entry statement. • Create a welcoming and thematic entry reinforced by transit / trolley stops at both ends to encourage visitors. These recommendations have the potential to catapult the Corridor from a place having a low sense of identity to a sensationally vibrant, XQLTXHSODFHZLWKDXQLÀHGDXWKHQWLFUHDGLO\ LGHQWLÀDEOHDHVWKHWLF A pedestrian bridge across the 111 Highway Corridor would be a powerful placemaking element. TECHNICAL ASSISTANCE PANEL 41 FINANCE RECOMMENDATIONS Since California’s redevelopment funding has HQGHGLQQRYDWLYHSDUWQHUVKLSVDQGÀQDQFLQJ methods have become necessary to move FRPPXQLWLHVIRUZDUG3XEOLFÀQDQFLQJFDQEH used to catalyze private investment as a tool to initiate redevelopment. The following list includes potential mechanisms for combining various sources of funding to facilitate change: • Business Improvement Districts (BID) Assessment to fund improvements and services encouraging business development. • Enhanced Infrastructure Finance District (EIFD) Similar to BID but 55% voter approval / 45 year bond. Increased tax revenue is used to repay bonds. • ,QÀOODQG7UDQVLW,PSURYHPHQW'LVWULFW 1,)7, 3URPRWHVLQÀOOKRXVLQJQHDU  transportation centers, pending approval by CA legislature. • Public Private Partnerships (PPP) Investors / city work jointly to improve DUHDÀQDQFHSDUWQHUVZLWKYHVWHG interest in area. • Participating Ground Leases (PGL) Option for City-owned land to incentivize creative & stimulating development that will draw interest. • Tourism Business Improvement District (TBID) Partner with other CV cities to jointly fund improvements and return a portion of the total to the district to promote tourism. Great cities happen strategically, and positive outcomes require a willingness to move beyond the status quo and adopt a spirit of intentionality. Every City has a choice to either accept things as they are or strive for a better future. 7KHVHÀQDQFHPHFKDQLVPVKDYHWKHSRWHQWLDO to bring the City’s dreams, (some of which are outlined in this document) to reality. Imagining DGLIIHUHQWIXWXUHLVWKHÀUVWVWHSWKHQSXWWLQJ together the right mix of ingredients to take advantage of coming trends is the key to positioning the Study Area for success. TECHNICAL ASSISTANCE PANEL 43 4. IMPLEMENTATION The Study Area functions as a stable revenue generator for the city, and this is likely to continue in the immediate future. However, an understanding of changing consumer trends will facilitate the decision-making process in regard to the best future uses for the Corridor. The following discussion involves the relationship of emerging technologies, DQGGHPRJUDSKLFLQÁXHQFHV CURRENT TRENDS In the next ten years, Amazon.com, and similar on-line purchasing companies will continue to disrupt big box spending, however experts predict that retail experiences of discovering great products and socializing with others will continue. As Millennials mature (born 1981 - 1996, 22-37 years old), demand for vibrant and diverse “cherish” shopping will be stronger. Traditional brands of earlier generations generally do not resonate with them. Millennials are a diverse group that tend to enjoy the expression of their individuality. This segment is drawn to “cool streets” that offer live entertainment, food oriented amenities and craft brewing establishments. Artisan products and retailers that enable customers to customize their 7$3SDUWLFLSDQWVSUHSDULQJIRUWKH6WXG\6HVVLRQSUHVHQWDWLRQRIÀQGLQJV 44 HIGHWAY 111 CORRIDOR STUDY products will prosper. Personalization of unique items that tell a story will become increasingly popular with this age group. Centennials (born 1995 - 2003, age 14 - 21) have never known a world without smart phones. As this group gains more buying power the weaker links in the retail will be washed away, and more customer oriented, shopping for value and unique experiences will replace many national retailers currently on the watch list for bankruptcy. TECHNOLOGY Embracing disruptive technology is key to survival for success of retail businesses. Traditional shopping centers are facing multiple problems. In additional to competition from e-commerce, many standard big box retailers expanded too rapidly before the Great Recession, resulting in many locations struggling for attention from a shrinking market share. A promising future trend is the melding of brick and mortar stores and e-commerce where customers are able to browse samples, then order with their phone and have merchandise delivered within 24 hours. This trend holds true for auto dealerships as well - inventory is becoming irrelevant as buyers increasingly want to customize their new vehicles to suit their personal preferences. In the future less space will be needed for Corridor auto dealership locations, freeing land for more engaging uses. $QRWKHU WHFKQRORJ\ WKDW FRXOG EHQHÀW WKH Study Area is geofencing, a location-based service that sets up a virtual boundary around a geographic location. This location could be used for a variety of uses, such as sending messages to bicyclists along the CV Link who have downloaded an app, alerting them of daily events and specials when they enter the La Quinta segment of the trail. This could be used to draw interest and build support from festival visitors or other tourists who may not learn of the Corridor area otherwise. PLACEMAKING A vital component to the success of the Study Area is Placemaking - the creation of a unique environment that tells a story that is fresh or draws from the heritage of an area. Millennials and Centennials are drawn to areas perceived as “cool,” meaning they are not rubber stamped centers with nationally recognized brands. Art and culture need to be the nucleus of the design concept and an DPSOLÀFDWLRQRIH[LVWLQJDUWLVWLFUHVRXUFHVZLOO be one of the keys to future success of the Corridor. Engaging artists who reside within the Coachella Valley early on in the placemaking process such as writers, musicians, visual artists, and chefs, will foster a sense of local pride that will draw attention to the Corridor. Inclusion of historical references and aspiring local talent will give a sense of authenticity to the placemaking process beyond what can be accomplished by branding alone. Early wins in the design process can be used as a tool to generate public excitement. Timing is critical to the success of any project, and WKHRSHQLQJRIWKHÀUVWVHJPHQWRIWKH&9/LQN Existing placemaking element in La Quinta. TECHNICAL ASSISTANCE PANEL 45 (hopefully in La Quinta) could be a strategic time to unveil initial plans for the Highway 111 Corridor Plan. Pop-ups are another tool to gain engagement - staging a pop-up park contest within the existing unused parking of the Study Area or a culinary art project combining food vendors with an art show could build public support and anticipation. SHARED ECONOMY Uber, Lyft, and Air B & B have recently ushered in the world of shared economy, where an extra room or SUV can become a source of extra income. Ride hailing has become so popular that public transportation is beginning to cancel routes and “curb management”, the planning of drop-off and pick up zones, has become a buzz word in transportation engineering. As this trend continues, and eventually moves into use of autonomous YHKLFOHVWUDIÀFLVOLNHO\WRLQFUHDVHHYHQLI of trips are shared. The shared economy emphasizes provision for multiple ways of moving through urban centers rather than primarily with privately owned vehicles. Bicycling is an important element of the shared economy, and represents the fastest-growing means of transportation in the United States. Today, electric bike sharing systems have been installed in over 120 urban centers nationwide. It is predicted that future electric bicycles will have regenerative batteries, recharging as they coast forward. This technology will expand bike sharing to broader groups including older active adults, especially in the warm desert climate. Not only is bicycling good for health and the HQYLURQPHQWLWLVDOVREHQHÀFLDOIRUEXVLQHVV According to ULI reports, retail sales increase as much as 46% when bicycle trails are added. Connections to the CV Link, shops oriented toward the trail, and electric bike sharing are vital to the Corridor’s on-going success. Electric bicycles are activating retail experiences in metropolitan areas nationwide. 46 HIGHWAY 111 CORRIDOR STUDY QUESTION #1 What funding or partnership strategies for improving Corridor aesthetics should the city consider? What is the right design to improve aesthetics and promote business visibility and access? The city should consider a public / private partnership for the city owned parcel as an incentive for a major hotel / mixed use development. A boutique hotel could provide an activity amenity area that would attract tourists and festival visitors to existing and future retail establishments. +LULQJDODQGVFDSHDUFKLWHFWXUHÀUPWRGHVLJQ street improvements and a master signage / monument program is recommended. A cohesive, upscale aesthetic will create a positive experience for motorists and pedestrians. Encourage pockets of urbanism to generate excitement and draw consumers: experiential retail and retailtainment concepts. Engage local artists in the placemaking process to foster a sense of local pride and authenticity. QUESTION #2 There is concern about the future viability of Hwy. 111, the largest tax revenue generator for the city: What are the appropriate size and mix of uses? The marketing report points to new generation type experiential specialty food stores, hobby, music, and book stores, building and gardening supplies, drinking establishments, and full service restaurants. What can the city do to promote a vibrant business community? 7KHFLW\VKRXOGHQFRXUDJHÁH[LEOHXVHVDQG parking reduction to create more space. 7KHPDWLF VLJQDJH  ZD\ÀQGLQJ FRKHVLYH attractive landscaping will create a more upscale appearance. Valet parking can be a way of providing more parking in less space. How can the city assist commercial uses as e-commerce continues to consume more market share? Hybrids between e-commerce and brick and mortar stores are becoming a popular FINAL ANALYSIS: ANSWERS TO QUESTIONS Local merchants recently embraced the shared economy by creating a rest station for Lyft drivers. TECHNICAL ASSISTANCE PANEL 47 QUESTION #6 :KDWDUHWKHFRVWVDQGEHQHÀWVRIDFRPSOHWH streets redesign of the highway 111 Corridor? A layered network approach to complete streets is an important means to provide choices and encourage active transportation. Costs include coordination and cooperation with private landowners, modest capital investment in paths and trails. %HQHÀWVDFFUXHGDUHQRDGGLWLRQDOULJKWRI way is required, safety enhancement and hazard avoidance, direct linkage between circulation and land use. QUESTION #7 What policy, land use and development strategies could be implemented now to position the Corridor for the future? Join forces with the Cities of Indio and Indian Wells to capitalize on existing regional draws and develop new attractions. Create policies that enhance the corridor, draw visitors and HQFRXUDJHH[SHULHQWLDOUHWDLO²EHÁH[LEOHZLWK allowed uses. QUESTION #5 What opportunities should the city consider when CV Link multi-use trail is constructed? The CV Link creates new gateways to the city and presents an opportunity to create a new image that will bring a positive “cool” perception of La Quinta. The city should HQFRXUDJH ZD\ ÀQGLQJ DQG OLQNDJHV KDW capitalize on the fact that connection to major ELF\FOHWUDLOVW\SLFDOO\LQFUHDVHIRRWWUDIÀFDQG retail revenues if correctly amenitized with QUESTION #4 Is vertical mixed use development the highest and best use from a city economic viability standpoint? Not at the present time but it will make sense at some point in the future so it’s important not to have policies that prohibit vertical mixed use development. Flexible standards that allow for a higher intensity of development are recommended. QUESTION #3 How will rapidly changing technologies affect the Corridor (autonomous vehicles, vehicle HOHFWULÀFDWLRQ8EHU/\IW " The shared economy and advent of driverless vehicles will have an impact on physical development of the Study Area. The needs of automotive dealership spaces will change. A move toward showrooms instead of inventory will require less space, freeing areas for other uses. Charging centers will be needed near activity areas for cars, EV’s, bicycles, and scooters. shade structures and resting areas. Implement a bike sharing program similar to the City of San Diego. Encourage new construction to face toward the channel / CV Link. Investigate new technologies such as geofencing which can propel business to the Corridor. replacement for big box retail. Providing LQFHQWLYHVVXFKDVUHGXFHGRUÁH[LEOHWLPLQJ for start-up fees and taxes encourage innovative solutions. 48 HIGHWAY 111 CORRIDOR STUDY ECONOMIC STRATEGIES • Add retail demand by increasing residential densities and capture attention of tourists and seasonal visitors. • ,GHQWLI\XQPHWGHPDQGDQGWKHQSURYLGHVXSSO\7KLVUHSRUWLGHQWLÀHG an unmet demand for hospitality, especially as a boutique hotel that could share a community amenity. • Through “invention” create a new product or experience and therefore a new demand. Retailtainment and experiential design could successfully create new energy, excitement, and vitality. MARKET POSITIONING • Existing retail is a stable revenue generator for the city and is geared toward residents. • The Study Area is largely under utilized with undeveloped properties, YDVWRSHQSDUNLQJDUHDVDQGRSSRUWXQLWLHVIRULQWHQVLÀFDWLRQ • The CV Link provides a potential draw if users are successfully engaged though linkages to the Study Area. • More consumer interest would add demand for hospitality uses, and would activate multi-modal transportation methods. BRANDING • Existing city brand already demonstrates high standards which will be elevated further with the introduction of the Montage and Pendry hotels. • Regional branding is critical to attracting tourism (Innovate 78 is a VXFFHVVIXOH[DPSOHHIIRUWRIUHJLRQDOO\EUDQGLQJÀYHQRUWK6DQ'LHJR County cities). • A brand for the Highway 111 corridor similar to the El Paseo District in 3DOP'HVHUWFRXOGGHÀQHWKH6WXG\$UHDDVWKHQHZ´FRROµDUHDIRU residents and visitors of all ages to experience. Engaging local artists has the potential to bring authenticity to this new identity • The CV Link is an intrinsic component of the new Corridor identity and should be emphasized in the branding process. FINAL CONCLUSIONS TECHNICAL ASSISTANCE PANEL 49 MANUEL BOUZA, AIA, LEED AP, Design Lead, MG2 Manuel Bouza has over 30 years of experience in local and LQWHUQDWLRQDO PL[HGXVH UHWDLO KRVSLWDOLW\ UHVLGHQWLDO DQG RIÀFH projects which he brings to his role as design leader for MG2’s ,UYLQHRIÀFH+HLVGULYHQWRFUHDWHXQLTXHSODFHVWKDWH[FHHGWKH expectations of his clients and create memorable experiences for the end-users. His expertise in designing impactful places is demonstrated in many notable projects in his portfolio, including the Getty Center in Los Angeles. He has built an incredible breadth RI NQRZOHGJH LQ WKH ÀHOG DQG LV SDVVLRQDWH DERXW PHQWRULQJ colleagues while continuing to work hard on his own projects. ANDREW BOWDEN, ASLA, Principal, LAND CONCERN – Landscape Architecture Andy specializes in master planned residential communities, assisted living communities, recreation facilities, and residential development. He has been a member of Building Industry Association of Southern California where he served as the Vice President of Councils and is currently on the Board of Directors for the Council on SAGE. Andy is active in the American Society of Landscape Architects and has been a two-time president of its Southern California Chapter, as well as serving two terms as Chapter Trustee. He was appointed by Governors Schwarzenegger and Brown to the Landscape Architects Technical Committee, and has served three times as the chair. SHEILA CEDERVALL, ASLA, LEED AP, Senior Associate, PLACEWORKS Sheila is an urban designer with more than 25 years of experience bringing vibrant, cohesive, and environmentally friendly communities to life. Her experience includes all phases of design and entitlements—from establishing the initial vision to working closely with local authorities to gain project approval. Sheila also specializes in sustainable building practices with an emphasis on water-wise landscape design. Before coming to PlaceWorks, she completed several transit-oriented projects encouraging multi modal methods of transportation, including SoCo Walk in Fullerton and the Transit District of the Great Park Communities in Irvine. 5. BIOGRAPHIES 50 HIGHWAY 111 CORRIDOR STUDY VAUGHAN DAVIES, Principal, Perkins Eastman Vaughan Davies has over 30 years of professional experience producing dynamic plans for downtowns, urban waterfronts, retail, resort and entertainment destinations, transit centers and mixed- use environments with an emphasis on creating vibrant ‘pedestrian ÀUVW·XUEDQQHLJKERUKRRGVLQFLWLHVODUJHDQGVPDOOQDWLRQDOO\DQG globally. Vaughan develops visionary plans and designs with a solid basis in reality, both in their authenticity and in their ability to be implemented successfully – he is a pragmatic visionary. Collaborating with major developers, cities, and agencies, he has GHPRQVWUDWHGDXQLTXHDELOLW\WRFUHDWHVLJQLÀFDQWDGGHGYDOXH for all interests involved, by creating one-of-a-kind addresses and focusing his design solutions on the establishment of a superior public realm as a unique and memorable amenity. CAROL MENTOR MCDERMOTT, Founder & Principal, Entitlement Advisors A specialist in land use entitlement and community issues management, Mrs. McDermott offers consulting expertise to the land development and building industries as well as to private individuals seeking assistance in maneuvering multiple jurisdictional hurdles. After serving as a partner in Government Solutions, Inc. (GSI) for 12 years, Mrs. McDermott formed an entity, Entitlement Advisors, to pursue consulting assignments and equity partnerships in the land use entitlement arena. Her experience has covered multiple agencies and communities in Orange, Los Angeles, San Diego, and San Mateo Counties in working with elected and appointed RIÀFLDOVFLW\FRXQW\DQG&RDVWDO&RPPLVVLRQVWDIIFRPPXQLW\ business, and environmental organizations. Her strength is in directing large and small teams of professionals on complex land use projects, providing project management and conducting community engagement to effectively address community issues, which leads to approvals for clients. STEPHEN NIETO, ASSOC AIA, Senior Urban Designer, South West Concepts With 9 years of experience, urban designer Stephen Nieto has extensive expertise in international and domestic large-scale master planning, urban design, and architectural projects. Stephen has broad experience working with clients in the public and private sector to create implementable master plans, dynamic mixed-use developments, and multi-family residential with a focus on design, sustainability, and pedestrian friendly environments. Stephen approaches each project with great sensibility toward contextual ÀWDQGDWWHQWLRQWR´SODFHPDNLQJµ0RVWUHFHQWO\6WHSKHQZDV a team member in the planning and awarding of the 2028 Los Angeles Summer Olympic Bid. TECHNICAL ASSISTANCE PANEL 51 ANTHONY “TONY” PETROS, Principal, LSA Associates, Inc. Tony is a Principal with LSA Associates, Inc., a full service planning DQG HQJLQHHULQJ ÀUP KHDGTXDUWHUHG LQ ,UYLQH +H PDQDJHV WKH WUDIÀFHQJLQHHULQJDQGSODQQLQJGLVFLSOLQHLQ&DOLIRUQLD+HSURYLGHG transportation planning and engineering services on major highway corridors, land developments, ports and terminals. He was the Project Manager for the Orange County Sustainable Communities Strategy, a Countywide effort to address greenhouse gas emission reduction, and the Orange County Long Range Transportation Plan, a 20 year vision of mobility for the County. In 2012 Tony was elected to the City of Newport Beach City Council from District 2. He chaired the City’s Bicycle Safety Committee, and was responsible for the preparation of a comprehensive Citywide Bicycle Master Plan, a $22 million roadmap to safe cycling in the City. SERGIO RAMIREZ, Deputy Director of Economic & Property Development Department – City of Long Beach Sergio is directly responsible for oversight of the Real Estate and Property Services Division of the City. Previously, Sergio spent 12 years with the City of Anaheim’s Community & Economic Development 'HSDUWPHQWZKHUHKHZDVLQYROYHGLQPDQ\RIWKH&LW\·VKLJKSURÀOH hospitality, retail, mixed-use, residential and sport facility projects. Recently, Sergio was head of the Amazon HQ2 bid representing the City of Long Beach in a dual-pronged submission with both the LAEDC and a partnership with City of Huntington Beach, which received national attention. His out-of-the-box approach towards economic development maximizes highest and best use for properties, Currently he is spearheading the City’s LIMITLESS marketing campaign, aimed at marketing the City’s countless development opportunities. Sergio brings phenomenal energy to Long Beach along with his incredible economic development VPDUWV +H·V SDVVLRQDWH DERXW KLV ÀHOG DQG WDNHV JUHDW SULGH LQ making a difference. ROBERT REICHER, The Reicher Company Robert Reicher has been active in the real estate industry for more than 20 years, holding positions with major developers and builders, as well as acting as an advisor and consultant to many of the most VLJQLÀFDQW EXLOGHUV GHYHORSHUV PDMRU FRUSRUDWLRQV OHQGHUV DQG government agencies in the nation. Mr. Reicher has overseen the establishment of a program of public/private development for a ODUJH 6RXWKHUQ &DOLIRUQLD FRXQW\ SUHSDUHG VWXGLHV RI ÀVFDO DQG economic impacts of proposed development, developed capital EXGJHWV DQG ÀVFDO SODQV DFWHG DV D FRQVXOWDQW UHJDUGLQJ NH\ real estate related strategic decisions, provided market guidance to redevelopment agencies, prepared management audits of operations of real estate-related government agencies, and SUHVHQWHGVHPLQDUVWRJRYHUQPHQWRIÀFLDOVUHVSRQVLEOHIRUSXEOLF private development. . 52 HIGHWAY 111 CORRIDOR STUDY CARL W. RIEGER JR.,Managing Director – Eastdil Secured 0U 5LHJHU LV FXUUHQWO\ UHVSRQVLEOH IRU VWUXFWXUHG ÀQDQFH and the capitalization for large scale commercial and residential developments as Managing Director of Eastdil. Mr. Rieger’s involvement with the company over the past 25 years has included roles in all four major business lines of Eastdil Secured – institutional property sales, debt placement, loan sales and capital raising. Mr. Rieger’s H[SHULHQFHLVQDWLRQDOLQVFRSHZLWKVLJQLÀFDQWJHRJUDSKLF knowledge and expertise in California, Hawaii and Florida. Throughout his career Mr. Rieger has been involved with many of the largest real estate transactions in the country as well as advising the U.S Government’s RTC and FDIC on strategic initiatives and sales. Prior to joining Eastdil Secured in 1993, Mr. Rieger was a Vice President with Arvida Company one of the country’s largest community development companies. OSCAR URANGA, Partner - IMG Construction Management Oscar Uranga is a real estate development professional with over 18 years of experience in planning, development, entitlement and construction of various products. He has an extensive background in Real Estate, Planning, Project Management and GIS Technology. Oscar is a partner at IMG Construction Management, a professional real estate VHUYLFHVÀUPZKLFKRIIHUVDGYLVRU\DQGSURMHFWPDQDJHPHQW services related to land acquisition, underwriting, due GLOLJHQFH HQWLWOHPHQW SURFHVVLQJ SODQFKHFN ÀQDQFLQJ and construction management. He specializes in urban LQÀOO PXOWLIDPLO\ SURMHFWV WKURXJKRXW 6RXWKHUQ &DOLIRUQLD Oscar also opportunistically participates as a sponsor level development partner on projects that align with his interests SPENCER WAMPOLE, Founder, The Wampole Group, Inc. Spencer is Founder of The Wampole Group, Inc. Dba TRAVLR VACATION HOMES, an up and coming Vacation Rental Property Management company with experience in Commercial, Industrial and Residential Real Estate across Southern California markets. This full-service vacation UHQWDOPDQDJHPHQWFRPSDQ\LVVSHFLÀFDOO\GHVLJQHGWR service investment clients and cater to high-end travelers in Indio, CA. We offer Real Estate Investment Syndication Opportunities, Full Service Real Estate Brokerage and Property Management for Luxury Vacation Rental Properties. Spencer is a graduate of USC Marshall School of Business and has his JD/MBA from Chapman University School of Law and George L. Argyros School of Business and Economics. Orange County | Inland Empire Strategic Plan Toolkit 2017 A Resource for Planning Compiled from the District Council’s Strategic Plan Workshop 2017 Texas based artists Werk Alvarez and Isaias Crow created this 30-foot-high mural on the rear of a building in the 300 block of East Fourth Street, in a narrow alley off Spurgeon Street in the culinary arts hub known as 4th Street Market in Santa Ana, California. Statement of Purpose ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 2 This plan will focus on the following key areas: 1. Housing Changes & Demand 2. Diversity & Inclusion 3. Public Sector Engagement 4. University Outreach & Engagement This Strategic Plan provides an outline of goals, resources and actions that our district council will adopt and measure for success. ULI is a member driven organization, therefore this plan is a result of a collaborative workshop by our district council leadership including the advisory board, management committee, initiative council leadership, member volunteers and staff. Looking ahead to the next two years - under the leadership of our District Council Chair, John R. Williams, our Strategic Plan Toolkit will serve as a framework for future planning, and achievement by identifying areas of opportunity and advancement. Efforts identified at the Strategic Planning workshop and captured in this toolkit will guide the programming and initiatives developed, supported and sustained within our district council over the next two years. ULI Mission ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 4 ULI is committed to: Fostering collaboration within and beyond ULI’s membership through mentoring, dialogue, and problem solving; Exploring issues of urbanization, conservation, regeneration, land use, capital formation, and sustainable development; Advancing land use policies and design practices that respect the uniqueness of both the built and natural environments; Sharing knowledge through education, applied research, publishing, and electronic media; and Sustaining a diverse global network of local practice and advisory efforts that address current and future challenges. The mission of the Urban Land Institute is to provide leadership in the responsible use of land and in creating and sustaining thriving communities worldwide. I would like to thank the members who volunteered their time to contribute their knowledge, creativity and expertise to this strategic plan. ULI is truly only as good as its members and we are fortunate to have some of the very best right here in our district council. From past chairs, governance, initiative council leadership to young leaders you represent the best and I am grateful for your support. I see an exciting future in store for the ULI Orange County/Inland Empire! Engagement is high and I believe this is a testament to how valuable being a member of ULI is in the local planning and development industry. This strategic plan, born of the members, will serve to guide staff, advisory board, councils, committees and members in continuing the strong work we do which has historically placed us among the strongest District Councils, worldwide. Here’s to us working together to further the ULI mission of providing leadership in the responsible use of land in Orange County/ Inland Empire. Kendra Chandler ULI OC/IE Executive Director Executive Director Kendra Chandler ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 6 District Council Chair John R. Williams As a long time member of the most preeminent organization in the real estate industry, I have seen the power of convening great minds to make big change. Communities being built today are different in size, scale and composition than the ones we once new. The Orange County/Inland Empire district council is home to the some of the best, brightest, and most distinguished business and professionals within our organization. Over the next two years of my term I intend to work alongside staff, and membership on the following four key areas of focus: housing changes and demand, diversity and inclusion, public sector engagement, university outreach and engagement. While each of these individual efforts presents challenges to traditional models and established metrics for success, embracing these opportunities for growth will set us apart by proving our resiliency and shining a light on what makes us great as a region. This Strategic Plan Toolkit contained herein is a result of a workshop conducted with leadership - aimed at building a framework that will function as a resource and catalyst for programming and initiatives over the next 2 years. Having been a part of the workshop effort this past summer, I am proud of the work done thus far and thank the membership for volunteering their knowledge and time to an effort that will undoubtedly shape our communities and profession. Thank you for your commitment to this effort and I look forward to working alongside you over the next two years John R. Williams, Avanath Capital ULI OC/IE District Council Chair About ULIOC / IE ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 8 Programs & Annual Events Meeting Schedule: Quarterly Leadership Meetings Quartlery Initiative Council Meetings Programming and Events: Two programs per month Two TAPs per year District Council Structure Initiatives • Capital Markets • Multihousing • NEXT • Office and Commercial • Public Realm • Women’s Leadership Initiative • Young Leaders Group “There is immense power when a group of people with similar interests gets together to work toward the same goals.” - Idowu Koyenikan ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 10Strategy Housing Changes & Demand1 ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 12 Housing Changes & Demand Goal: Building upon our localized success as a housing innovator and leader, we will shift the pendulum to address demographic and land use impacts through convening practitioners and jurisdictions to have meaningful dialogue that is both educational and generative to creating avenues for success in workforce housing in our region. Opportunities: Workforce (attainable) housing is an issue in our region because of the lack of affordable land (in the OC). There is a need for mid-sized developments (mid-priced), that are connected to transit options. Collaboration with local agencies is vital in order to start a dialogue, increase density, identify and examine infrastructure and access to transit ways and modes. Alternatives to traditional housing models must explore how mixed-use and suburban-urban programming could lend to an optimization of land in the interim of large land use access and policy reform. Changing demographics must be considered in new models as well and an in depth understanding of who we are building communities for including millennials, aging boomers and the identified cultural pockets that represent a globally diverse population in our region. Transportation and infrastructure must be examined to encourage connections to existing landforms while allowing for connection and flexibility to new housing models. Infrastructure can be improved to create urban like connections that encourage walkability, and movement towards emerging vehicular and modal trends. Celebrating the unique distinctions of our presumably disjointed cities may provide an opportunity to create niche pockets of place that might appeal to millennials leaving the region for places with more affordable housing and more appealing sense of place. Strategy: Create a forum based on education & exploration of land use challenges with members of the public sector in order to foster a dialogue that will address policy barriers by defining potential thresholds of consequences we face otherwise. Housing Changes & Demand Look beyond our backyard: Highlight success stories and bring in officials from others jurisdictions that are implementing solutions like small-lot ordinances and ADU’s to provide evidence of feasibility and economic impact. Examine retrofitting the underutilized: Can underutilized/under-performing retail, parking lots and golf courses provide viable residential communities that speak to changing demography and the need for connected transportation solutions? Suburban–urban evolution: Examine the retrofitting of existing master planned communities in order to create more walkability via corridor transit solutions and adding mixed uses. Re-connect & Re-imagine: Create a workshop that brings OCTA and OMNITRANS, together with jurisdictions to discuss regional connections and local opportunities for change that will be impacted by or affect the development of new community models. Actions: Prototype - Identify 2 distinct areas that can serve as a case study that addresses opportunity areas we have defined. Identify a place that serves as a strong model of success – even if outside our region. Partnerships - Identify partnerships with agencies, jurisdictions, and trade organizations like APA that could be partners for larger programs. Fresh perspective - Identify new champions within our district council leadership that are engaged in new approaches to housing and are abreast of demographic shifts currently affecting of our region. ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 14 Housing Changes & Demand Metric: Three to four programs in each fiscal year that will build upon problems and their potential solutions examined with partnerships identified within each program. Submit two publications to Urban Land Magazine highlighting our approach to assessing our housing problem. Create a toolkit based on myths and facts observed during our exploration and programmed events that will serve as a tool and resource that both celebrates partnerships and creates clarity of problems and solutions on both sides of the counter. Resources: Examples of successful age-qualified communities: Rancho Mission Viejo Innovative ideas: Costa Mesa small lot ordinance Airbnb, Covington model (70’s) Retrofits of dead and dying malls to residential: Main Place, Five Lagunas Examples: Five Lagunas: adding new apartments that bring business to the mall and coordinate parking resources. Aliso Viejo Town Center: pre-planning and negotiating multi-tenant consolidation into denser, mixed use area Resource Links • WORKFORCE HOUSING IN HIGH COST MARKETS – A TERWILLIGER CENTER FOR HOUSING CASE STUDY : PRICED OUT • BUILDING FOR GENERATIONS -  55+ HOUSING • UNDERSTANDING HOUSING AND TRANSPORTATION COSTS: TERWILLIGER STUDY • REVERSING THE DECLINE OF CALIFORNIA’S WORKFORCE HOUSING • AUTONOMOUS VEHICLES  - HYPE AND POTENTIAL • RETROFITTING SUBURBIA • OC COMMUNITY INDICATORS REPORT  Diversity & Inclusion2 ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 16 5% Yes No Making efforts to be more representative Yes No 35%20% 45% 95% Currently, within your own company, does your leadership represent the populations for which you create communities? Does understanding your target market population affect the financial success of your sales and profit? Goal: Acknowledging the changing demographic of our region as well as the changing face of practitioners within our field, we aim to create opportunities for women and people of color to engage within our district council. These efforts will allow for valuable insight into those for whom we are developing by those currently missing from the conversation. Opportunities: Historically the development industry has been dominated by male professionals, however it has lagged in scaling to the changing demographic of the ever-evolving populations. Within the region of our district council, our population is comprised of ethnic minorities that are not often represented in land use, development, design, decision-making or even within our profession. The Institute has acknowledged the impact and value of creating initiatives to enable better representation of disparate populations such as Young Professional (YLG/NEXT), Women (WLI) and the age qualified population (55+Initiative Council). Ethnic diversity has yet to be successfully addressed though it is evident that this is a factor for the Americas and specifically within our district council. Our council leadership has shared that their respective companies place value on diversity and are making efforts to be more representative and provide opportunities. Diversity & Inclusion Diversity & Inclusion Strategy: Mentor with the audience in mind: Provide mentorships at all levels that foster a conversation relevant to the audience. Educate the membership on how to mentor in a way that is relevant and tailor a message - the way we would when marketing a new development to a target audience. Utilize resources already developed: Programs like REDI (Real Estate Diversity Initiative) are already adopted with marked success in both Colorado and Minnesota. Identofy a champion for these efforts by creating a role. (Inner City Advisor and Chair of Diversity and Inclusion have been roles in past years.) Learn from other district councils: Other councils have years of marked experience with initiatives already created by the Institute. Create a conversation and be open to learning lessons from our peers. Identify Partners and Leaders: Locally we have examples of companies that have seen the impact of diversity initiatives. Sharing these successes in a forum or program can help increase awareness and promote additional solutions for advancing the conversation. Identify a resource list of partners such as Asian American Business Association, CREW, and Hispanic, Black, and Asian Chambers of Commerce, Chinese American Construction Professionals (CACP), Asian Business League of SoCal (ABL), National Association of Hispanic Real Estate Professionals (NAHREP) as potential collaborative partners in efforts or programs. Connect early and in person: Engaging with various communities at the grass roots level through outreach events, TAPs, and early engagement at the high school and university level are proactive and effective ways to build momentum and authentic understanding within our community. ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 18 Diversity & Inclusion Actions: Provide perspective: Based on workshops comments and notes, there is an evident need for ULI to host its own implicit bias trainings, or generally explain to its members why diversity is important. Fresh Perspective: Create opportunities to mentor and educate university students about professions in the real estate industry. Connect with Colorado to learn about their successes and begin the dialogue before trying to reinvent a wheel. Build on success: WLI is building momentum and should look to increase membership and outreach at the student level to educate women at an earlier age about professions and careers in the real estate arena. Partnerships: Identify partners that best align with our mission in the real estate arena and explore which are most critical to success within our efforts. Metrics: An education event or publication: Examine how to create an education opportunity to enable an understanding amongst our leadership and members on why diversity is relevant and vlauable to success in real estate. Two programs (TAP, university or high school presentation, mentorship, etc.) to outreach and begin dialogue surrounding opportunities to pursue careers in real estate. Identify ways/people to support programs and events like WLI or REDI through cross pollination of efforts and with partner organizations outside of ULI. Resource Links: • URBAN LAND FEATURED VIDEO ON DIVERSITY AND ITS RELEVANCE TO DEVELOPMENT • AMERICAN DEMOGRAPHY 2030: BURSTING WITH DIVERSITY, YET A BABY BUST • REAL ESTATE DIVERSITY INITIATIVE – ULI COLORADO • WOMEN’S LEADERSHIP INITIATIVE – BUILDING A CULTURE OF INCLUSIVITY ULI SD • WOMEN’S LEADERSHIP INITIATIVE – STRATEGIES TO PROMOTE WOMEN ULI NATIONAL Public Sector Engagement3 ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 20 Public Sector Engagement Planners and officials may have motivations to support development, however constituents and residents are a critical element that may be worth engaging in an educational format. A common language or translator is needed to bring clarity in communication for trigger words like density, affordability, parking variances and tax credits. Often times, a definition or perception is outdated and the verbiage is missing an association with actual physical representation. ULI has often been associated with a developers club - public sector professionals may see more value in peer-to-peer type events. Partnering with public sector associations and/or having panels that are representative of their leaders and officials would motivate participation of both public and private sector attendees. Cost to attend programs is a burden and an arduous approval process in public sector offices. We must do a better job in creating accessible paths to get public sector employees at the table in order to even begin a discussion. Strategy: Extend an olive branch and initiate all communication/messaging with the affirmation that as ULI we have an ethical interest in promoting the responsible use of land with a commitment to dialogue based on education – not debate. Collaboration is power and partnership with organizations like APA and AEP on programs will help get all the right people in a room to listen and engage. Goal: Education, outreach and partnerships are needed to bridge the gap between the public sector and private sector in order to provide an informed prescription of land use rooted in rehabilitated policy that is based on current and real time conditions. Our council will work to create conversations via forums, tools, partnerships and publications that bring players together and unlock solutions to hurdles on both sides of the table. Opportunities: Education is needed to empathize with issues impacting constraints and pressures of the public sector in land use policy and public sector process in order to frame a sound discussion and avoid shallow debate. Support and respond to the need for new and refreshed tools that are current and supportive of hurdles being faced by our planning departments. Share resources and leverage our institutional credibility. ULI has access to case studies and the ability to generate real time back yard classrooms via TAPs that have always proven popular and helpful to local jurisdictions. Explore our own resource pool within ULI Our problems are not always unique to our council. Northern California has been innovative in a very active and development averse community. There are many great success stories in our own network. Actions: TAPs have proven to be a great show of support and demonstration of what the Institute can offer in the way of surmounting development hurdles. These reports can be a foundation for case studies that are rooted in public private partnership solutions. Project tours are compelling and needed to provide physical demonstration of what policy verbiage struggles to articulate. These have proven to be eye opening and excellent fodder for identifying gaps in land use policy and the built environment. Celebration of best practices and successful public/private collaborations through programs like Good Government awards can encourage positive engagement in a lighter format. Develop and create a set of tools such as an Affordable Housing 101 workshop (including info on tax credits, density myths, etc.) or a revived series of Myths and Facts 2017-2018 publications that capture lessons learned. Create a membership or program attendance solution that either allows for reduced (low enough to be a cash transaction ex: $10 - $20 or a quantified number of free seats per program per agency partner or trade organization (like APA). Metrics: Two TAPs that speak to other initiatives identified in our strategic plan such as Affordable Housing and Infrastructure supporting better land use optimization. Two Programs that partner with public sector organizations that create a shared forum and educational opportunity for both sides of the counter. Public Sector Engagement ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 22 Public Sector Engagement Two Publications that either document the programs and/or provide responses via vetted/ researched answers to critical questions identified at program panel discussion. Two tours of new models of development and demonstrate policy evolution either in our district or in neighboring district councils. Resources: Jurisdictions that could serve as models or examples: • City of Montebello • City of Ontario (Scott Murphy, Planning Director) • Orange County (Colby Cataldi - Development Services) • City of Los Angeles (Eric Garcetti, Mayor) • City of Santa Ana: new openness to multi-family Local projects that may serve as a case study: Good Public Private Partnership collaboration • Orange County • Ontario and Brookfield: Ontario Ranch • Garden Grove • Anaheim: Proactive and helpful zoning staff have been helping professionals navigate through the maze. Resource Links: • WINNING PUBLIC ENGAGEMENT: A CASE STUDY ON 1028 MARKET STREETAMERICAN DEMOGRAPHY 2030: BURSTING WITH DIVERSITY, YET A BABY BUST • NINE PRACTICES OF PUBLIC PRIVATE PARTNERSHIPS • URBAN PLAN FOR PUBLIC OFFICIALS • PUBLIC ENGAGEMENT HACKED – AN EVENT RECAP • MYTHS AND FACTS ABOUT HIGH DENSITY 2005 PUBLICATION • MYTH AND FACTS - AFFORDABLE AND HIGH DENSITY HOUSING BY HCD 2002 • GOOD GOVERNMENT AWARDS - SPUR University Outreach & Engagement4 ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 24 University Outreach & Engagement Opportunities: Innovation and new ideas are rooted in the ability to remain informed and engage in new technology, and emerging trends. Young and fresh perspectives provide insight into a market that is dependent on understanding consumers and market trajectory. Within our district council region we have the following relationships in some form with the following regional universities and programs: • UCI: Paul Merage School of Business, School of Law, School of Social Ecology • Cal Poly Pomona • USC MRED Program • USC PPD Department • Chapman University • CSUF Goal: Understanding that a strong workforce comprised of educated, innovative, and fresh perspectives is essential to sustaining a thriving industry in our district council, we will develop and support efforts over the next two years that will engage and increase opportunities for university students to establish careers in real estate within our region. University Outreach & Engagement Strategy: Identify champions in YLG, NEXT who have members that are recent grads from local universities and hence will be best at spearheading outreach to their own respective schools. Identify resources at each university. Begin with student-led clubs within our real estate adjacent programs and create a list of individuals in those clubs to be our line of communication for events and promotion. Prioritize opportunities needed by conducting a survey of clubs that will allow us to prioritize efforts, strategize collaborations, and cross-pollinate with resources that may feed the need of other initiatives mentioned that are a part of our two-year plan. Examples of those cross pollination opportunities could exist with WLI and our diversity initiative. There are many accredited universities within Orange County and Inland Empire that we have yet to establish connections and partnerships with including UC Riverside and Cal State San Bernardino. Connecting with students across universities in our region to all that ULI has to offer, including a professional network, would introduce the opportunity to remain in our region and establish a career in real estate. There is an overlap of other initiatives within our two- year strategic plan that are centered on mentorship of diverse populations as well as introducing careers in real estate to students earlier on in their education. We have untapped ambassadors within our younger professional initiatives who have recently graduated who still have relationships and connections to local universities. ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 26 Actions: Empower leadership and create a University Outreach initiative/committee Accurately assess the need by conducting a survey to help plan and prioritize efforts that are highest and best use of council time and resources. Establish partnerships/sponsorships at each university that gives a quantified number of ‘free admission’ seats to students per year. This should be scaled depending on how many programs and student clubs at each school we can engage/commit to being an active part of this communication/outreach initiative. Metrics: Establish three programs per year that can be taken to each university as a means to educate and engage. Establish partnerships with at least 3 universities Increase student engagement to reach 20% more students per year in each of the 2-year span of this plan for a 40% increase in student engagement after 4 years. Resource Links: • ULI COLORADO STUDENT SCHOLARSHIP MODEL/DETAILS • ULI HINES STUDENT COMPETITION • ULI SF GRADUATE STUDENT FELLOWSHIP MODEL/DETAILS • WLI AND STUDENT COLLABORATION EXAMPLE - BALTIMORE University Outreach & Engagement Appendix ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 28 District Council Leadership ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 30 District Council Chair Advisory Board Chair Assistant Chair Mission Advancement Chair Initiative Council Chairs At-Large Members Advisory Board Membership | Programming | Urban Plan | YLG Management Committe Chair Assistant Chair Treasurer Vice Chair of Membership Sponsorship Vice Chair of Outreach Vice Chair of YLG Governance Committe Governance Chair Mission Advancement Chair Past District Council Chairs Executive Director ULI Staff Initiative Councils Multi Housing | Capital Markets | Office & Commercial | Public Realm | Womens Leadership | NEXT Operational & Support Structure 2017 John R. Williams Avanath Capital Management CHAIR Denise Ashton William Hezmalhalch Architects ASSISTANT CHAIR Greg Anderson Shea Properties VICE CHAIR MULTI-HOUSING Julie Brinkerhoff-Jacobs Lifescapes International, Inc. VICE CHAIR WOMENS LEADERSHIP Jay Bullock Rancho Mission Viejo AT-LARGE Jessica Candaele KTGY Architecture + Planning VICE CHAIR MEMBERSHIP Robert Caudill Colliers International VICE CHAIR OFFICE & COMMERCIAL Louisa Feletto William Hezmalhalch Architects VICE CHAIR, YOUNG LEADERS GROUP Jason Ficht JZMK Partners VICE CHAIR PUBLIC REALM Valerie Hardman Outdoor Dimensions VICE CHAIR, PROGRAMS Eric Higuchi Alpha Development Consulting Inc CO VICE CHAIR, OUTREACH AND INNOVATION Susan Hori Manatt, Phelps & Phillips, LLP AT-LARGE Randal Jackson PlaceWorks IMMEDIATE PAST CHAIR Steven Kellenberg Kellenberg Studio AT-LARGE John Martin Martin and Associates, LLC AT-LARGE Sean Matsler Manatt, Phelps & Phillips, LLP VICE CHAIR NEXT Jeff Mayer Mayer Creative CHAIR GOVERNANCE Laurence Netherton GOVERNANCE Steve PonTell National Community Renaissance AT-LARGE Martin O’Hea Bixby Land Company VICE CHAIR, CAPITAL MARKETS Michael Ruane National Community Renaissance CHAIR OF MISSION ADVANCEMENT Yolanda Sepulveda Spectacle Design CO VICE CHAIR, OUTREACH AND INNOVATION Oscar Uranga IMG Construction Management VICE CHAIR TAP Advisory Board ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 32ManagementCommitteeJohn R. Williams Avanath Capital Management CHAIR Denise Ashton William Hezmalhalch Architects ASSISTANT CHAIR Jessica Candaele KTGY Architecture + Planning VICE CHAIR MEMBERSHIP Eric Higuchi Alpha Development Consulting, Inc CO VICE CHAIR, OUTREACH AND INNOVATION David Kim The Bascom Group TREASURER Alex Leonard AvalonBay Communities, Inc. VICE CHAIR, YOUNG LEADERS GROUP Martin O’Hea Bixby Land Company VICE CHAIR Jeffrey Reder CenterSquare Investment Management ASSISTANT VICE CHAIR Andrew Amaro City National Bank VICE CHAIR OUTREACH Ken Coatsworth Sares Regis Group VICE CHAIR EDUCATION Amber House Northwestern Mutual YOUNG LEADERS GROUP REPRESENTATIVE Sebastian Trujillo HFF YOUNG LEADERS GROUP REPRESENTATIVE Jeet Desai Paul Merage School of Business STUDENT REPRESENTATIVE Bruce Anderson Barings Paul Angle KeyBank Real Estate Capital Ron Bonneau Pacific Coast Capital Partners Eric Boyd CrossHarbor Capital Partners, LLC William Campbell Knightsbridge Realty Capital Peter Cassiano Invesco Real Estate Robert Durand KBSCapital MarketsJerome Fink The Bascom Group Colin Gamber Donahue Schriber Kevin Jennings Bank of America Merrill Lynch Scott Magoffin Barings McCay Major John Hancock Real Estate Finance Group Jeremy Mape Western Realco Scott McPherson US Bank John Murray PIMCO Scott Murray Greenlaw Partners, LLC Richard Putnam Soonipi Holdings, Ltd. Scott Read Newmark Knight Frank Tom Rutherford LBA Realty Thomas Sherlock Talonvest Capital Inc. William Shubin Shubin Nadal Realty Investors Eric Smyth CIP Real Estate Kurt Strasmann CBRE ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 34Multi HousingGreg Anderson Shea Properties VICE CHAIR Aram Chahbazian TCA Architects ASSISTANT VICE CHAIR Derrek Ostrzyzek Moran & Company VICE CHAIR OUTREACH Michelle Thrakulchavee City Ventures VICE CHAIR EDUCATION Mathew Barbiasz Raintree Partners YOUNG LEADERS GROUP REPRESENTATIVE Megan Palmer MVE + Partners, Inc. YOUNG LEADERS GROUP REPRESENTATIVE Tanner Wolverton University of California, Irvine STUDENT REPRESENTATIVE Morgan Anderson Arthur J. Gallagher Risk Management Services Inc. Scott Baxter Raintree Partners Geoff Boler Eastdil Secured Marc Chasman Alliance Residential Shawn Hansen Greystar Eric Herro Northwestern Mutual Alex Leonard AvalonBay Communities, Inc. Scott McClave The Bascom Group, LLC Jeff McNutt Irvine Apartment Communities Marjorie Molloy Berkadia Bill Montgomery Sares Regis Group John Olivier Fuscoe Engineering, Inc. Robert Patterson CBRE Robert Quarton Walker & Dunlop David Robbins Lewis Management Corp Darin Schoolmeester MVE + Partners, Inc. Jason Silver Ledcor Patrick Simons Western National Properties Damon Smith DCI Engineers Robert Taylor Invesco Real Estate Alex Wong Red Oak Investments, LLC Sean Matsler Manatt, Phelps & Phillips, LLP VICE CHAIR Jennifer Chirco-Coker Intracorp Companies ASSISTANT VICE CHAIR Bryant Brislin The Hoffman Company VICE CHAIR, OUTGOING Tunde Ogunwole Trammell Crow Company VICE CHAIR EDUCATION Todd Barnett Wells Fargo Bank Andy Bratt Newmark Realty Capital, Inc. Suzanna Chan FNTG Builder Services Johanna Crooker KTGY Architecture + Planning Ed Davis MBK Homes Colin Gamber Donahue Schriber Oscar Graham Pacifica Investments Gena Guisar CSG Consultants Javier Gutierrez Stuart Kane, LLP Daniel Hsu Mountain Path Capital Michael Hutaff William Hezmalhalch Architects Sarah Klaustermeier Aimco Jeremy Krout EPD Solutions Nathan McElmurry SmartStop Asset Management Buu Ngo Welbrook Senior Living Christopher Pierson William Warren Group Michael Presser George Elkins Mortgage Banking Company Rick Price Raintree Partners Richard Rojas City of Carson Hessam Vakili Gensler Andrew Watkins SWA Group Matt West City of TustinNEXT ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 36 Robert Caudill Colliers International VICE CHAIR Robert Duncan Caribou Industries, Inc. ASSISTANT VICE CHAIR Barbie Hendon Commonwealth Land Title Company VICE CHAIR EDUCATION Bryce Bunker YOUNG LEADERS GROUP REPRESENTATIVE Chase Gilmore Irvine Company Retail Properties YOUNG LEADERS GROUP REPRESENTATIVE Erwin Cruz University of California Irvine STUDENT REPRESENTATIVE John Carbonara Northwestern Mutual Lawrence Casey Donahue Schriber J. Richard Choate Choate Parking Consultants, Inc. Matthew Fogt Allen Matkins Leck Gamble Mallory & Natsis, LLC Dirk Geiger Bank of America Merrill Lynch Joe Giordani NorthMarq Capital Tom Lam Buchanan Street Partners Robert Miranda Townsend Group Kathy Reed Farmers & Merchants Bank Michael Reynolds The Concord Group, LLC Jinger Tapia Ware Malcomb Jeffrey Thompson Rancho Mission Viejo Terry Thompson County of San Bernardino Director of Real Estate Services Office &Commercial Jason Ficht JZMK Partners VICE CHAIR Richard Flierl Katalyst ASSISTANT VICE CHAIR Pete Carmichael City of Irvine VICE CHAIR OUTREACH Matt Shannon Urbanus Group VICE CHAIR EDUCATION Dima Galkin RSG, Inc. YOUNG LEADERS GROUP REPRESENTATIVE Daniel Herman University of California Irvine STUDENT REPRESENTATIVE Stephanie Roxas City of Irvine YOUNG LEADERS GROUP REPRESENTATIVE William Crouch City of Orange Jane DeLorenzo Sustainable Options Patrick Fuscoe Fuscoe Engineering, Inc. Jon Goetz Kronick Moskovitz Tiedemann & Girard Steven Kellenberg Kellenberg Studio John Leehey Danielian Associates, Inc. Jonathan Lightfoot City of San Clemente David Luzuriaga Kimley-Horn Amy Martz NewOpen Group Seth Merewitz Best Best & Krieger LLP Matthew Michalovsky PIMCO Andrew Nelson Red Oak Investments, LLC Peter Quintanilla Michael Baker International Timothy Ralston TDR Strategies Joel Rosen City of Buena Park Manuel Trujillo Irvine Company Retail Properties Charles Ware Planner, Urban Designer, Landscape Architect Patricia Whitaker Innovative Housing Opportunities Inc. Annette Wiley Wiley Architects Audrey Young City of Lake Elsinore Public Realm ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 38Women’s LeadershipLaura Archuleta Jamboree Housing Corporation CO-VICE CHAIR Julie Brinkerhoff-Jacobs Lifescapes International, Inc. CO-VICE CHAIR Karen Gulley PlaceWorks CO-ASSISTANT VICE CHAIR Robin Robinson Fuscoe Engineering, Inc. CO-ASSISTANT VICE CHAIR Astrid Collins Mobilite VICE CHAIR EDUCATION Christine Geronaga Obnial Architects Orange VICE CHAIR OUTREACH Natalie Ashlock Lifescapes International Inc. YOUNG LEADERS GROUP REPRESENTATIVE Nairi Siddiqi Stuart Kane LLP YOUNG LEADERS GROUP REPRESENTATIVE Anne Bretana Gensler Ann Caruana Avanath Capital Management Tricia Esser KTGY Architecture + Planning Jenna Figueroa Wave Hospitality Advisors Jessica Fritz William Hezmalhalch Architects Rian Graber Meyers Research LLC, a Kennedy Wilson Company Amber Heredia PSOMAS Michelle Hoalton PACE Advanced Water Engineering Susan Hori Manatt, Phelps & Phillips, LLP Frawn Morgan LDC Advisors Hitta Mosesman RSG, Inc. Vickie Oshima MVE + Partners, Inc. Kate Seabaugh John Burns Real Estate Consulting Lori Smith ORION Property Partners Deirdre Spalding TMC America LLC Noelle Steele Michael Baker International Karen Williamson Capital One Bank Angela Woodward ima design Young LeadersLouisa Feletto William Hezmalhalch Architects VICE CHAIR Alex Leonard AvalonBay Communities, Inc. ASSISTANT VICE CHAIR Natalie Ashlock Lifescapes International Inc. Mathew Barbiasz Raintree Partners Bryce Bunker Pacifica Planning Group Nathan Buxser Solomon Cordwell Buenz Jingjing Cheng Colliers International Christine DePillo JP Morgan Chase David Dieguez Jenna Figueroa Wave Hospitality Advisors Dima Galkin RSG, Inc. Chase Gilmore Irvine Company Office Properties Amber House Northwestern Mutual Timothy Huynh Brookfield Residential Tom Lam University of Southern California - MRED Jonathan Lightfoot City of San Clemente John Marshall NorthMarq Capital Kevin Martin Irvine Company Office Properties Katie Nilmeier Langan Megan Palmer MVE + Partners, Inc. Danielle Reppen Brookfield Residential Stephanie Roxas City of Irvine Kate Seabaugh John Burns Real Estate Consulting Philip Shehade Murow|CM Nairi Siddiqi Stuart Kane LLP Noelle Steele Michael Baker International Amanda Tropiano De Novo Planning Group Sebastian Trujillo HFF Mike West Inland West ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 40 Code of Ethics ULI relies heavily on the experience of its members. It is through member involvement and information resources that ULI has been able to set standards of excellence in development practice. The Institute has long been recognized as one of the world’s most respected and widely quoted sources of objective information on urban planning, growth, and development. To become a ULI member, you must commit to the following code of ethics: • Respect for the Land • Respect for the Profession • Respect for the Consumer • Respect for the Public • Respect for Equality of Opportunity • Respect for Others in the Land Use & Development Profession • Respect for the Larger Environment • Respect for the Future • Respect for Future Generations • Respect for Personal Integrity ULI OC/IE DISTRICT COUNCIL STAFF (FROM LEFT TO RIGHT) KATIE HOLST, SENIOR ASSOCIATE; KENDRA CHANDLER, EXECUTIVE DIRECTOR; STACY GREER, MANAGER ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 41 Thank YouThank you to leadership who participated in the 2017-2018 workshop. Scott Ashlock Denise Ashton Jay Bullock Julie Brinkerhoff-Jacobs Bill Campbell Robert Caudill Aram Chahbazian Kendra Chandler Jeff Enes Louisa Feletto Stacy Greer Valerie Hardman Daniel Herman -workshop recorder Eric Higuchi Katie Holst Susan Hori Randy Jackson Steven Kellenberg David Kim Dana Kovach - workshop recorder Alex Leonard Johnathan Lightfoot - workshop recorder Regina Marston John Martin Sean Matsler Jeff Mayer Larry Netherton Vickie Oshima - workshop recorder Mike Ruane Yolanda Sepulveda - workshop facilitator Oscar Uranga John R. Williams ULI Orange County + Inland Empire | Strategic Plan Toolkit | 2017-2018 | 42 Hi... Nice to meet you! We are the Orange County Inland / Empire District Council located in Southern California comprised of 95 cities and spanning 3 counties. We are a thriving, uniquely diverse, suburban-urban metropolitan region spanning from the coast of Orange County through to the mountains and desert of the Inland Empire. Our communities represent a story of an evolving American dream flourishing with diversity in age, culture, ethnicity, housing and industry. Bounded by regions of Los Angeles County and San Diego County, we are distinctly different from our neighbors in that we do not contain a singular city center or core. Rather, we are comprised of a collection of distinctive hubs, housing, commerce and industry connected through transit corridors linking us to our sister cities and neighboring regions. With over 1000 members we are the 13th largest District Council worldwide. Our members are active and committed to the Institute with 227 Full Members, 143 National Product Council Members, 6 current & past Trustees and 18 current & past Governors. We are excited to share more with you in the years to come! Get to know us! ULI Orange County Inland Empire 5151 California Avenue, Suite 100 Irvine, CA 92617 orangecounty.uli.org HEARING DRAFT | OCTOBER 19, 2018 BEACH BOULEVARD SPECIFIC PLANDRA F TAF R AFAF BEB BEACH BOULEVARD SPECIFIC PLAN | HEARING DRAFT OCTOBER 2018 CITY COUNCIL Tom Tait, Mayor James Vanderbilt, Council Member Jose F. Moreno, Mayor Pro-Tempore Kris Murray, Council Member Denise Barnes, Council Member Lucille Kring, Council Member Stephen Faessel, Council Member PLANNING COMMISSION ŝůůĂůĂƟ͕ŚĂŝƌ Michelle Lieberman, Chair Pro-Tempore John Armstrong, Commissioner Jess Carbajal, Commissioner John A. Gillespie, Commissioner Kimberly Keys, Commissioner Steve White, Commissioner ACKNOWLEDGMENTS ůĞdž&ůŽƌĞƐ͕DĂŐŶŽůŝĂ^ĐŚŽŽůŝƐƚƌŝĐƚZĞƉƌĞƐĞŶƚĂƟǀĞƐ Amanda Edinger, West District Neighborhood Council Carol Judy, Anacapa Community Residents Cynthia Hall, At-Large Seat Denny Ahir, Motel Owner Esther Wallace, West Anaheim Neighborhood Development Council Javier Gonzalez, Anaheim Family YMCA :ĞītĞďĞƌ͕tĞƐƚŶĂŚĞŝŵZĞƐŝĚĞŶƟĂůĞǀĞůŽƉĞƌƐ Leodegario Barcena, West Anaheim Apartment Residents Max Aranki, Arab American Community Center Nathan Zug, Anaheim Religious Community Council WĂƵůŚŽ͕/ůůƵŵŝŶĂƟŽŶ&ŽƵŶĚĂƟŽŶ WŚLJůůŝƐ'ƌĞĞŶďĞƌŐ͕ZĞŶĞǁtĞƐƚŶĂŚĞŝŵŽŵŵŝƩĞĞ Queen Kwembe, Project SAY (Save Anaheim’s Youth) Rod Pierson, Senior Mobile Home Park Residents Shereen Ameri, At-Large Seat dŝīĂŶLJtĞůƚ͕ƚͲ>ĂƌŐĞ^ĞĂƚ William Judy, Anacapa Community Residents BEACH BOULEVARD SPECIFIC PLAN COMMUNITY ADVISORY COMMITTEE HEARING DRAFT OCTOBER 2018| BEACH BOULEVARD SPECIFIC PLAN CITY STAFF Community & Economic Development John Woodhead, Community and Economic Development Director Grace Stepter, Deputy Community and Economic Development Director Jessica Gonzales, Economic Development Manager Laura Alcala, Community Investment Manager Andy Nogal, Community Investment Manager Kevin Clausen-Quiroz, Project Manager II Community Services Anaheim Sporn, Community Services Superintendent Pamela Galera, Principal Project Planner Planning & Building David Belmer, Planning and Building Director ^ĂŶĚƌĂ^ĂŐĞƌƚ͕ŽŵŵƵŶŝƚLJWƌĞƐĞƌǀĂƟŽŶDĂŶĂŐĞƌ Roger Bennion, Code Enforcement Supervisor Susan Kim, Principal Planner Gustavo Gonzalez, Senior Planner City Attorney's Office >ĞŽŶŝĞDƵůǀŝŚŝůů͕ĞƉƵƚLJŝƚLJƩŽƌŶĞLJ/s Fire Allen Hogue, Deputy Fire Marshal Police Craig Friesen, Lieutenant Robert Dunn, Lieutenant Timothy Schmidt, Lieutenant Public Works Rudy Emami, Public Works Director Carlos Castellanos, City Engineer David Mori, Design Services Manager :ĂŵŝĞ>Ăŝ͕dƌĂĸĐĂŶĚdƌĂŶƐƉŽƌƚĂƟŽŶDĂŶĂŐĞƌ LJƵŵŝdĂŬĂLJĂƐƵ͕^ƚƌĞĞƚƐĂŶĚ^ĂŶŝƚĂƟŽŶDĂŶĂŐĞƌ Cesar Carrillo, Principal Civil Engineer Mike Eskander, Principal Civil Engineer Linda Johnson, Principal Planner Shawn Azarhoosh, Associate Engineer ZĂĨĂĞůŽďŝĂŶ͕WƌŝŶĐŝƉĂůdƌĂĸĐŶŐŝŶĞĞƌ ĂǀŝĚ<ĞŶŶĞĚLJ͕ƐƐŽĐŝĂƚĞdƌĂŶƐƉŽƌƚĂƟŽŶŶŐŝŶĞĞƌ DŝĐŚĂĞů>ĞŐŐĞƩ͕ZĞƐŽƌƚKƉĞƌĂƟŽŶƐ^ƵƉĞƌǀŝƐŽƌ Mike Atkinson, Resort Superintendent Public Utilities Graham Bowen, Assistant General Manager Janet Lonneker, Assistant General Manager Phil Hayes, Business and Community Programs Manager &ƌĞĚĂƌǀĂƌnj͕dƌĂŶƐŵŝƐƐŝŽŶĂŶĚŝƐƚƌŝďƵƟŽŶDĂŶĂŐĞƌ Tim Bass, Senior Electrical Engineer BEACH BOULEVARD SPECIFIC PLAN | HEARING DRAFT OCTOBER 2018 ACKNOWLEDGMENTS CONSULTANTS PlaceWorks Karen Gulley, Principal Bill Halligan, Esq., Principal, Environmental Services Suzanne Schwab, AICP, Senior Associate ZLJĂŶWŽƩĞƌ͕/W͕ƐƐŽĐŝĂƚĞ Fehr & Peers Jason Pack, PE, Principal WĂƵů,ĞƌƌŵĂŶŶ͕W͕^ĞŶŝŽƌdƌĂŶƐƉŽƌƚĂƟŽŶŶŐŝŶĞĞƌ BAE Urban Economics Sherry Rudnak, Principal Aaron Barker, Senior Associate Arellano Associates Laura Muna-Landa, Senior Project Manager Ariel AlconTapia, Assistant Project Coordinator Fuscoe Engineering Ian Adam, MESM, CPSWQ, QSD, Principal/Stormwater Manager Stephanie Castle Zinn, Water Resources Specialist Schweitzer + Associates, Inc. :ƵĚŝ^ĐŚǁĞŝƚnjĞƌ͕sŝĐĞWƌĞƐŝĚĞŶƚͬ^ĞŶŝŽƌdžĞĐƵƟǀĞ Crowdbrite Darin Dinsmore, President & CEO SPECIAL RECOGNITION California Strategic Growth Council ^ƵƐƚĂŝŶĂďůĞŽŵŵƵŶŝƟĞƐWůĂŶŶŝŶŐ'ƌĂŶƚĂŶĚ /ŶĐĞŶƟǀĞƐWƌŽŐƌĂŵ dŚĞǁŽƌŬƵƉŽŶǁŚŝĐŚƚŚŝƐƉƵďůŝĐĂƟŽŶŝƐďĂƐĞĚǁĂƐ funded in whole or in part through a Sustainable ŽŵŵƵŶŝƟĞƐ'ƌĂŶƚĂǁĂƌĚĞĚďLJƚŚĞ^ƚƌĂƚĞŐŝĐ'ƌŽǁƚŚ Council. Disclaimer The statements and conclusions of this report are those of the Grantee and/or Subcontractor and not necessarily those of the Strategic Growth Council or ŽĨƚŚĞĞƉĂƌƚŵĞŶƚŽĨŽŶƐĞƌǀĂƟŽŶŽƌŝƚƐĞŵƉůŽLJĞĞƐ͘ The Strategic Growth Council and the Department ŽĨŽŶƐĞƌǀĂƟŽŶŵĂŬĞŶŽǁĂƌƌĂŶƟĞƐ͕ĞdžƉƌĞƐƐŽƌ ŝŵƉůŝĞĚ͕ĂŶĚĂƐƐƵŵĞŶŽůŝĂďŝůŝƚLJĨŽƌƚŚĞŝŶĨŽƌŵĂƟŽŶ contained in the succeeding text. HEARING DRAFT OCTOBER 2018| BEACH BOULEVARD SPECIFIC PLAN TABLE OF CONTENTS CHAPTER 1 Introduction: Improve the Boulevard....................3 ϭ͘ϭ >ŽĐĂƟŽŶͶdŚĞ,ĞĂƌƚŽĨtĞƐƚŶĂŚĞŝŵ ....................4 1.2 Purpose and Authority .............................................7 ϭ͘ϯ KƌŐĂŶŝnjĂƟŽŶŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶŽĐƵŵĞŶƚ ............8 1.4 Community Involvement ..........................................9 ϭ͘ϱ ZĞůĂƟŽŶƐŚŝƉƚŽKƚŚĞƌWůĂŶƐ͕WƌŽŐƌĂŵƐ͕ŐĞŶĐŝĞƐ͕ ĂŶĚZĞŐƵůĂƟŽŶƐ ......................................................13 1.6 Environmental Clearance........................................17 CHAPTER 2 Themes, Vision, & Guiding Principles ................21 2.1 Key Themes ............................................................21 2.2 Vision ...................................................................... 23 2.3 Guiding Principles ...................................................24 CHAPTER 3 Context: History & Existing Land Use .................31 3.1 History.....................................................................31 ϯ͘Ϯ džŝƐƟŶŐ>ĂŶĚhƐĞƐŽĨĞĂĐŚŽƵůĞǀĂƌĚĂŶĚƚŚĞ ^ƵƌƌŽƵŶĚŝŶŐŝƟĞƐ ..................................................32 ϯ͘ϯ džŝƐƟŶŐDĂƌŬĞƚŽŶĚŝƟŽŶƐ .....................................38 ϯ͘ϰ džŝƐƟŶŐ^ƵƐƚĂŝŶĂďŝůŝƚLJīŽƌƚƐ ..................................45 CHAPTER 4 The Plan .......................................................................51 ϰ͘ϭ /ŶƚƌŽĚƵĐƟŽŶ ............................................................51 ϰ͘Ϯ >ĂŶĚhƐĞ .................................................................51 4.3 Corridor Design Concepts .......................................64 ϰ͘ϰ WĂƌŬƐĂŶĚZĞĐƌĞĂƟŽŶ ..............................................86 4.5 Sustainability ..........................................................88 4.6 Mobility .................................................................. 92 4.7 Infrastructure .......................................................109 4.8 Police and Fire Service ..........................................121 CHAPTER 5 Administration + Implementation ..................125 ϱ͘ϭ ^ƉĞĐŝĮĐWůĂŶĚŽƉƟŽŶ ..........................................125 ϱ͘Ϯ ^ƉĞĐŝĮĐWůĂŶŵĞŶĚŵĞŶƚƐ ...................................125 ϱ͘ϯ ^ƉĞĐŝĮĐWůĂŶĚũƵƐƚŵĞŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϮϱ 5.4 Zoning and Development Standards .....................125 ϱ͘ϱ ^ƉĞĐŝĮĐWůĂŶĚŵŝŶŝƐƚƌĂƟǀĞĚũƵƐƚŵĞŶƚƐ ............125 ϱ͘ϲ /ŶƚĞƌƉƌĞƚĂƟŽŶ .......................................................125 ϱ͘ϳ EŽŶĐŽŶĨŽƌŵŝƟĞƐ ...................................................125 5.8 Project Approval Process ......................................126 5.9 Severability ...........................................................126 ϱ͘ϭϬ^ƉĞĐŝĮĐWůĂŶŶǀŝƌŽŶŵĞŶƚĂů/ŵƉĂĐƚZĞƉŽƌƚĂŶĚ DŝƟŐĂƟŽŶDŽŶŝƚŽƌŝŶŐ ..........................................126 ϱ͘ϭϭ/ŵƉůĞŵĞŶƚĂƟŽŶ ....................................................128 APPENDIX A Development Code APPENDIX B Community Outreach Summary APPENDIX C Preliminary Market Analysis and Motel Demand Study APPENDIX D Sustainability Existing Conditions Report BEACH BOULEVARD SPECIFIC PLAN | HEARING DRAFT OCTOBER 2018 TABLE OF CONTENTS LIST OF FIGURES &ŝŐƵƌĞϭͲϭZĞŐŝŽŶĂů>ŽĐĂƟŽŶ ............................................4 Figure 1-2 Local Vicinity ....................................................5 Figure 3-1 Development Eras .........................................33 &ŝŐƵƌĞϯͲϮdžŝƐƟŶŐ>ĂŶĚhƐĞ ...........................................35 &ŝŐƵƌĞϯͲϯdžŝƐƟŶŐ>ĂŶĚhƐĞƌĞĂŬĚŽǁŶ ........................37 Figure 4-1 Development Areas .......................................55 Figure 4-2 Areas Likely to Change ...................................57 &ŝŐƵƌĞϰͲϯ/ůůƵƐƚƌĂƟǀĞWĞƌƐƉĞĐƟǀĞĨŽƌƚŚĞŽŶĐĞƉƚƵĂů Development of the East Corner of Beach Boulevard and Lincoln Avenue.........................58 &ŝŐƵƌĞϰͲϰ/ůůƵƐƚƌĂƟǀĞZĞǀŝƚĂůŝnjĂƟŽŶŽŶĐĞƉƚƐĨŽƌƚŚĞ ĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶƌĞĂ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϬ &ŝŐƵƌĞϰͲϱ/ůůƵƐƚƌĂƟǀĞWĞƌƐƉĞĐƟǀĞĨŽƌŽŶĐĞƉƚƵĂů Development the Southeast Corner of Beach Boulevard and Ball Road ......................................62 &ŝŐƵƌĞϰͲϳ/ůůƵƐƚƌĂƟǀĞWĞƌƐƉĞĐƟǀĞĨŽƌŽŶĐĞƉƚƵĂů Development of the Southwest Corner of Beach Boulevard and Orange Avenue ........................................................64 &ŝŐƵƌĞϰͲϴ/ůůƵƐƚƌĂƟǀĞWĞƌƐƉĞĐƟǀĞĨŽƌŽŶĐĞƉƚƵĂů Development of the West Side of Beach Boulevard between Orange Avenue and Ball Road .........................66 &ŝŐƵƌĞϰͲϵWƌŽƉŽƐĞĚ^ƚƌĞĞƚƌŽƐƐ^ĞĐƟŽŶͲ Beach Boulevard .............................................................71 &ŝŐƵƌĞϰͲϭϬŽŶĐĞƉƚƵĂůWůĂŶƟŶŐWůĂŶWĂƩĞƌŶ ................72 Figure 4-11 Proposed Branding for Beach Boulevard .....83 &ŝŐƵƌĞϰͲϭϮůƚĞƌŶĂƟǀĞtĂLJƐƚŽ/ŶĐŽƌƉŽƌĂƚĞ Open Space in Future Development Projects .................84 &ŝŐƵƌĞϰͲϭϯZŽĂĚǁĂLJůĂƐƐŝĮĐĂƟŽŶƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϵϱ Figure 4-14 Crosswalk Improvements ............................97 &ŝŐƵƌĞϰͲϭϱdžŝƐƟŶŐĂŶĚWƌŽƉŽƐĞĚŝŬĞǁĂLJƐ ..................99 Figure 4-16 Proposed Carbon Creek Bikeway ŽŶŶĞĐƟŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϬϭ Figure 4-17 Transit Routes ............................................105 &ŝŐƵƌĞϰͲϭϴŶĂŚĞŝŵZĞƐŽƌƚdƌĂŶƐƉŽƌƚĂƟŽŶZŽƵƚĞƐ ....107 Figure 4-19 Proposed Storm Drain Improvements .......111 Figure 4-20 Proposed Sewer Improvements ................115 Figure 4-21 Proposed Water System Improvements ....119 Figure 5-1 Project Approval Process Chart ...................127 LIST OF TABLES Table 3-1 Employment by Industry, 2011–2016 .............39 Table 3-2 Resident Employment by Industry, 2015 ........42 dĂďůĞϯͲϯ'ƌĞĞŶ,ŽƵƐĞ'ĂƐZĞĚƵĐƟŽŶ͗ Current Status and Targets, 2015-2030 ..........................46 dĂďůĞϰͲϭĞǀĞůŽƉŵĞŶƚƌĞĂ^ƚĂƟƐƟĐĂů^ƵŵŵĂƌLJ..........54 dĂďůĞϰͲϮdƌĞĞĂŶĚWůĂŶƚWĂůĞƩĞ .....................................74 dĂďůĞϰͲϯZŽĂĚǁĂLJůĂƐƐŝĮĐĂƟŽŶƐ ..................................93 dĂďůĞϰͲϰŝĐLJĐůĞ&ĂĐŝůŝƚLJĞĮŶŝƟŽŶƐ ...............................96 dĂďůĞϱͲϭ/ŵƉůĞŵĞŶƚĂƟŽŶĐƟŽŶWůĂŶ .........................132 CHAPTER 1:INTRODUCTION 2 | INTRODUCTION | HEARING DRAFT OCTOBER 2018 dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018| INTRODUCTION | 3 1 dŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶ;^WͿŝƐƚŚĞƌĞƐƵůƚ ŽĨĂĨŽĐƵƐĞĚĂŶĚĐŽŵƉƌĞŚĞŶƐŝǀĞĞīŽƌƚŝŶǀŽůǀŝŶŐƚŚĞ ŝƚLJŽĨŶĂŚĞŝŵĂŶĚƚŚĞtĞƐƚŶĂŚĞŝŵŽŵŵƵŶŝƚLJ͘ dŚŝƐ^ƉĞĐŝĮĐWůĂŶŐƵŝĚĞƐĨƵƚƵƌĞĚĞǀĞůŽƉŵĞŶƚĂůŽŶŐĂ ϭ͘ϱͲŵŝůĞƐƚƌĞƚĐŚŽĨĞĂĐŚŽƵůĞǀĂƌĚďĞƚǁĞĞŶƚŚĞĐŝƟĞƐ ŽĨƵĞŶĂWĂƌŬĂŶĚ^ƚĂŶƚŽŶ͘dŚĞŝƚLJĂŶĚĐŽŵŵƵŶŝƚLJ ĚĞƐŝƌĞƚŽƌĞĂĐƟǀĂƚĞƚŚĞĐŽƌƌŝĚŽƌĂƐĂŶĞĐŽŶŽŵŝĐĂůůLJ ǀŝďƌĂŶƚĨŽĐĂůĂƌĞĂŝŶŶĂŚĞŝŵ͘ŽŶƐĞƋƵĞŶƚůLJ͕ĂŶĞǁ ĐŽŵŵƵŶŝƚLJͲĚƌŝǀĞŶǀŝƐŝŽŶǁŝůůĂĐƟǀĂƚĞƚŚĞĐŽƌƌŝĚŽƌ ƚŚƌŽƵŐŚ ŝŵƉůĞŵĞŶƚĂƚŝŽŶ ŽĨ ƚŚŝƐ WůĂŶ͘ ^ƵƉƉŽƌƚĞĚ ďLJŵŽĚĞƌŶĚĞǀĞůŽƉŵĞŶƚƐƚĂŶĚĂƌĚƐ͕ĞĐŽŶŽŵŝĐĂŶĚ ƐƵƐƚĂŝŶĂďůĞĐŽŵŵƵŶŝƚLJĚĞǀĞůŽƉŵĞŶƚŝŶĐĞŶƟǀĞƐ͕ĂŶĚ ĐĂƉŝƚĂůŝŵƉƌŽǀĞŵĞŶƚƐ͕ƚŚĞ^WŚŽůŝƐƟĐĂůůLJĂĚĚƌĞƐƐĞƐ ƚŚĞĨƵƚƵƌĞŽĨĞĂĐŚŽƵůĞǀĂƌĚͶƚŚĞŚĞĂƌƚŽĨtĞƐƚ ŶĂŚĞŝŵ͘ ^ƚĂƚĞZŽƵƚĞϯϵͶĞĂĐŚŽƵůĞǀĂƌĚͶǁĂƐŽŶĐĞŬŶŽǁŶ ĂƐƚŚĞΗZŽĂĚƚŽ^ƵŵŵĞƌΗĂƐŝƚǁĂƐŚŝƐƚŽƌŝĐĂůůLJƚŚĞŽŶůLJ ŶŽƌƚŚͬƐŽƵƚŚƌŽƵƚĞƚŽƚŚĞKƌĂŶŐĞŽƵŶƚLJďĞĂĐŚĞƐ͘dŚĞ ŵĂũŽƌŝƚLJŽĨĚĞǀĞůŽƉŵĞŶƚŝŶƚŚĞĂƌĞĂƚŽŽŬƉůĂĐĞĚƵƌŝŶŐ ƚŚĞϭϵϲϬƐĂŶĚϭϵϳϬƐ͘DŽƚĞůƐƉŽƉƵůĂƚĞĚƚŚĞƌŽƵƚĞ ƉƌŽǀŝĚŝŶŐĂĐĐŽŵŵŽĚĂƟŽŶƐĨŽƌǀŝƐŝƚŽƌƐ͘^ƵƉƉŽƌƟŶŐ ĐŽŵŵĞƌĐŝĂůĂŶĚƐĞƌǀŝĐĞͲŽƌŝĞŶƚĞĚƵƐĞƐĨŽůůŽǁĞĚ͘ ĞƐŝŐŶĂƚĞĚďLJƚŚĞ^ŽƵƚŚĞƌŶĂůŝĨŽƌŶŝĂƐƐŽĐŝĂƟŽŶ ŽĨ'ŽǀĞƌŶŵĞŶƚƐĂƐĂ,ŝŐŚYƵĂůŝƚLJdƌĂŶƐŝƚŽƌƌŝĚŽƌ͕ ĞĂĐŚŽƵůĞǀĂƌĚ͛ƐƉƌŝŵĂƌLJĨƵŶĐƟŽŶŝƐƐƟůůĨŽƌŵŽƚŽƌ ǀĞŚŝĐůĞƐ͘EŽŶͲŵŽƚŽƌŝnjĞĚŵŽĚĞƐŽĨƚƌĂŶƐƉŽƌƚĂƟŽŶ ƐƵĐŚĂƐǁĂůŬŝŶŐĂŶĚďŝŬŝŶŐĂƌĞŶŽƚǁĞůůŝŶƚĞŐƌĂƚĞĚ ĂůŽŶŐƚŚĞƐƚƌĞĞƚ͘ĚĚŝƟŽŶĂůůLJ͕ŵĂŶLJŽĨƚŚĞůĂŶĚƵƐĞƐ ĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌĚŽŶŽƚĐŽŶƚƌŝďƵƚĞƚŽƚŚĞƉŽƐŝƟǀĞ ƋƵĂůŝƟĞƐŽĨƚŚĞƐƵƌƌŽƵŶĚŝŶŐĐŽŵŵƵŶŝƚLJ͘dŚĞĚĞĐůŝŶŝŶŐ ƌĞƚĂŝůĐĞŶƚĞƌƐ͕ŵŽƚĞůƐ͕ĂŶĚǀĂĐĂŶƚůĂŶĚƐĐŽŶƚƌŝďƵƚĞƚŽ ƚŚĞĂƌĞĂΖƐŚŝŐŚĐƌŝŵĞƌĂƚĞĂŶĚĞĐŽŶŽŵŝĐĚĞƚĞƌŝŽƌĂƟŽŶ͘ dŚĞŝŶƚĞŶƚŽĨƚŚŝƐ^ƉĞĐŝĮĐWůĂŶŝƐƚŽĐƌĞĂƚĞĂŶĞǁ͕ ƚĂŝůŽƌĞĚĂŶĚŇĞdžŝďůĞƌĞŐƵůĂƚŽƌLJĞŶǀŝƌŽŶŵĞŶƚ͕ůĂŶĚ ƵƐĞƉůĂŶ͕ĚĞǀĞůŽƉŵĞŶƚŝŶĐĞŶƟǀĞƐ͕ĂŶĚƐƚƌĞĞƚƐĐĂƉĞ ĞŶŚĂŶĐĞŵĞŶƚƐƚŽŝŵƉƌŽǀĞĐŽŶĚŝƟŽŶƐĂůŽŶŐĞĂĐŚ ŽƵůĞǀĂƌĚĂŶĚĂƩƌĂĐƚĞĐŽŶŽŵŝĐŝŶǀĞƐƚŵĞŶƚƚŽƚŚĞ ĂƌĞĂ͘ dŚĞ^ƉĞĐŝĮĐWůĂŶƉƌŽĐĞƐƐŝŶĐůƵĚĞĚƚŚĞĐŽŵŵƵŶŝƚLJ ĂƚĞǀĞƌLJƐƚĂŐĞ͘dŚĞǀŝƐŝŽŶĂŶĚŐƵŝĚŝŶŐƉƌŝŶĐŝƉůĞƐ͕ ƉƌŽǀŝĚĞĚ ŝŶ ŚĂƉƚĞƌ Ϯ͕ ǁĞƌĞ ĐƌĞĂƚĞĚ ǁŝƚŚ ƚŚĞ ĐŽŵŵƵŶŝƚLJĂŶĚŚŝŐŚůŝŐŚƚƚŚĞƚŚĞŵĞƐƚŚĂƚĞŵĞƌŐĞĚ ƚŚƌŽƵŐŚŽƵƚƚŚĞƉƌŽĐĞƐƐ͘dŚĞLJĂƌĞƚŚĞĨŽƵŶĚĂƟŽŶĨŽƌ ƚŚŝƐWůĂŶĂŶĚĐŽŶƟŶƵĞƚŽĨŽĐƵƐŝƚLJŝŵƉƌŽǀĞŵĞŶƚƐ ŝŶƚŚĞtĞƐƚŶĂŚĞŝŵĂƌĞĂ͘dŚĞƉƌŽĐĞƐƐĂŶĚƐƚĞƉƐƚŽ ƌĞĂůŝnjĞƚŚĞǀŝƐŝŽŶĂƌĞĚŝƐĐƵƐƐĞĚƚŚƌŽƵŐŚŽƵƚƚŚŝƐWůĂŶ ĂŶĚŝŶŐƌĞĂƚĞƌĚĞƚĂŝůŝŶŚĂƉƚĞƌϱ͕ĚŵŝŶŝƐƚƌĂƟŽŶĂŶĚ /ŵƉůĞŵĞŶƚĂƟŽŶ͘ dŚĞŝƚLJƌĞĐĞŝǀĞĚĨƵŶĚŝŶŐĨŽƌƚŚŝƐWůĂŶƚŚƌŽƵŐŚƚŚĞ ĂůŝĨŽƌŶŝĂ ^ƚƌĂƚĞŐŝĐ 'ƌŽǁƚŚ ŽƵŶĐŝů͛Ɛ ^ƵƐƚĂŝŶĂďůĞ ŽŵŵƵŶŝƟĞƐWůĂŶŶŝŶŐ'ƌĂŶƚĂŶĚ/ŶĐĞŶƟǀĞƐWƌŽŐƌĂŵ͘ /ŵƉůĞŵĞŶƚĂƟŽŶŽĨƚŚĞWůĂŶǁŝůůƐƚƌĞŶŐƚŚĞŶƚŚĞtĞƐƚ ŶĂŚĞŝŵ ĐŽŵŵƵŶŝƚLJ ĂŶĚ ƐƵƉƉŽƌƚ ƚŚĞ ^ƚƌĂƚĞŐŝĐ 'ƌŽǁƚŚŽƵŶĐŝůΖƐƉƌŽŐƌĂŵŐŽĂůƐƚŽ͗ • ,ĞůƉůŽĐĂůŐŽǀĞƌŶŵĞŶƚƐŵĞĞƚƚŚĞĐŚĂůůĞŶŐĞƐ ŽĨĂĚŽƉƟŶŐůĂŶĚƵƐĞƉůĂŶƐ • /ŵƉůĞŵĞŶƚƐƚƌĂƚĞŐŝĞƐƚŽƚƌĂŶƐĨŽƌŵ ĐŽŵŵƵŶŝƟĞƐĂŶĚĐƌĞĂƚĞůŽŶŐͲƚĞƌŵ ƉƌŽƐƉĞƌŝƚLJ dŚĞ^ƚƌĂƚĞŐŝĐ'ƌŽǁƚŚŽƵŶĐŝů;^'ͿĚĞĨŝŶĞƐĂ ƐƵƐƚĂŝŶĂďůĞĐŽŵŵƵŶŝƚLJĂƐŽŶĞƚŚĂƚƉƌŽŵŽƚĞƐĞƋƵŝƚLJ͕ ƐƚƌĞŶŐƚŚĞŶƐƚŚĞĞĐŽŶŽŵLJ͕ƉƌŽƚĞĐƚƐƚŚĞĞŶǀŝƌŽŶŵĞŶƚ͕ ĂŶĚƉƌŽŵŽƚĞƐŚĞĂůƚŚLJ͕ƐĂĨĞĐŽŵŵƵŶŝƟĞƐͶƚŚĞƐĂŵĞ ĨĂĐƚŽƌƐƚŚĂƚĂƌĞŬĞLJƚŽƚŚĞƐƵĐĐĞƐƐŽĨƚŚĞĞĂĐŚ ŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶĂŶĚƌĞǀŝƚĂůŝnjĂƟŽŶŽĨtĞƐƚ ŶĂŚĞŝŵ͘ƐƉĂƌƚŽĨƚŚĞ^'ŐƌĂŶƚ͕ƚŚĞŝƚLJĞƐƚĂďůŝƐŚĞĚ ůŽŶŐͲƚĞƌŵŽďũĞĐƟǀĞƐƚŽůĂLJƚŚĞŝŶŝƟĂůŐƌŽƵŶĚǁŽƌŬ ĨŽƌĐƌĞĂƟŶŐĂƐƵƐƚĂŝŶĂďůĞƉůĂŶ͘dŚĞ^WŽďũĞĐƟǀĞƐ ŝŶĐůƵĚĞ͗ • /ŶĐƌĞĂƐŝŶŐŝŶĮůůĂŶĚĐŽŵƉĂĐƚĚĞǀĞůŽƉŵĞŶƚ ĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ • ZĞǀŝƚĂůŝnjĂƟŽŶŽĨƚŚĞ^WĂƌĞĂĂƐĂŶƵƌďĂŶ ĐŽƌĞĂŶĚĐŽŵŵƵŶŝƚLJĐĞŶƚĞƌĨŽƌtĞƐƚ ŶĂŚĞŝŵ • ^ƚƌĞŶŐƚŚĞŶŝŶŐƚŚĞůŽĐĂůĞĐŽŶŽŵLJ 1 INTRODUCTION: IMPROVE THE BOULEVARD ŽŶĐĞƉƚƵĂů ŝůůƵƐƚƌĂƟǀĞ ŽĨ Ă ƌĞǀŝƚĂůŝnjĞĚ ŶĞŝŐŚďŽƌŚŽŽĚ ĐŽŵŵĞƌĐŝĂůĐĞŶƚĞƌĂƚĞĂĐŚŽƵůĞǀĂƌĚĂŶĚĂůůZŽĂĚ͘ 4 | INTRODUCTION | HEARING DRAFT OCTOBER 2018 1.1 LOCATION—THE HEART OF WEST ANAHEIM ĞĂĐŚŽƵůĞǀĂƌĚƐƚĂƌƚƐŝŶƚŚĞŝƚLJŽĨ>Ă,ĂďƌĂĂŶĚ ƉĂƐƐĞƐƚŚƌŽƵŐŚŶŝŶĞĐŝƟĞƐďĞĨŽƌĞƚĞƌŵŝŶĂƟŶŐŝŶƚŚĞ ŝƚLJŽĨ,ƵŶƟŶŐƚŽŶĞĂĐŚ͘ZĞŐŝŽŶĂůůLJ͕ƚŚĞŚŝŐŚǁĂLJ ĐŽŶŶĞĐƚƐƚŽ^ƚĂƚĞZŽƵƚĞϵϭĂŶĚ/ͲϱƚŽƚŚĞŶŽƌƚŚŝŶ ƚŚĞŝƚLJŽĨƵĞŶĂWĂƌŬ͘dŽƚŚĞƐŽƵƚŚŝƚĐŽŶŶĞĐƚƐƚŽ ^ƚĂƚĞZŽƵƚĞϮϮĂŶĚ/ͲϰϬϱŝŶƚŚĞĐŝƟĞƐŽĨ^ƚĂŶƚŽŶĂŶĚ tĞƐƚŵŝŶƐƚĞƌ͘&ŝŐƵƌĞϭͲϭ͕ZĞŐŝŽŶĂů>ŽĐĂƟŽŶ͕ĚĞƉŝĐƚƐ ƚŚĞƌĞŐŝŽŶĂůůŽĐĂƟŽŶŽĨƚŚĞ^WĂƌĞĂĂŶĚƐƵƌƌŽƵŶĚŝŶŐ ĐŝƟĞƐ͘ dŚĞ^WĂƌĞĂŝƐĂŶĂƉƉƌŽdžŝŵĂƚĞůLJϭ͘ϱͲŵŝůĞƐĞŐŵĞŶƚ ŽĨĞĂĐŚŽƵůĞǀĂƌĚŝŶƚŚĞŝƚLJŽĨŶĂŚĞŝŵ͕ĂƐƐŚŽǁŶ ŽŶ&ŝŐƵƌĞϭͲϮ͕>ŽĐĂůsŝĐŝŶŝƚLJ͘ĞĂĐŚŽƵůĞǀĂƌĚŝƐĂŶ ĞŝŐŚƚͲůĂŶĞĚŝǀŝĚĞĚŚŝŐŚǁĂLJ͘dŚĞĂƌĞĂďŽƌĚĞƌƐƚŚĞ ĐŝƟĞƐŽĨƵĞŶĂWĂƌŬƚŽƚŚĞŶŽƌƚŚĂŶĚ^ƚĂŶƚŽŶƚŽƚŚĞ ƐŽƵƚŚ͘DĂũŽƌĐƌŽƐƐͲƐƚƌĞĞƚƐĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌŝŶƚŚĞ ŝƚLJůŝŵŝƚƐŝŶĐůƵĚĞĂůůZŽĂĚ͕KƌĂŶŐĞǀĞŶƵĞ͕ĂŶĚ >ŝŶĐŽůŶǀĞŶƵĞ͘dŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂĞŶĐŽŵƉĂƐƐĞƐ ĂƉƉƌŽdžŝŵĂƚĞůLJϮϴϯĂĐƌĞƐ͘WŽŝŶƚƐŽĨŝŶƚĞƌĞƐƚǁŝƚŚŝŶƚŚĞ ĂƌĞĂŝŶĐůƵĚĞdǁŝůĂZĞŝĚWĂƌŬ͕^ĐŚǁĞŝƚnjĞƌWĂƌŬ͕tĞƐƚ ŶĂŚĞŝŵDĞĚŝĐĂůĞŶƚĞƌ͕ĂŶĚƚŚĞtĞƐƚŶĂŚĞŝŵ zŽƵƚŚĞŶƚĞƌ͘ ƐĂŵĂũŽƌĐŽŶŶĞĐƟŽŶƚŚƌŽƵŐŚƚŚĞŝƚLJŽĨŶĂŚĞŝŵ͕ ĞĂĐŚŽƵůĞǀĂƌĚŚĂƐĂŶĂǀĞƌĂŐĞĚĂŝůLJƚƌĂĸĐĐŽƵŶƚ ŽĨϲϲ͕ϬϬϬǀĞŚŝĐůĞƐ͘tŝƚŚĂŶĞƐƚŝŵĂƚĞĚĞdžŝƐƚŝŶŐ ƉŽƉƵůĂƟŽŶŽĨĂďŽƵƚϰ͕ϱϬϬƉĞŽƉůĞǁŝƚŚŝŶƚŚĞ^ƉĞĐŝĮĐ WůĂŶďŽƵŶĚĂƌLJĂŶĚĂƉƉƌŽdžŝŵĂƚĞůLJϰϱ͕ϱϬϬƌĞƐŝĚĞŶƚƐ ǁŝƚŚŝŶĂŽŶĞͲŵŝůĞƌĂĚŝƵƐŽĨƚŚĞŝŶƚĞƌƐĞĐƟŽŶŽĨĞĂĐŚ ŽƵůĞǀĂƌĚ ĂŶĚ KƌĂŶŐĞ ǀĞŶƵĞ ƚŚĞ ĐŽƌƌŝĚŽƌ ŚĂƐ ĞŶŽƌŵŽƵƐƉŽƚĞŶƟĂůƚŽƐƵƉƉŽƌƚƌĞƐŝĚĞŶƚƐĂŶĚǀŝƐŝƚŽƌƐ ĂůŝŬĞ͘ ĚũĂĐĞŶƚǀŝƐŝƚŽƌͲƐĞƌǀŝŶŐĂƩƌĂĐƟŽŶƐŝŶƚŚĞƵĞŶĂWĂƌŬ ŶƚĞƌƚĂŝŶŵĞŶƚŽŶĞŝŶĐůƵĚĞ<ŶŽƩΖƐĞƌƌLJ&ĂƌŵĂŶĚ ^ŽĂŬŝƚLJ͕DĞĚŝĞǀĂůdŝŵĞƐ͕WŝƌĂƚĞƐŝŶŶĞƌdŚĞĂƚƌĞ͕ ZŽĐŬΘƌĞǁƐ͕dŚĞ^ŽƵƌĐĞ͕ĂŶĚWŽƌƚŽΖƐĂŬĞƌLJΘĂĨĞ͘ &ŝŌĞĞŶŚŽƚĞůƐƉƌŽǀŝĚĞŽǀĞƌŶŝŐŚƚĂĐĐŽŵŵŽĚĂƟŽŶƐ ǁŝƚŚŝŶƚŚĞƵĞŶĂWĂƌŬŶƚĞƌƚĂŝŶŵĞŶƚŽŶĞ͘^ƚƌĂĚĚůŝŶŐ ƚŚĞƐŽƵƚŚĞƌŶďŽƵŶĚĂƌLJŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂŝƐ ĚǀĞŶƚƵƌĞŝƚLJ͕ǁŚŝĐŚŽīĞƌƐĨĂŵŝůLJĞŶƚĞƌƚĂŝŶŵĞŶƚŝŶ ĂƐŵĂůůĂŵƵƐĞŵĞŶƚƉĂƌŬĞŶǀŝƌŽŶŵĞŶƚ͘ &ŝŐƵƌĞϭͲϭZĞŐŝŽŶĂů>ŽĐĂƟŽŶ §¨¦ £[ £[ £[ £[ £[ £[ §¨¦ £[ £[ CERRITOS WHITTIER LA PUENTE WEST COVINA LA MIRADA LA HABRA HEIGHTS INDUSTRY SANTA FE SPRINGS SANTA ANA GARDEN GROVE CYPRESS COSTA MESA WESTMINSTER BUENA PARK LA PALMA LA HABRA FOUNTAIN VALLEY SEAL BEACH HUNTINGTON BEACH BREA LOS ALAMITOS STANTON NEWPORT BEACH ANAHEIM FULLERTON 1 22 57 90 60 72 39 91 405405 55 012 Miles Specific Plan Area City of Anaheim Beach Blvd HEARING DRAFT OCTOBER 2018| INTRODUCTION | 5 1 G k k !( !( 4 4 4 4 4 4 4 BROADWAY ORANGE AVE LINCOLN AVE BEACHBLVDWESTERN AVEBALL RD DALE AVE^ West Anaheim Medical CenterFire Station #11 City of Buena Park City of Stanton Adventure City Schweitzer Park Twila Reid Park Western High School Dale Junior High Centralia Elementary Dr. Albert Schweitzer Elementary Lord Baden-Powell ElementaryOrange County Christian School Twila Reid Elementary West Anaheim Youth Center 05001,000 Feet 4 School !(Park k Public Facilities G Hospital Specific Plan Area City Boundary Figure 1-2 Local Vicinity 6 | INTRODUCTION | HEARING DRAFT OCTOBER 2018 dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018| INTRODUCTION | 7 1 1.2 PURPOSE AND AUTHORITY dŚĞ^WŝƐĂŶĂĐƟǀĞ͕ůŽŶŐͲƚĞƌŵƉůĂŶŶŝŶŐĚŽĐƵŵĞŶƚ ƚŚĂƚǁŝůůŐƵŝĚĞĨƵƚƵƌĞůĂŶĚƵƐĞĂŶĚĚĞǀĞůŽƉŵĞŶƚ ĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ͘ƐƉĞĐŝĨŝĐƉůĂŶŝƐĂƉůĂŶŶŝŶŐ ƚŽŽůƵƐĞĚƚŽŐƵŝĚĞƚŚĞĨƵƚƵƌĞŽĨůĂŶĚƵƐĞ͕ŵŽďŝůŝƚLJ͕ ĞĐŽŶŽŵŝĐ͕ĂŶĚĞŶǀŝƌŽŶŵĞŶƚĂůĨĞĂƚƵƌĞƐŝŶĂŶĂƌĞĂ͘ ĂůŝĨŽƌŶŝĂ'ŽǀĞƌŶŵĞŶƚŽĚЧϲϱϰϱϬƚŚƌŽƵŐŚΑϲϱϰϱϳ ĞƐƚĂďůŝƐŚĞƐƚŚĞĂƵƚŚŽƌŝƚLJĨŽƌĐŝƟĞƐƚŽĂĚŽƉƚƐƉĞĐŝĮĐ ƉůĂŶƐĞŝƚŚĞƌďLJƌĞƐŽůƵƟŽŶŽƌďLJŽƌĚŝŶĂŶĐĞ͘ dŚĞƉƵƌƉŽƐĞŽĨƚŚŝƐ^ƉĞĐŝĮĐWůĂŶŝƐŶŽƚŽŶůLJƚŽĞƐƚĂďůŝƐŚ ĂǀŝƐŝŽŶĨŽƌƚŚĞtĞƐƚŶĂŚĞŝŵĐŽŵŵƵŶŝƚLJ͕ďƵƚƚŽ ƉƌŽǀŝĚĞĂƚĂŝůŽƌĞĚƌĞŐƵůĂƚŽƌLJĨƌĂŵĞǁŽƌŬĨŽƌƚŚĞ^W ĂƌĞĂƚŚĂƚŝŶĐůƵĚĞƐĐƵƐƚŽŵŝnjĞĚĚĞǀĞůŽƉŵĞŶƚĂŶĚĚĞƐŝŐŶ ƐƚĂŶĚĂƌĚƐ͕ůĂŶĚƵƐĞĚĞƐŝŐŶĂƟŽŶƐĂŶĚƐƚƌĞĞƚƐĐĂƉĞ ŝŵƉƌŽǀĞŵĞŶƚƐ͘dŚŝƐ^ƉĞĐŝĮĐWůĂŶƐĞƌǀĞƐĂƐƚŚĞnjŽŶŝŶŐ ĨŽƌƚŚĞ^WĂƌĞĂĂŶĚĞƐƚĂďůŝƐŚĞƐƉŽůŝĐLJŐƵŝĚĂŶĐĞ ĨŽƌƉĞƌŵŝƚƚĞĚͬƉƌŽŚŝďŝƚĞĚůĂŶĚƵƐĞƐ͕ĚĞǀĞůŽƉŵĞŶƚ ƐƚĂŶĚĂƌĚƐ͕ ŝŶĨƌĂƐƚƌƵĐƚƵƌĞ ŝŵƉƌŽǀĞŵĞŶƚƐ͕ ĂŶĚ ŝŵƉůĞŵĞŶƚĂƟŽŶƉƌŽŐƌĂŵƐĐƵƐƚŽŵŝnjĞĚĨŽƌƚŚŝƐĂƌĞĂ͘ ŶLJƐƚĂŶĚĂƌĚŽƌƌĞŐƵůĂƟŽŶŝŶƚŚŝƐ^ƉĞĐŝĮĐWůĂŶƚŚĂƚ ĚŝīĞƌƐĨƌŽŵƚŚĞŶĂŚĞŝŵDƵŶŝĐŝƉĂůŽĚĞ;DͿƐŚĂůů ƐƵƉĞƌƐĞĚĞƚŚĞD͘tŚĞƌĞƚŚŝƐ^ƉĞĐŝĮĐWůĂŶŝƐƐŝůĞŶƚ͕ ƚŚĞƉƌŽǀŝƐŝŽŶƐŽĨƚŚĞDƐŚĂůůƉƌĞǀĂŝů͕ĂƐŝŶƚĞƌƉƌĞƚĞĚ ďLJƚŚĞWůĂŶŶŝŶŐĂŶĚƵŝůĚŝŶŐŝƌĞĐƚŽƌ͘ KŶXXXXXX͕ƚŚĞŶĂŚĞŝŵŝƚLJŽƵŶĐŝůĂĚŽƉƚĞĚ KƌĚŝŶĂŶĐĞEŽ͘XXXXXƌĞůĂƟŶŐƚŽƚŚĞĞƐƚĂďůŝƐŚŵĞŶƚ ŽĨnjŽŶŝŶŐĂŶĚĚĞǀĞůŽƉŵĞŶƚƐƚĂŶĚĂƌĚƐĨŽƌƚŚĞĞĂĐŚ ŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶ;^WͿEŽ͘ϮϬϭϳͲϭďLJƚŚĞ ĂĚĚŝƟŽŶŽĨŚĂƉƚĞƌϭϴ͘ϭϮϮƚŽƚŚĞŶĂŚĞŝŵDƵŶŝĐŝƉĂů ŽĚĞ͕ĂŶĚKƌĚŝŶĂŶĐĞEŽ͘XXXX͕ĂŵĞŶĚŝŶŐƚŚĞnjŽŶŝŶŐ ŵĂƉƚŽƌĞĐůĂƐƐŝĨLJĂƉƉƌŽdžŝŵĂƚĞůLJϮϯϮ͘ϴĂĐƌĞƐŽĨĐĞƌƚĂŝŶ ƌĞĂůƉƌŽƉĞƌƚLJŝŶƚŽƚŚĞ^W͘dŚĞ^WĂůƐŽƌĞƋƵŝƌĞĚĂŶ ĂŵĞŶĚŵĞŶƚƚŽƚŚĞŝƚLJΖƐ'ĞŶĞƌĂůWůĂŶ͘ ƵƚŽͲŽƌŝĞŶƚĞĚ ĐŽŵŵĞƌĐŝĂů ƐŚŽƉƉŝŶŐ ĐĞŶƚĞƌƐ ĂƌĞ ŵŽƐƚůLJ ůŽĐĂƚĞĚ Ăƚ ƚŚĞ ŵĂũŽƌ ŝŶƚĞƌƐĞĐƟŽŶƐ ŽĨ ĞĂĐŚ ŽƵůĞǀĂƌĚ ĂŶĚ Ăůů ZŽĂĚ͕ KƌĂŶŐĞ ǀĞŶƵĞ͕ ĂŶĚ >ŝŶĐŽůŶ ǀĞŶƵĞ ĂůŽŶŐ ƚŚĞ ĐŽƌƌŝĚŽƌ͘ WHAT IS A SPECIFIC PLAN? A specific plan is one of several policy or regulatory tools used by local governments to guide community development. While ƚŚĞŐĞŶĞƌĂůƉůĂŶƐĞƚƐĨŽƌƚŚŐŽĂůƐ͕ŽďũĞĐƟǀĞƐ͕ ƉŽůŝĐŝĞƐ͕ĂŶĚƉƌŽŐƌĂŵƐĨŽƌƚŚĞĞŶƟƌĞũƵƌŝƐĚŝĐƟŽŶ͕ ĂƐƉĞĐŝĮĐƉůĂŶĚŽĞƐƐŽĨŽƌĂůŽĐĂůŝnjĞĚĂƌĞĂĂŶĚ in greater detail. The authority for preparing ĂƐƉĞĐŝĮĐƉůĂŶŝƐŝŶƚŚĞĂůŝĨŽƌŶŝĂ'ŽǀĞƌŶŵĞŶƚ ŽĚĞΑΑϲϱϰϱϬƚŚƌŽƵŐŚϲϱϰϱϳ͘dŚĞůĂǁĂůůŽǁƐ͕ but does not require, the planning agency ƚŽƉƌĞƉĂƌĞĂŶĚĂĚŽƉƚƐƉĞĐŝĮĐƉůĂŶƐĨŽƌƚŚĞ systematic execution of the general plan. ĐĐŽƌĚŝŶŐƚŽƐƚĂƚĞůĂǁ͕ĂůůƐƉĞĐŝĮĐƉůĂŶƐŵƵƐƚďĞ ĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞĂĚŽƉƚĞĚŐĞŶĞƌĂůƉůĂŶ͕ĂŶĚ ĂůůƐƵďĚŝǀŝƐŝŽŶĂŶĚĚĞǀĞůŽƉŵĞŶƚĂĐƟǀŝƚLJŵƵƐƚďĞ ĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞƐƉĞĐŝĮĐƉůĂŶ͘ 8 | INTRODUCTION | HEARING DRAFT OCTOBER 2018 1.3 ORGANIZATION OF THE SPECIFIC PLAN DOCUMENT ĂĐŚĐŚĂƉƚĞƌŽĨƚŚĞ^WĂĚĚƌĞƐƐĞƐĂŬĞLJĐŽŵƉŽŶĞŶƚ ŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶ͘dŚĞ^WŝƐĚŝǀŝĚĞĚŝŶƚŽĮǀĞ ĐŚĂƉƚĞƌƐĂŶĚĨŽƵƌĂƉƉĞŶĚŝdžƐĞĐƟŽŶƐ͗ ŚĂƉƚĞƌϭ/ŶƚƌŽĚƵĐƟŽŶ͗WƌŽǀŝĚĞƐĂŶŽǀĞƌǀŝĞǁŽĨ ƚŚĞ^ƉĞĐŝĮĐWůĂŶƉƌŽũĞĐƚ͕ƚŚĞƉƵƌƉŽƐĞŽĨƚŚĞWůĂŶ͕ ƌĞƋƵŝƌĞŵĞŶƚƐ ĨŽƌ ĞŶǀŝƌŽŶŵĞŶƚĂů ƌĞǀŝĞǁ͕ ĂŶĚ Ă ƐƵŵŵĂƌLJŽĨƌĞůĂƚĞĚƉůĂŶƐ͕ƉƌŽŐƌĂŵƐ͕ĂŶĚƌĞŐƵůĂƟŽŶƐ͘ ŚĂƉƚĞƌϮ<ĞLJdŚĞŵĞƐ͕sŝƐŝŽŶĂŶĚ'ƵŝĚŝŶŐWƌŝŶĐŝƉůĞƐ͗ WƌĞƐĞŶƚƐƚŚĞŬĞLJƚŚĞŵĞƐ͕ĐŽŵŵƵŶŝƚLJΖƐǀŝƐŝŽŶĨŽƌƚŚĞ ĨƵƚƵƌĞ͕ĂŶĚŐƵŝĚŝŶŐƉƌŝŶĐŝƉůĞƐĨŽƌƚŚŝƐWůĂŶ͘ ŚĂƉƚĞƌϯŽŶƚĞdžƚ͗ŽǀĞƌƐďĂĐŬŐƌŽƵŶĚŝŶĨŽƌŵĂƟŽŶ͕ ŝŶĐůƵĚŝŶŐĂďƌŝĞĨŚŝƐƚŽƌLJŽĨƚŚĞĂƌĞĂĂŶĚĂƐƵŵŵĂƌLJŽĨ ƚŚĞĞdžŝƐƟŶŐĐŽŶĚŝƟŽŶƐ͘ ŚĂƉƚĞƌϰdŚĞWůĂŶ͗ŽŶƐŝƐƚƐŽĨƚŚƌĞĞƐƵďͲƐĞĐƟŽŶƐͶ ĞǀĞůŽƉŵĞŶƚƌĞĂƐ͕DŽďŝůŝƚLJ͕ĂŶĚ/ŶĨƌĂƐƚƌƵĐƚƵƌĞͶƚŚĂƚ ŝĚĞŶƟĨLJƚŚĞŝŶƚĞŶĚĞĚůĂŶĚƵƐĞƐ͕ƐƚƌĞĞƚƐĐĂƉĞ͕ŵŽďŝůŝƚLJ͕ ƌĞĐƌĞĂƟŽŶĂŶĚŽƉĞŶƐƉĂĐĞ͕ĂŶĚŝŶĨƌĂƐƚƌƵĐƚƵƌĞƉůĂŶƐ ĨŽƌƚŚĞ^WĂƌĞĂ͘ ĞǀĞůŽƉŵĞŶƚƌĞĂƐĚĞĮŶĞƐƚŚĞŝŶƚĞŶĚĞĚůĂŶĚƵƐĞ ĨŽƌĞĂĐŚĚĞǀĞůŽƉŵĞŶƚĂƌĞĂ͕ĚĞƐĐƌŝďĞƐƐƚĂŶĚĂƌĚƐĨŽƌ ĚĞǀĞůŽƉŵĞŶƚĂŶĚĚĞƐŝŐŶ͕ŝŶĐůƵĚŝŶŐďƵŝůĚŝŶŐŚĞŝŐŚƚ͕ ĚĞŶƐŝƚLJ͕ƉĂƌŬŝŶŐ͕ƐŝƚĞĐŽŶĮŐƵƌĂƟŽŶ͕ďƵŝůĚŝŶŐĚĞƐŝŐŶ͕ ŽƉĞŶƐƉĂĐĞ͕ĂŶĚŽƚŚĞƌƌĞƋƵŝƌĞŵĞŶƚƐ͘ The DŽďŝůŝƚLJƐĞĐƟŽŶĂĚĚƌĞƐƐĞƐƚŚĞƉƵďůŝĐƌŝŐŚƚͲŽĨͲ ǁĂLJĂŶĚƉƵďůŝĐƌĞĂůŵƌĞůĂƚĞĚƚŽƉĞĚĞƐƚƌŝĂŶ͕ŶŽŶͲ ŵŽƚŽƌŝnjĞĚĂŶĚŵŽƚŽƌŝnjĞĚǀĞŚŝĐůĞƐ͘ /ŶĨƌĂƐƚƌƵĐƚƵƌĞ ƉƌŽǀŝĚĞƐƉůĂŶŶĞĚŝŵƉƌŽǀĞŵĞŶƚƐĨŽƌƚŚĞ ŵĂũŽƌŝŶĨƌĂƐƚƌƵĐƚƵƌĞƐLJƐƚĞŵƐ͕ŝŶĐůƵĚŝŶŐƐƚŽƌŵĚƌĂŝŶ͕ ƐĞǁĞƌ͕ĂŶĚǁĂƚĞƌĂŶĚƚŚĞŝŵƉĂĐƚĨƵƚƵƌĞĚĞǀĞůŽƉŵĞŶƚ ĐŽƵůĚŚĂǀĞŽŶƚŚĞƐĞƐLJƐƚĞŵƐ͘ ŚĂƉƚĞƌ ϱ ĚŵŝŶŝƐƚƌĂƚŝŽŶ ĂŶĚ /ŵƉůĞŵĞŶƚĂƚŝŽŶ͗ WƌĞƐĞŶƚƐƚŚĞƉƌŽĐĞƐƐĨŽƌƉƌŽũĞĐƚĂƉƉƌŽǀĂůƐ͕ŝŶĐĞŶƟǀĞƐ͕ ŝŵƉůĞŵĞŶƚĂƟŽŶĂĐƟŽŶƐ͕ĂŶĚĞĐŽŶŽŵŝĐĚĞǀĞůŽƉŵĞŶƚ ƐƚƌĂƚĞŐLJĨŽƌƚŚĞ^WĂƌĞĂ͘ ƉƉĞŶĚŝdžĞǀĞůŽƉŵĞŶƚŽĚĞ͗WƌŽǀŝĚĞƐĂĐŽƉLJ ŽĨŶĂŚĞŝŵDƵŶŝĐŝƉĂůŽĚĞŚĂƉƚĞƌϭϴ͘ϭϮϮ͕ǁŚŝĐŚ ĞƐƚĂďůŝƐŚĞƐĚĞǀĞůŽƉŵĞŶƚƐƚĂŶĚĂƌĚƐĨŽƌƚŚĞĞĂĐŚ ŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͘dŚĞĐŽĚĞĚĞƚĂŝůƐƚŚĞ ƐƚĂŶĚĂƌĚƐ͕ ƐƵĐŚ ĂƐ ďƵŝůĚŝŶŐ ŚĞŝŐŚƚ͕ ĚĞŶƐŝƚLJ͕ ĂŶĚ ƉĂƌŬŝŶŐ͘dŚŝƐƐĞĐƚŝŽŶĂůƐŽĚĞƚĂŝůƐƉĞƌŵŝƚƚĞĚĂŶĚ ƉƌŽŚŝďŝƚĞĚůĂŶĚƵƐĞƐ͘dŚĞĐŽĚĞŚĂƐďĞĞŶĂĚŽƉƚĞĚďLJ ŽƌĚŝŶĂŶĐĞ͘ ƉƉĞŶĚŝdžŽŵŵƵŶŝƚLJKƵƚƌĞĂĐŚZĞƉŽƌƚ͗ŽĐƵŵĞŶƚƐ ƚŚĞƉƵďůŝĐŽƵƚƌĞĂĐŚƉƌŽĐĞƐƐĂŶĚĐŽŵŵƵŶŝƚLJŝŶƉƵƚ ƌĞĐĞŝǀĞĚƌĞŐĂƌĚŝŶŐƚŚĞ^ƉĞĐŝĮĐWůĂŶ͘ DĂŶLJŽĨƚŚĞŵŽƚĞůƐĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚŚĂǀĞŽƌŝŐŝŶĂůƐŝŐŶĂŐĞĂŶĚ ŚĂǀĞŶŽƚƌĞĐĞŝǀĞĚĨĂĕĂĚĞŽƌŽƚŚĞƌƉƌŽƉĞƌƚLJŝŵƉƌŽǀĞŵĞŶƚƐƐŝŶĐĞƚŚĞϭϵϳϬƐ͘ HEARING DRAFT OCTOBER 2018| INTRODUCTION | 9 1 ZĞƐŝĚĞŶƚƐƉĂƌƟĐŝƉĂƚĞŝŶĂĐƟǀŝƟĞƐĂƚĂΗƉŽƉͲƵƉΗƚŚĨŽƌƚŚĞ^ƉĞĐŝĮĐ WůĂŶĚƵƌŝŶŐƚŚĞϮϬϭϲtEtĞƐƚĞƌŶĂƌďĞƋƵĞ͘ Appendix C Preliminary Market Analysis and Motel ĞŵĂŶĚ^ƚƵĚLJ͗WƌŽǀŝĚĞƐƐĞǀĞƌĂůĞĐŽŶŽŵŝĐƐƚƵĚŝĞƐ ƚŚĂƚǁĞƌĞĐŽŶĚƵĐƚĞĚƚŽĞǀĂůƵĂƚĞŵĂƌŬĞƚĐŽŶĚŝƟŽŶƐ ŝŶƚŚĞĂƌĞĂ͘ Appendix D Existing Conditions Report on ^ƵƐƚĂŝŶĂďŝůŝƚLJ͗^ƵŵŵĂƌŝnjĞƐĞdžŝƐƟŶŐĂŶĚƉŽƚĞŶƟĂů ƐƵƐƚĂŝŶĂďŝůŝƚLJŝŶŝƟĂƟǀĞƐŝŶ ƚŚĞŝƚLJŽĨŶĂŚĞŝŵĂŶĚ ^WĂƌĞĂƚŽŝŶĨŽƌŵƚŚĞ^WŽĨŽƉƉŽƌƚƵŶŝƟĞƐƚŽ ƉƌŽŵŽƚĞ ƐƵƐƚĂŝŶĂďůĞ ĚĞǀĞůŽƉŵĞŶƚ ĂŶĚ ƉƌĂĐƚŝĐĞƐ ǁŝƚŚŝŶƚŚĞƐƚƵĚLJĂƌĞĂ͘ 1.4 COMMUNITY INVOLVEMENT /ŶϮϬϭϰ͕ƉƌŝŽƌƚŽƌĞĐĞŝǀŝŶŐƚŚĞ^ƚƌĂƚĞŐŝĐ'ƌŽǁƚŚŽƵŶĐŝů 'ƌĂŶƚ͕ƚŚĞŝƚLJĞŵďĂƌŬĞĚŽŶĂĐŽŵŵƵŶŝƚLJŽƵƚƌĞĂĐŚ ĞīŽƌƚĂŶĚĐŽŵŵŝƐƐŝŽŶĞĚĂŵĂƌŬĞƚĂŶĂůLJƐŝƐĨŽƌƚŚĞ ĂƌĞĂ͘ƐƵŵŵĂƌLJŽĨƚŚĞŽƵƚƌĞĂĐŚĞīŽƌƚƐĂƌĞƉƌŽǀŝĚĞĚŝŶ ƉƉĞŶĚŝdž͕ŽŵŵƵŶŝƚLJ KƵƚƌĞĂĐŚZĞƉŽƌƚ͘/ŶĂĚĚŝƟŽŶ͕ ƚŚĞŝƚLJĐŽŶƟŶƵĞĚƚŽĞŶŐĂŐĞƚŚĞƉƵďůŝĐƚŚƌŽƵŐŚŽƵƚ ƚŚĞ^ƉĞĐŝĮĐWůĂŶƉƌŽĐĞƐƐ͘WƵďůŝĐŝŶǀŽůǀĞŵĞŶƚŝŶĐůƵĚĞĚ ƚŚĞĨŽƌŵĂƟŽŶŽĨĂŽŵŵƵŶŝƚLJĚǀŝƐŽƌLJŽŵŵŝƩĞĞ ;Ϳ͕ĂƐĞƌŝĞƐŽĨΗƉŽƉͲƵƉΗǁŽƌŬƐŚŽƉƐ͕ƐƚĂŬĞŚŽůĚĞƌ ŝŶƚĞƌǀŝĞǁƐ͕ǁŽƌŬƐŚŽƉƐǁŝƚŚƉƌŽƉĞƌƚLJŽǁŶĞƌƐŝŶĐůƵĚŝŶŐ ŵŽƚĞůŽǁŶĞƌƐ͕ĂŶĚĂĚĞǀĞůŽƉĞƌƌŽƵŶĚƚĂďůĞ͘ŶŽŶͲ ůŝŶĞĐŽŵƉŽŶĞŶƚŝŶĐůƵĚĞĚĂĚĞĚŝĐĂƚĞĚƉƌŽũĞĐƚǁĞďƉĂŐĞ ĂŶĚǁĞďͲďĂƐĞĚƐƵƌǀĞLJ͘WƵďůŝĐŽƵƚƌĞĂĐŚĂůƐŽŝŶĐůƵĚĞĚ WůĂŶŶŝŶŐŽŵŵŝƐƐŝŽŶĂŶĚŝƚLJŽƵŶĐŝůǁŽƌŬƐŚŽƉƐĂŶĚ ŚĞĂƌŝŶŐƐ͘ 1.4.1 Community Advisory Committee dŚĞ  ƉůĂLJĞĚ ĂŶ ŝŵƉŽƌƚĂŶƚ ƌŽůĞ ŝŶ ƉƌŽǀŝĚŝŶŐ ĨĞĞĚďĂĐŬƚŽƚŚĞƐƉĞĐŝĮĐƉůĂŶƚĞĂŵ͘dŚĞŵĞƚŶŝŶĞ ƟŵĞƐŽǀĞƌƚŚĞĐŽƵƌƐĞŽĨĂLJĞĂƌĂŶĚĂŚĂůĨ;ϮϬϭϱʹϮϬϭϲͿ͘ dŚĞŐƌŽƵƉǁĂƐĞƐƚĂďůŝƐŚĞĚƉƌŝŽƌƚŽĐŽŵŵĞŶĐĞŵĞŶƚ ŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶƉƌŽĐĞƐƐĂŶĚǁĂƐĂůƐŽŝŶǀŽůǀĞĚŝŶ ƐĞůĞĐƟŶŐƚŚĞĐŽŶƐƵůƚĂŶƚƚĞĂŵƚŽĂƐƐŝƐƚƚŚĞŝƚLJǁŝƚŚ ƉƌĞƉĂƌĂƚŝŽŶŽĨƚŚĞWůĂŶ͘ŽŵƉŽƐĞĚŽĨƌĞƐŝĚĞŶƚƐ͕ ƉƌŽƉĞƌƚLJ͕ĂŶĚďƵƐŝŶĞƐƐŽǁŶĞƌƐ͕ĂŶĚĐŽŵŵƵŶŝƚLJĂŶĚ ƌĞůŝŐŝŽƵƐŐƌŽƵƉƌĞƉƌĞƐĞŶƚĂƟǀĞƐ͕ƚŚĞǁĂƐƚĂƐŬĞĚ ǁŝƚŚƉƌŽǀŝĚŝŶŐĨĞĞĚďĂĐŬĂŶĚĐŽŵŵƵŶŝĐĂƟŶŐǁŝƚŚ ƚŚĞŝƌƌĞƐƉĞĐƟǀĞŐƌŽƵƉƐ͘/ŶĂĚĚŝƟŽŶƚŽŵĞĞƟŶŐƐ͕ƚŚĞ ĂůƐŽƉĂƌƟĐŝƉĂƚĞĚŝŶĂŚŽƵƐŝŶŐƚŽƵƌƚŚĂƚƚŽŽŬƚŚĞŵ ƚŚƌŽƵŐŚƐĞǀĞƌĂůŶĞǁƐŝŶŐůĞĂŶĚŵƵůƟͲĨĂŵŝůLJŚŽƵƐŝŶŐ ĚĞǀĞůŽƉŵĞŶƚƐŝŶŶĂŚĞŝŵĂŶĚƐƵƌƌŽƵŶĚŝŶŐĐŝƟĞƐ͘ dŚĞƌĞǀŝĞǁĞĚĞdžŝƐƟŶŐĐŽŶĚŝƟŽŶƐĨŽƌƚŚĞ^W ĂƌĞĂ͕ĂƐƐŝƐƚĞĚŝŶƚŚĞĐƌĞĂƟŽŶŽĨƚŚĞǀŝƐŝŽŶĂŶĚŐƵŝĚŝŶŐ ƉƌŝŶĐŝƉůĞƐ͕ĞdžƉůŽƌĞĚŽƉƟŽŶƐĨŽƌůĂŶĚƵƐĞĐŚĂŶŐĞƐ͕ĂŶĚ ŐĂǀĞĨĞĞĚďĂĐŬƌĞŐĂƌĚŝŶŐƉĞƌŵŝƩĞĚƵƐĞƐ͕ŵŽďŝůŝƚLJ ŽƉƟŽŶƐ͕ĂŶĚƵƌďĂŶĚĞƐŝŐŶŝĚĞĂƐĨŽƌƚŚĞĐŽƌƌŝĚŽƌ͘ EŝŶĞ ŽŵŵƵŶŝƚLJ ĚǀŝƐŽƌLJ ŽŵŵŝƩĞĞ ŵĞĞƟŶŐƐ ǁĞƌĞ ŚĞůĚ ŽǀĞƌ ƚŚĞ ĐŽƵƌƐĞŽĨƚŚĞƉƌŽũĞĐƚ͘ 10 | INTRODUCTION | HEARING DRAFT OCTOBER 2018 >ŽĐĂů ĚĞǀĞůŽƉĞƌƐ ƉĂƌƟĐŝƉĂƚĞĚ ŝŶ Ă ƌŽƵŶĚƚĂďůĞ ĚŝƐĐƵƐƐŝŽŶ ĂďŽƵƚ ŽƉƉŽƌƚƵŶŝƟĞƐ ĂŶĚ ŝƐƐƵĞƐ ĨŽƌ ƚŚĞ ĞĂĐŚ ŽƵůĞǀĂƌĚ ĐŽƌƌŝĚŽƌ͘ 1.4.2 Pop-up Outreach dŚƌŽƵŐŚŽƵƚ ƚŚĞ ^ƉĞĐŝĨŝĐ WůĂŶ ƉƌŽĐĞƐƐ͕ ƚŚĞ ƚĞĂŵ ĞŶŐĂŐĞĚƚŚĞĐŽŵŵƵŶŝƚLJŝŶǀĂƌŝŽƵƐĂĐƟǀŝƟĞƐƌĞůĂƚĞĚƚŽ ƚŚĞŬĞLJƚŽƉŝĐƐĂĚĚƌĞƐƐĞĚďLJƚŚĞWůĂŶ͘WŽƉͲƵƉŽƵƚƌĞĂĐŚ ĞǀĞŶƚƐͶƐĞƫŶŐƵƉĂƚŚŽƌƚĂďůĞĂƚĂŶĞƐƚĂďůŝƐŚĞĚ ĞǀĞŶƚͶƉƌŽǀŝĚĞĚƚŚĞƚĞĂŵƚŚĞŽƉƉŽƌƚƵŶŝƚLJƚŽƌĞĂĐŚ ƚŚĞƉƵďůŝĐǁŚĞŶĂŶĚǁŚĞƌĞƚŚĞĐŽŵŵƵŶŝƚLJƌĞŐƵůĂƌůLJ ŐĂƚŚĞƌƐĂŶĚĂĐƟǀĞůLJƉĂƌƟĐŝƉĂƚĞƐ͘dŚĞƐĞůŽĐĂůĂŶŶƵĂů ĞǀĞŶƚƐŝŶĐůƵĚĞĚĂĐŽŵŵƵŶŝƚLJďĂƌďĞƋƵĞ͕ďĂĐŬͲƚŽͲ ƐĐŚŽŽůŶŝŐŚƚ͕ĂŶĚƚƌĞĞůŝŐŚƟŶŐĐĞƌĞŵŽŶLJ͘ǀĞŶƚĚĂƚĞƐ ĂŶĚůŽĐĂƟŽŶƐĂƌĞŶŽƚĞĚŽŶƚŚĞůĞŌͲŚĂŶĚƐŝĚĞŽĨƚŚŝƐ ƉĂŐĞ͘ 1.4.3 Stakeholder Interviews /ŶĚŝǀŝĚƵĂůƐƚĂŬĞŚŽůĚĞƌŝŶƚĞƌǀŝĞǁƐǁĞƌĞĐŽŶĚƵĐƚĞĚďLJ ƚŚĞƉƌŽũĞĐƚƚĞĂŵĞĂƌůLJŝŶƚŚĞƐƉĞĐŝĮĐƉůĂŶƉƌŽĐĞƐƐ͘ ƵƐŝŶĞƐƐŽǁŶĞƌƐĂŶĚƉƌŽƉĞƌƚLJŽǁŶĞƌƐǁĞƌĞĞŶŐĂŐĞĚ ŝŶĐŽŶǀĞƌƐĂƟŽŶƐƌĞŐĂƌĚŝŶŐƚŚĞŝƌůŽŶŐͲƚĞƌŵƉůĂŶƐĨŽƌ ĐŚĂŶŐĞ͕ŝƐƐƵĞƐĐƵƌƌĞŶƚůLJĂīĞĐƟŶŐďƵƐŝŶĞƐƐ͕ĂŶĚƚŚĞ ŶĞĞĚƐƚŚĞLJƉĞƌĐĞŝǀĞĚĨŽƌƚŚĞƐƵƌƌŽƵŶĚŝŶŐĐŽŵŵƵŶŝƚLJ͘ dŚŝƐŝŶƉƵƚǁĂƐĞƐƉĞĐŝĂůůLJƵƐĞĨƵůůLJĂƐƚŚĞƉƌŽũĞĐƚƚĞĂŵ ŝĚĞŶƟĮĞĚĂƌĞĂƐŽĨĐŚĂŶŐĞǁŝƚŚŝŶƚŚĞ^WĂƌĞĂ͘ 1.4.4 Developer Roundtable dŚĞĚĞǀĞůŽƉĞƌƌŽƵŶĚƚĂďůĞǁĂƐĂŚĂůĨͲĚĂLJŵĞĞƟŶŐŚĞůĚ ǁŝƚŚůŽĐĂůďƵŝůĚĞƌƐ͕ĚĞǀĞůŽƉĞƌƐ͕ĂŶĚŽƚŚĞƌƌĞĂůĞƐƚĂƚĞ ƉƌŽĨĞƐƐŝŽŶĂůƐǁŝƚŚŝŶƚĞƌĞƐƚŝŶƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ ŽƌƌŝĚŽƌ͘dŚĞ^ƉĞĐŝĮĐWůĂŶĐŽŶƐƵůƚĂŶƚƚĞĂŵĨĂĐŝůŝƚĂƚĞĚ ƚŚĞŵĞĞƟŶŐǁŝƚŚŵĞŵďĞƌƐŽĨƚŚĞŝƚLJΖƐWůĂŶŶŝŶŐĂŶĚ ƵŝůĚŝŶŐĞƉĂƌƚŵĞŶƚĂŶĚƌĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵƚŚĞ ĐŝƟĞƐŽĨ^ƚĂŶƚŽŶĂŶĚƵĞŶĂWĂƌŬĂůƐŽŝŶĂƩĞŶĚĂŶĐĞ͘ dŚĞƌŽƵŶĚƚĂďůĞƉƌŽǀŝĚĞĚĂŶŝĚĞĂůĨŽƌƵŵĨŽƌǀĞƐƚĞĚ ŝŶƚĞƌĞƐƚƐƚŽŚĂǀĞĂŶŽƉĞŶĚŝĂůŽŐƵĞǁŝƚŚƚŚĞƉƌŽũĞĐƚ ƚĞĂŵ͕ƉƌŽǀŝĚĞŝŶƉƵƚ͕ĂŶĚĞdžƉƌĞƐƐĐŽŶĐĞƌŶƐĨŽƌĂŶĞǁ ĞĂĐŚŽƵůĞǀĂƌĚ͘/ƚĂůƐŽƉƌŽǀŝĚĞĚĂŶŽƉƉŽƌƚƵŶŝƚLJƚŽ ƉƌŽŵŽƚĞƚŚĞĂŶƟĐŝƉĂƚĞĚĐŚĂŶŐĞƐĂůŽŶŐƚŚĞĞĂĐŚ ŽƵůĞǀĂƌĚĐŽƌƌŝĚŽƌƚŽƚŚĞĚĞǀĞůŽƉŵĞŶƚĐŽŵŵƵŶŝƚLJ͘ 1.4.5 Property and Motel Owner Workshops ŝƚLJƐƚĂīŚĞůĚĂǁŽƌŬƐŚŽƉǁŝƚŚƐĞǀĞƌĂůŽǁŶĞƌƐŽĨ ƉƌŽƉĞƌƚLJŝŶƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͘ƐĞƉĂƌĂƚĞŵĞĞƟŶŐ ǁĂƐĂůƐŽŚĞůĚǁŝƚŚŽŶůLJƚŚĞŽǁŶĞƌƐŽĨŵŽƚĞůƐŝŶƚŚĞ ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͘dŚĞƉƵƌƉŽƐĞŽĨƚŚĞǁŽƌŬƐŚŽƉƐ ǁĂƐƚŽŝŶĨŽƌŵƚŚĞƉƌŽƉĞƌƚLJŽǁŶĞƌƐŽĨƚŚĞƉŽƚĞŶƟĂů ŝŵƉůŝĐĂƟŽŶƐĂŶĚŽƉƉŽƌƚƵŶŝƟĞƐĨŽƌƚŚĞŝƌƉƌŽƉĞƌƟĞƐ ĂŶĚďƵƐŝŶĞƐƐĞƐĂƐĂƌĞƐƵůƚŽĨƚŚĞ^W͘ WKWͳhWKhdZ,sEd^ X ^ĞƉƚĞŵďĞƌϯ͕ϮϬϭϱͮĂĐŬƚŽ^ĐŚŽŽů EŝŐŚƚĂƚdǁŝůĂZĞŝĚůĞŵĞŶƚĂƌLJ School X ĞĐĞŵďĞƌϰ͕ϮϬϭϱͮtĞƐƚŶĂŚĞŝŵ ŶŶƵĂů,ŽůŝĚĂLJdƌĞĞ>ŝŐŚƟŶŐ ĞƌĞŵŽŶLJ X DĂLJϭϰ͕ϮϬϭϲͮtĞƐƚŶĂŚĞŝŵ EĞŝŐŚďŽƌŚŽŽĚĞǀĞůŽƉŵĞŶƚŽƵŶĐŝů ;tEͿŶŶƵĂůtĞƐƚĞƌŶĂƌďĞƋƵĞ HEARING DRAFT OCTOBER 2018| INTRODUCTION | 11 1 ĚĞĚŝĐĂƚĞĚƉƌŽũĞĐƚǁĞďƐŝƚĞŽīĞƌĞĚƉĂƌƟĐŝƉĂŶƚƐƚŚĞŽƉƉŽƌƚƵŶŝƚLJƚŽĂŶƐǁĞƌ ƉŽůůƋƵĞƐƟŽŶƐ͕ƚĂŬĞĂǀŝƌƚƵĂůƚŽƵƌŽĨĞĂĐŚŽƵůĞǀĂƌĚ͕ĂŶĚĐŽŵƉůĞƚĞĂƐƵƌǀĞLJ͘ 1.4.6 Online Engagement ƵƌŝŶŐƚŚĞŝŶŝƟĂůŽƵƚƌĞĂĐŚƉŚĂƐĞŝŶtĞƐƚŶĂŚĞŝŵ͕ ƉƌŝŽƌƚŽŝŶŝƟĂƟŶŐƚŚĞ^ƉĞĐŝĮĐWůĂŶƉƌŽĐĞƐƐ͕ĂĚĞĚŝĐĂƚĞĚ ǁĞďƐŝƚĞǁĂƐĐƌĞĂƚĞĚƚŽĞŶŐĂŐĞƚŚĞĐŽŵŵƵŶŝƚLJĂŶĚŐĞƚ ƚŚĞŝƌĨĞĞĚďĂĐŬŽŶŝƐƐƵĞƐ͘dŚŝƐƚLJƉĞŽĨŽƵƚƌĞĂĐŚǁĂƐ ĞƐƉĞĐŝĂůůLJŚĞůƉĨƵůƚŽƌĞĂĐŚŵĞŵďĞƌƐŽĨƚŚĞĐŽŵŵƵŶŝƚLJ ǁŚŽǁĞƌĞƵŶĂďůĞƚŽĂƩĞŶĚĂĐŽŵŵƵŶŝƚLJǁŽƌŬƐŚŽƉŽƌ ŽƚŚĞƌĞǀĞŶƚ͘dŚĞǁĞďƐŝƚĞ͕ǁǁǁ͘ŝŵƉƌŽǀĞǁĞƐƚĂŶĂŚĞŝŵ͘ ĐŽŵ͕ĞŶŐĂŐĞĚƚŚĞƉƵďůŝĐŝŶƐĞǀĞƌĂůĂĐƟǀŝƟĞƐŝŶĐůƵĚŝŶŐ͗ • WŽůůƋƵĞƐƟŽŶƐ • ƌĞĂŵĂƉ • ǀŝƌƚƵĂůƐŝƚĞƚŽƵƌ • WƌĞĨĞƌĞŶĐĞƐƵƌǀĞLJ • ŶĂƌĞĂĨŽƌƐƵďŵŝƫŶŐŝĚĞĂƐĂŶĚĐŽŵŵĞŶƚƐ ZĞƐƵůƚƐŽĨƚŚĞŽŶͲůŝŶĞƐƵƌǀĞLJƉƌŝŽƌŝƟnjĞĚƚŚĞŬĞLJƚŚĞŵĞƐ ĨƌŽŵƚŚĞŝŶŝƟĂůŽƵƚƌĞĂĐŚƉŚĂƐĞ͘dŚĞĨŽůůŽǁŝŶŐƌĞƐƵůƚƐ ŝŶĨŽƌŵĞĚƚŚĞǀŝƐŝŽŶĂŶĚƉƌŝŽƌŝƟnjĞĚŝŵƉƌŽǀĞŵĞŶƚƐ ŝĚĞŶƟĮĞĚŝŶƚŚĞWůĂŶ͗ • ,ĞĂůƚŚΘ^ĂĨĞƚLJ͗&ŽĐƵƐŽŶŝŵƉƌŽǀŝŶŐƚŚĞ ŚĞĂůƚŚĂŶĚǁĞůĨĂƌĞŽĨŽƵƌƌĞƐŝĚĞŶƚƐ • ŚĂƌĂĐƚĞƌΘWůĂĐĞ͗ƌĞĂƚĞĂƐƚƌŽŶŐĞƌ ĐŽŵŵƵŶŝƚLJŝĚĞŶƟƚLJ • ĐŽŶŽŵLJΘsŝƚĂůŝƚLJ͗/ŶǀĞƐƚƌĞƐŽƵƌĐĞƐŝŶƚŽ ĂƩƌĂĐƟŶŐĂŶĚƐƵƉƉŽƌƟŶŐŶĞǁ͕ĐŽŵŵƵŶŝƚLJͲ ƐĞƌǀŝŶŐďƵƐŝŶĞƐƐĞƐ • DŽďŝůŝƚLJKƉƟŽŶƐ͗WƌŽǀŝĚĞĂƌĂŶŐĞŽĨƐĂĨĞ ŵŽďŝůŝƚLJŽƉƟŽŶƐ ^ƵďƐĞƋƵĞŶƚ ƋƵĞƐƚŝŽŶƐ ĂƐŬĞĚ ƉĂƌƚŝĐŝƉĂŶƚƐ ĂďŽƵƚ ƉŽƐƐŝďůĞŝŵƉƌŽǀĞŵĞŶƚƐĂŶĚĐŚĂŶŐĞƐĨŽƌƚŚĞĂƌĞĂ͘ dŚĞ ƐƵƌǀĞLJ ĐŽŶĐůƵĚĞĚ ǁŝƚŚ ƋƵĞƐƚŝŽŶƐ ƌĞůĂƚĞĚ ƚŽ ĚĞŵŽŐƌĂƉŚŝĐŝŶĨŽƌŵĂƚŝŽŶ͘dŚĞĨƵůůƐĞƚŽĨƐƵƌǀĞLJ ƋƵĞƐƟŽŶƐĂŶĚƌĞƐƵůƚƐĂƌĞƉƌŽǀŝĚĞĚŝŶƉƉĞŶĚŝdž͕ KƵƚƌĞĂĐŚ͘ dŚĞĚĞŵŽŐƌĂƉŚŝĐŝŶĨŽƌŵĂƚŝŽŶĐŽůůĞĐƚĞĚĨƌŽŵƚŚĞ ƐƵƌǀĞLJƌĞƉŽƌƚĞĚƚŚĂƚϯϭƉĞƌĐĞŶƚŽĨƐƵƌǀĞLJƌĞƐƉŽŶĚĞŶƚƐ ǁĞƌĞƵŶĚĞƌƚŚĞĂŐĞŽĨϮϰ͘dŚŝƐŝŶĚŝĐĂƚĞĚƚŽƚŚĞƉƌŽũĞĐƚ ƚĞĂŵƚŚĂƚƚŚĞƌĞǁĂƐĂŶŽƉƉŽƌƚƵŶŝƚLJĨŽƌĂĚĚŝƟŽŶĂů ŽƵƚƌĞĂĐŚƚŽůŽĐĂůLJŽƵƚŚ͘ůƚŚŽƵŐŚĨŽĐƵƐĞĚŽƵƚƌĞĂĐŚ ŽĨƚŚŝƐŶĂƚƵƌĞǁĂƐŶŽƚŽƌŝŐŝŶĂůůLJƉůĂŶŶĞĚĨŽƌƚŚŝƐ ƉƌŽũĞĐƚ͕ƚŚŝƐŝŶĨŽƌŵĂƟŽŶ͕ĐŽƵƉůĞĚǁŝƚŚƚŚĞŵĂƌŬĞƚ ĂŶĂůLJƐŝƐ;ŚĂƉƚĞƌϯͿ͕ƐƉƵƌƌĞĚĂŚŝŐŚƐĐŚŽŽůŽƵƚƌĞĂĐŚ ĐŽŵƉŽŶĞŶƚŽĨƚŚĞƐƉĞĐŝĮĐƉůĂŶƉƌŽĐĞƐƐ͕ĚŝƐĐƵƐƐĞĚ ĨƵƌƚŚĞƌŝŶƐĞĐƟŽŶϭ͘ϰ͘ϲ͕,ŝŐŚ^ĐŚŽŽůKƵƚƌĞĂĐŚ͘ dŚĞ ŝƚLJΖƐ ǁĞďƐŝƚĞ ĂůƐŽ ƉƌŽǀŝĚĞĚ Ă ĚĞĚŝĐĂƚĞĚ ƉƌŽũĞĐƚǁĞďƉĂŐĞǁŝƚŚƉƌŽũĞĐƚƵƉĚĂƚĞƐ͕ŝŶĨŽƌŵĂƟŽŶ͕ ŶŽƚŝĨŝĐĂƚŝŽŶƐ͕ĂŶĚĚĂƚĞƐŽĨĐŽŵŵƵŶŝƚLJŽƵƚƌĞĂĐŚ ĞǀĞŶƚƐ͘ dŚĞ ŝƚLJ ĂůƐŽ ŵĂŝŶƚĂŝŶƐ Ă ǁĞď ƉĂŐĞ ĨŽƌ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ ƚŚƌŽƵŐŚ ƚŚĞ WůĂŶŶŝŶŐ ĞƉĂƌƚŵĞŶƚ ŽŶ ƚŚĞ ŝƚLJ ŽĨ ŶĂŚĞŝŵ ǁĞďƐŝƚĞ͘ 12 | INTRODUCTION | HEARING DRAFT OCTOBER 2018 ,/',^,KK>KhdZ,sEd^ X &ĞďƌƵĂƌLJϮϱ͕ϮϬϭϲͮtĞƐƚĞƌŶ,ŝŐŚ ^ĐŚŽŽů͕W'ŽǀĞƌŶŵĞŶƚĂŶĚĐŽŶŽŵŝĐƐ ůĂƐƐ X DĂƌĐŚϮϰ͕ϮϬϭϲͮ^ĂǀĂŶŶĂ,ŝŐŚ^ĐŚŽŽů͕ W'ŽǀĞƌŶŵĞŶƚůĂƐƐ X ƉƌŝůϮϭ͕ϮϬϭϲͮDĂŐŶŽůŝĂ,ŝŐŚ^ĐŚŽŽů͕ &ƌŝĚĂLJEŝŐŚƚ>ŝǀĞŌĞƌ^ĐŚŽŽůůƵď ^ƚƵĚĞŶƚƐĂƚDĂŐŶŽůŝĂ͕tĞƐƚĞƌŶ͕ĂŶĚ^ĂǀĂŶŶĂŚŝŐŚƐĐŚŽŽůƐ ƉĂƌƟĐŝƉĂƚĞĚ ŝŶ ĂŶ ĂĐƟǀŝƚLJ ƚŽ ĞŶǀŝƐŝŽŶ ŶĞǁ ŽƉƉŽƌƚƵŶŝƟĞƐ ĨŽƌ ƌĞƚĂŝů͕ ƌĞƐŝĚĞŶƟĂů͕ ĂŶĚ ŽĸĐĞ ƐƉĂĐĞ ĂůŽŶŐ ĞĂĐŚ ŽƵůĞǀĂƌĚ͘ 1.4.7 High School Outreach ƐƉĂƌƚŽĨƚŚĞŽƵƚƌĞĂĐŚƉƌŽĐĞƐƐ͕ƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ ^ƉĞĐŝĨŝĐWůĂŶƉƌŽũĞĐƚƚĞĂŵĐŽŶĚƵĐƚĞĚĂƐĞƌŝĞƐŽĨ ǁŽƌŬƐŚŽƉƐĂƚƚŚƌĞĞůŽĐĂůŚŝŐŚƐĐŚŽŽůƐǁŝƚŚƐƚƵĚĞŶƚƐŝŶ ƚŚĞĚǀĂŶĐĞĚWůĂĐĞŵĞŶƚ;WͿŐŽǀĞƌŶŵĞŶƚͬĞĐŽŶŽŵŝĐƐ ĐůĂƐƐĞƐĂŶĚ&ƌŝĚĂLJEŝŐŚƚ>ŝǀĞĂŌĞƌͲƐĐŚŽŽůĐůƵď͘ůů ƚŚƌĞĞŽĨƚŚĞƐĐŚŽŽůƐĂƌĞŝŶƚŚĞtĞƐƚŶĂŚĞŝŵĂƌĞĂ͘dŚĞ ŐŽĂůŽĨƚŚĞŚŝŐŚƐĐŚŽŽůŽƵƚƌĞĂĐŚĞǀĞŶƚƐǁĂƐƚŽƉƌŽǀŝĚĞ ĂŶŽǀĞƌǀŝĞǁŽĨƚŚĞƉƌŽũĞĐƚ͕ŝŶƚƌŽĚƵĐĞƐƚƵĚĞŶƚƐƚŽƚŚĞ ƵƌďĂŶƉůĂŶŶŝŶŐƉƌŽĨĞƐƐŝŽŶ͕ĂŶĚƌĞĐĞŝǀĞĨĞĞĚďĂĐŬĨƌŽŵ ĂƐĞŐŵĞŶƚŽĨƚŚĞƉŽƉƵůĂƟŽŶƵŶĚĞƌƚŚĞĂŐĞŽĨϯϰǁŚŽ ƌĞƉƌĞƐĞŶƚƐŚĂůĨŽĨƚŚĞƉŽƉƵůĂƟŽŶǁŝƚŚŝŶĂŵŝůĞƌĂĚŝƵƐ ŽĨƚŚĞĐŽƌƌŝĚŽƌ͘ ^ƚƵĚĞŶƚƐǁĞƌĞůĞĚƚŚƌŽƵŐŚĂƐŵĂůůͲŐƌŽƵƉĞdžĞƌĐŝƐĞƚŚĂƚ ĂƐŬĞĚƚŚĞŵƚŽĚĞƐŝŐŶĂƐŝƚĞĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ͘ ĂĐŚŐƌŽƵƉǁĂƐŐŝǀĞŶĂďůĂŶŬĐŽŶĐĞƉƚƵĂůƐŝƚĞƉůĂŶ ĂŶĚĂƐŬĞĚƚŽǁŽƌŬƚŽŐĞƚŚĞƌƚŽĚƌĂǁĂŶĚůŝƐƚƚŚĞƚLJƉĞ ŽĨĚĞǀĞůŽƉŵĞŶƚĂŶĚůĂŶĚƵƐĞƐƚŚĞLJǁŽƵůĚůŝŬĞƚŽ ƐĞĞŽŶƚŚĞƐŝƚĞŝŶƚŚĞĨƵƚƵƌĞ͘dŚĞƐĐŚŽŽůƐĂŶĚĚĂƚĞƐ ŽĨĞĂĐŚĞǀĞŶƚĂƌĞƉƌŽǀŝĚĞĚŝŶƚŚĞůĞŌͲŚĂŶĚĐŽůƵŵŶ͘ ĚĚŝƚŝŽŶĂůůLJ͕ ƉƉĞŶĚŝdž ͕ŽŵŵƵŶŝƚLJKƵƚƌĞĂĐŚ ZĞƉŽƌƚ͕ĚŽĐƵŵĞŶƚƐƚŚĞĚŝƐĐƵƐƐŝŽŶĂŶĚŝĚĞĂƐƚŚĂƚ ĞŵĞƌŐĞĚĨƌŽŵƚŚĞŚŝŐŚƐĐŚŽŽůŽƵƚƌĞĂĐŚĞǀĞŶƚƐ͘ 1.4.8 Planning Commission and City Council Study Sessions/Workshops and Public Hearings WĞƌŝŽĚŝĐĂůůLJ ŝƚLJ ƐƚĂĨĨ ĐŽŶĚƵĐƚĞĚ ƐƚƵĚLJ ƐĞƐƐŝŽŶƐ ǁŝƚŚWůĂŶŶŝŶŐŽŵŵŝƐƐŝŽŶĂŶĚŝƚLJŽƵŶĐŝůƚŽďƌŝĞĨ ĚĞĐŝƐŝŽŶŵĂŬĞƌƐĂŶĚƚŚĞŐĞŶĞƌĂůƉƵďůŝĐĂďŽƵƚƚŚĞ ƉƌŽŐƌĞƐƐŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶ͕ƌĞƉŽƌƚŽŶŽƵƚƌĞĂĐŚ ĞīŽƌƚƐ͕ĂŶĚƉƌŽǀŝĚĞĂŶŽǀĞƌǀŝĞǁŽĨƚŚĞǀŝƐŝŽŶĂŶĚ ŐƵŝĚŝŶŐƉƌŝŶĐŝƉůĞƐ͘EŽĂĐƟŽŶǁĂƐƚĂŬĞŶĚƵƌŝŶŐƚŚĞƐĞ ƐĞƐƐŝŽŶƐ͖ƚŚĞŝŶƚĞŶƚǁĂƐƚŽĞƐƚĂďůŝƐŚĨĂŵŝůŝĂƌŝƚLJǁŝƚŚ ƚŚĞƉƌŽũĞĐƚ͘tŽƌŬƐŚŽƉƐǁĞƌĞŚĞůĚŝŶDĂƌĐŚĂŶĚ:ƵŶĞ ŽĨϮϬϭϲ͘ WƵďůŝĐĂĚŽƉƟŽŶŚĞĂƌŝŶŐƐǁĞƌĞƐƵďƐĞƋƵĞŶƚůLJŚĞůĚĨŽƌ ƚŚĞ^ƉĞĐŝĮĐWůĂŶĂŶĚ/ZŝŶKĐƚŽďĞƌĂŶĚEŽǀĞŵďĞƌ ŽĨϮϬϭϴ͘ /dzKhE/>EW>EE/E' COMMISSION WORKSHOPS AND Wh>/,Z/E'^ X DĂƌĐŚϭ͕ϮϬϭϲͮŝƚLJŽƵŶĐŝů X :ƵŶĞϭϯ͕ϮϬϭϲͮWůĂŶŶŝŶŐŽŵŵŝƐƐŝŽŶ X KĐƚŽďĞƌϮϵ͕ϮϬϭϴͮWůĂŶŶŝŶŐŽŵŵŝƐƐŝŽŶ X EŽǀĞŵďĞƌϭϯ͕ϮϬϭϴͮŝƚLJŽƵŶĐŝů HEARING DRAFT OCTOBER 2018| INTRODUCTION | 13 1 1.5 RELATIONSHIP TO OTHER PLANS, PROGRAMS, AGENCIES, AND REGULATIONS dŚŝƐƐĞĐƟŽŶĚĞƐĐƌŝďĞƐƚŚĞƌĞŐƵůĂƚŽƌLJƐĞƫŶŐƌĞůĂƚĞĚƚŽ ƉůĂŶŶŝŶŐĂĐƟǀŝƟĞƐƚŚĂƚǁĞƌĞĐŽŶƐŝĚĞƌĞĚƚŚƌŽƵŐŚŽƵƚ ƚŚĞĐƌĞĂƟŽŶŽĨƚŚĞ^W͘DĂŶLJŽĨƚŚĞƐĞƌĞŐƵůĂƟŽŶƐ ĂŶĚŐƵŝĚŝŶŐĚŽĐƵŵĞŶƚƐĂƌĞƌĞůĂƚĞĚƚŽŵĂŶĚĂƚĞƐƐĞƚƚŽ ƌĞĚƵĐĞŐƌĞĞŶŚŽƵƐĞŐĂƐĞŵŝƐƐŝŽŶƐĂŶĚĂĐŚŝĞǀĞŽƚŚĞƌ ƐƵƐƚĂŝŶĂďŝůŝƚLJŽďũĞĐƟǀĞƐŽĨƚŚĞĂůŝĨŽƌŶŝĂ^ƚƌĂƚĞŐŝĐ 'ƌŽǁƚŚŽƵŶĐŝů;^'Ϳ͘^ŝŶĐĞƚŚŝƐ^ƉĞĐŝĮĐWůĂŶǁĂƐ ĨƵŶĚĞĚƚŚƌŽƵŐŚƚŚĞ^'ΖƐ^ƵƐƚĂŝŶĂďůĞŽŵŵƵŶŝƟĞƐ WůĂŶŶŝŶŐ'ƌĂŶƚĂŶĚ/ŶĐĞŶƚŝǀĞƐWƌŽŐƌĂŵ͕ƚŚĞŬĞLJ ƉŝĞĐĞƐŽĨůĞŐŝƐůĂƟŽŶĚĞƚĂŝůĞĚďĞůŽǁĚĞŵŽŶƐƚƌĂƚĞŚŽǁ ƚŚĞŝƚLJŝƐƌĞƐƉŽŶĚŝŶŐƚŽƚŚĞƐĞůĂǁƐƚŚƌŽƵŐŚůŽĐĂů ƉůĂŶŶŝŶŐĞīŽƌƚƐ͘dŚŝƐƐĞĐƟŽŶŝŶĐůƵĚĞƐĚĞƐĐƌŝƉƟŽŶƐ ŽĨĂƉƉůŝĐĂďůĞƉůĂŶƐ͕ƉƌŽŐƌĂŵƐ͕ĂŶĚƌĞŐƵůĂƟŽŶƐĂƚƚŚĞ ƐƚĂƚĞ͕ƌĞŐŝŽŶĂů͕ĂŶĚůŽĐĂůůĞǀĞůƐ͘ 1.5.1 State ĂĐŚŽĨƚŚĞĂĐƚƐĂŶĚͬŽƌĂŐĞŶĐŝĞƐďĞůŽǁĚĞƐĐƌŝďĞƐƐƚĂƚĞ ůĂǁƐƚŚĂƚŝŵƉĂĐƚůĂŶĚƵƐĞƉůĂŶŶŝŶŐĞīŽƌƚƐŵŽƐƚĐůŽƐĞůLJ ƌĞůĂƚĞĚƚŽƚƌĂŶƐƉŽƌƚĂƟŽŶĂŶĚŚŽƵƐŝŶŐ͘ƐĂƉƉůŝĐĂďůĞ͕ ƚŚĞƉƌŽǀŝƐŝŽŶƐŽĨĞĂĐŚŽĨƚŚĞƐĞůĂǁƐǁĞƌĞĂĚĚƌĞƐƐĞĚŝŶ ƚŚĞĂƉƉƌŽƉƌŝĂƚĞĐŚĂƉƚĞƌŽĨƚŚŝƐ^ƉĞĐŝĮĐWůĂŶ͘ ĂůŝĨŽƌŶŝĂĞƉĂƌƚŵĞŶƚŽĨdƌĂŶƐƉŽƌƚĂƟŽŶ;ĂůƚƌĂŶƐͿ ĂůƚƌĂŶƐŝƐƚŚĞƐƚĂƚĞΖƐƚƌĂŶƐƉŽƌƚĂƟŽŶĂŐĞŶĐLJ͘dŚĞ ĚĞƉĂƌƚŵĞŶƚŵĂŶĂŐĞƐĂůŝĨŽƌŶŝĂΖƐŚŝŐŚǁĂLJĂŶĚĨƌĞĞǁĂLJ ŶĞƚǁŽƌŬ͕ĂƐǁĞůůĂƐŝŶƚĞƌͲĐŝƚLJƌĂŝůĂŶĚƚŚĞƉĞƌŵŝƫŶŐŽĨ ƉƵďůŝĐͲƵƐĞĂŝƌƉŽƌƚƐĂŶĚƐƉĞĐŝĂůƵƐĞŚĞůŝƉŽƌƚƐ͘ĂůƚƌĂŶƐ ǁŽƌŬƐǁŝƚŚůŽĐĂůĂŐĞŶĐŝĞƐƚŽĐĂƌƌLJŽƵƚŝƚƐŵŝƐƐŝŽŶ ŽĨ ΗƉƌŽǀŝĚŝŶŐ Ă ƐĂĨĞ͕ ƐƵƐƚĂŝŶĂďůĞ͕ ŝŶƚĞŐƌĂƚĞĚ ĂŶĚ ĞĸĐŝĞŶƚƚƌĂŶƐƉŽƌƚĂƟŽŶƐLJƐƚĞŵƚŽĞŶŚĂŶĐĞĂůŝĨŽƌŶŝĂΖƐ ĞĐŽŶŽŵLJĂŶĚůŝǀĂďŝůŝƚLJ͘ΗdŚĞŐŽĂůƐŽĨƚŚĞŽƌŐĂŶŝnjĂƟŽŶ ĂƌĞƚŽ͗ • ^ĂĨĞƚLJĂŶĚ,ĞĂůƚŚ͗WƌŽǀŝĚĞĂƐĂĨĞ ƚƌĂŶƐƉŽƌƚĂƟŽŶƐLJƐƚĞŵĨŽƌǁŽƌŬĞƌƐĂŶĚ ƵƐĞƌƐ͕ĂŶĚƉƌŽŵŽƚĞŚĞĂůƚŚƚŚƌŽƵŐŚĂĐƟǀĞ ƚƌĂŶƐƉŽƌƚĂƟŽŶĂŶĚƌĞĚƵĐĞĚƉŽůůƵƟŽŶŝŶ ĐŽŵŵƵŶŝƟĞƐ͘ • ^ƚĞǁĂƌĚƐŚŝƉĂŶĚĸĐŝĞŶĐLJ͗DŽŶĞLJ ĐŽƵŶƚƐ͘ZĞƐƉŽŶƐŝďůLJŵĂŶĂŐĞĂůŝĨŽƌŶŝĂ͛Ɛ ƚƌĂŶƐƉŽƌƚĂƟŽŶͲƌĞůĂƚĞĚĂƐƐĞƚƐ͘ • ^ƵƐƚĂŝŶĂďŝůŝƚLJ͕>ŝǀĂďŝůŝƚLJ͕ĂŶĚĐŽŶŽŵLJ͗DĂŬĞ ůŽŶŐͲůĂƐƟŶŐ͕ƐŵĂƌƚŵŽďŝůŝƚLJĚĞĐŝƐŝŽŶƐƚŚĂƚ ŝŵƉƌŽǀĞƚŚĞĞŶǀŝƌŽŶŵĞŶƚ͕ƐƵƉƉŽƌƚĂǀŝďƌĂŶƚ ĞĐŽŶŽŵLJ͕ĂŶĚďƵŝůĚĐŽŵŵƵŶŝƟĞƐ͕ŶŽƚ ƐƉƌĂǁů͘ • ^LJƐƚĞŵWĞƌĨŽƌŵĂŶĐĞ͗hƟůŝnjĞůĞĂĚĞƌƐŚŝƉ͕ ĐŽůůĂďŽƌĂƟŽŶĂŶĚƐƚƌĂƚĞŐŝĐƉĂƌƚŶĞƌƐŚŝƉƐƚŽ ĚĞǀĞůŽƉĂŶŝŶƚĞŐƌĂƚĞĚƚƌĂŶƐƉŽƌƚĂƟŽŶƐLJƐƚĞŵ ƚŚĂƚƉƌŽǀŝĚĞƐƌĞůŝĂďůĞĂŶĚĂĐĐĞƐƐŝďůĞŵŽďŝůŝƚLJ ĨŽƌƚƌĂǀĞůĞƌƐ͘ • KƌŐĂŶŝnjĂƟŽŶĂůdžĐĞůůĞŶĐĞ͗ĞĂŶĂƟŽŶĂů ůĞĂĚĞƌŝŶĚĞůŝǀĞƌŝŶŐƋƵĂůŝƚLJƐĞƌǀŝĐĞƚŚƌŽƵŐŚ ĞdžĐĞůůĞŶƚĞŵƉůŽLJĞĞƉĞƌĨŽƌŵĂŶĐĞ͕ƉƵďůŝĐ ĐŽŵŵƵŶŝĐĂƟŽŶ͕ĂŶĚĂĐĐŽƵŶƚĂďŝůŝƚLJ͘ California Strategic Growth Council &ŽƌŵĞĚŝŶϮϬϬϴǁŝƚŚƚŚĞƉĂƐƐŝŶŐŽĨ^ĞŶĂƚĞŝůů;^Ϳ ϳϯϮ͕ƚŚĞ^'ĐŽŶƐŝƐƚƐŽĨĂŐĞŶĐLJŵĞŵďĞƌƐĨƌŽŵǀĂƌŝŽƵƐ ƐƚĂƚĞĚĞƉĂƌƚŵĞŶƚƐ͘dŚĞ^'ǁŽƌŬƐƚŽĐŽŽƌĚŝŶĂƚĞĂŶĚ ƉƌŽŵŽƚĞƚŚĞĂĐƟǀŝƟĞƐŽĨƐƚĂƚĞĂŐĞŶĐŝĞƐďLJƉƌŽǀŝĚŝŶŐ ĨƵŶĚŝŶŐ͕ĐŽŽƌĚŝŶĂƟŽŶ͕ĂŶĚŐĞŶĞƌĂůƐƵƉƉŽƌƚƚŽĂĐŚŝĞǀĞ ŽďũĞĐƟǀĞƐƚŚĂƚŝŶĐůƵĚĞ͕ďƵƚĂƌĞŶŽƚůŝŵŝƚĞĚƚŽ͗ • /ŵƉƌŽǀŝŶŐĂŝƌĂŶĚǁĂƚĞƌƋƵĂůŝƚLJ • WƌŽŵŽƟŶŐƉƵďůŝĐŚĞĂůƚŚĂŶĚĞƋƵŝƚLJ • /ŶĐƌĞĂƐŝŶŐŚŽƵƐŝŶŐĂīŽƌĚĂďŝůŝƚLJ • WƌŽŵŽƟŶŐŝŶĮůůĂŶĚĐŽŵƉĂĐƚĚĞǀĞůŽƉŵĞŶƚ • ZĞǀŝƚĂůŝnjŝŶŐƵƌďĂŶĂŶĚĐŽŵŵƵŶŝƚLJĐĞŶƚĞƌƐ • /ŵƉƌŽǀŝŶŐŝŶĨƌĂƐƚƌƵĐƚƵƌĞƐLJƐƚĞŵƐ • WƌŽŵŽƟŶŐĞŶĞƌŐLJĞĸĐŝĞŶĐLJĂŶĚ ĐŽŶƐĞƌǀĂƟŽŶ • ZĞĚƵĐŝŶŐĂƵƚŽŵŽďŝůĞƵƐĂŐĞĂŶĚĨƵĞů ĐŽŶƐƵŵƉƟŽŶ dŚĞ ^' ĂŶĚ ƚŚĞ 'ŽǀĞƌŶŽƌΖƐ KĨĨŝĐĞ ŽĨ WůĂŶŶŝŶŐ ĂŶĚ ZĞƐĞĂƌĐŚ ĐŽŽƌĚŝŶĂƚĞ ƉůĂŶŶŝŶŐ ĂĐƚŝǀŝƚŝĞƐ ƚŚĂƚ ƐƵƉƉŽƌƚ ƐƵƐƚĂŝŶĂďůĞ ĐŽŵŵƵŶŝƚŝĞƐ͕ ĞŵƉŚĂƐŝnjŝŶŐ ƐƚƌŽŶŐĞĐŽŶŽŵŝĞƐ͕ƐŽĐŝĂůĞƋƵŝƚLJ͕ĂŶĚĞŶǀŝƌŽŶŵĞŶƚĂů ƐƚĞǁĂƌĚƐŚŝƉ͘ 'ůŽďĂůtĂƌŵŝŶŐ^ŽůƵƟŽŶƐĐƚ dŚĞ'ůŽďĂůtĂƌŵŝŶŐ^ŽůƵƟŽŶƐĐƚ;ƐƐĞŵďůLJŝůůϯϮͿ ͲϯϮͿŽĨϮϬϬϲǁĂƐƐŝŐŶĞĚŝŶƚŽůĂǁŽŶ^ĞƉƚĞŵďĞƌ Ϯϳ͕ϮϬϬϲ͘ϯϮĞƐƚĂďůŝƐŚĞĚĂĐŽŵƉƌĞŚĞŶƐŝǀĞƉƌŽŐƌĂŵ ƚŽ ƌĞĚƵĐĞ ŐƌĞĞŶŚŽƵƐĞ ŐĂƐ ĞŵŝƐƐŝŽŶƐ ƚŽ ĐŽŵďĂƚ ĐůŝŵĂƚĞĐŚĂŶŐĞ͘dŚŝƐďŝůůƌĞƋƵŝƌĞƐƚŚĞĂůŝĨŽƌŶŝĂŝƌ ZĞƐŽƵƌĐĞƐŽĂƌĚ;ZͿƚŽĚĞǀĞůŽƉƌĞŐƵůĂƟŽŶƐƚŽ ƌĞĚƵĐĞŐƌĞĞŶŚŽƵƐĞŐĂƐĞŵŝƐƐŝŽŶƐƚŽϭϵϵϬůĞǀĞůƐďLJ ϮϬϮϬ͘:ĂŶƵĂƌLJϭ͕ϮϬϭϮƚŚĞŐƌĞĞŶŚŽƵƐĞŐĂƐƌƵůĞƐĂŶĚ ŵĂƌŬĞƚŵĞĐŚĂŶŝƐŵƐĂĚŽƉƚĞĚďLJZƚŽŽŬĞīĞĐƚĂŶĚ ĂƌĞůĞŐĂůůLJĞŶĨŽƌĐĞĂďůĞ͘ 14 | INTRODUCTION | HEARING DRAFT OCTOBER 2018 ƚƌĂŶƐŝƚ͘ dŚĞŽŵƉůĞƚĞ^ƚƌĞĞƚƐĐƚĂůƐŽƌĞƋƵŝƌĞƐĐŝƌĐƵůĂƟŽŶ ĞůĞŵĞŶƚƐ ƚŽ ĐŽŶƐŝĚĞƌ ƚŚĞ ŵƵůƚŝƉůĞ ƵƐĞƌƐ ŽĨ ƚŚĞ ƚƌĂŶƐƉŽƌƚĂƚŝŽŶƐLJƐƚĞŵ͕ŝŶĐůƵĚŝŶŐĐŚŝůĚƌĞŶ͕ĂĚƵůƚƐ͕ ƐĞŶŝŽƌƐ͕ĂŶĚƚŚĞĚŝƐĂďůĞĚ͘ϭϯϱϴƚĂƐŬƐƚŚĞ'ŽǀĞƌŶŽƌ͛Ɛ KĸĐĞŽĨWůĂŶŶŝŶŐĂŶĚZĞƐĞĂƌĐŚƚŽƌĞůĞĂƐĞŐƵŝĚĞůŝŶĞƐ ĨŽƌĐŽŵƉůŝĂŶĐĞ͕ǁŚŝĐŚĂƌĞƐŽĨĂƌƵŶĚĞǀĞůŽƉĞĚ͘ 1.5.2 Regional dŚĞĂƉƉůŝĐĂďůĞƌĞŐŝŽŶĂůĂŐĞŶĐŝĞƐ͕ƉůĂŶƐĂŶĚƉƌŽŐƌĂŵƐ ƚŚĂƚĂůƐŽŚĂǀĞƌĞŐƵůĂƚŽƌLJŽǀĞƌƐŝŐŚƚƚŚĂƚŝŶŇƵĞŶĐĞĚƚŚĞ ĐƌĞĂƟŽŶŽĨƚŚŝƐWůĂŶĂƌĞĚŝƐĐƵƐƐĞĚďĞůŽǁ͘ ^ŽƵƚŚĞƌŶĂůŝĨŽƌŶŝĂƐƐŽĐŝĂƟŽŶŽĨ'ŽǀĞƌŶŵĞŶƚƐ ǀĞƌLJ ĨŽƵƌ LJĞĂƌƐ͕ ƚŚĞ ^ŽƵƚŚĞƌŶ ĂůŝĨŽƌŶŝĂ ƐƐŽĐŝĂƚŝŽŶ ŽĨ 'ŽǀĞƌŶŵĞŶƚƐ ;^'Ϳ ƵƉĚĂƚĞƐ ƚŚĞ ZĞŐŝŽŶĂůdƌĂŶƐƉŽƌƚĂƟŽŶWůĂŶ;ZdWͿĂŶĚ^ƵƐƚĂŝŶĂďůĞ ŽŵŵƵŶŝƟĞƐ^ƚƌĂƚĞŐLJ;^^ͿĂƐƌĞƋƵŝƌĞĚďLJ^ϯϳϱ͘ ^'ΖƐƐŝdžͲĐŽƵŶƚLJƌĞŐŝŽŶŝŶĐůƵĚĞƐ>ŽƐŶŐĞůĞƐ͕^ĂŶ ĞƌŶĂƌĚŝŶŽ͕ZŝǀĞƌƐŝĚĞ͕KƌĂŶŐĞ͕sĞŶƚƵƌĂ͕ĂŶĚ/ŵƉĞƌŝĂů ĐŽƵŶƟĞƐ͘ƵƌƌĞŶƚĂŶĚƌĞĐĞŶƚƚƌĂŶƐƉŽƌƚĂƟŽŶƉůĂŶŐŽĂůƐ ŐĞŶĞƌĂůůLJĨŽĐƵƐŽŶďĂůĂŶĐĞĚƚƌĂŶƐƉŽƌƚĂƟŽŶĂŶĚůĂŶĚ ƵƐĞƉůĂŶŶŝŶŐƚŚĂƚ͗ ϭ͘ DĂdžŝŵŝnjĞƐŵŽďŝůŝƚLJĂŶĚĂĐĐĞƐƐŝďŝůŝƚLJĨŽƌĂůů ƉĞŽƉůĞĂŶĚŐŽŽĚƐŝŶƚŚĞƌĞŐŝŽŶ Ϯ͘ WƌĞƐĞƌǀĞƐĂŶĚĞŶƐƵƌĞƐĂƐƵƐƚĂŝŶĂďůĞƌĞŐŝŽŶĂů ƚƌĂŶƐƉŽƌƚĂƟŽŶƐLJƐƚĞŵ ϯ͘ DĂdžŝŵŝnjĞƐƚŚĞƉƌŽĚƵĐƟǀŝƚLJŽĨŽƵƌ ƚƌĂŶƐƉŽƌƚĂƟŽŶƐLJƐƚĞŵ dŚĞŵŽƐƚƌĞĐĞŶƚZWdͬ^^ǁĂƐĂĚŽƉƚĞĚŝŶϮϬϭϲ͖ ŝŶƚŚĂƚƉůĂŶĞĂĐŚŽƵůĞǀĂƌĚǁĂƐĚĞƐŝŐŶĂƚĞĚĂƐĂ ,ŝŐŚYƵĂůŝƚLJdƌĂŶƐŝƚŽƌƌŝĚŽƌ͘dŚŽƵŐŚŵĂŶLJƉƌŽũĞĐƚƐ ĂƌĞƐĐŚĞĚƵůĞĚƚŚƌŽƵŐŚƚŚĞZdWƚŚƌŽƵŐŚŽƵƚKƌĂŶŐĞ ŽƵŶƚLJ͕ŶŽŶĞŽĨƚŚĞŵĂƌĞǁŝƚŚŝŶƚŚĞ^WĂƌĞĂĨŽƌ ƚŚĞĐƵƌƌĞŶƚƉůĂŶŶŝŶŐĐLJĐůĞ͘ KƌĂŶŐĞŽƵŶƚLJ>ŽŶŐZĂŶŐĞdƌĂŶƐƉŽƌƚĂƟŽŶWůĂŶ KƌĂŶŐĞŽƵŶƚLJdƌĂŶƐƉŽƌƚĂƟŽŶƵƚŚŽƌŝƚLJΖƐϮϬϭϴ>ŽŶŐ ZĂŶŐĞdƌĂŶƐƉŽƌƚĂƟŽŶWůĂŶĨŽƌKƌĂŶŐĞŽƵŶƚLJƉůĂĐĞƐ ĂŶĞŵƉŚĂƐŝƐŽŶĨƌĞĞǁĂLJŝŶƚĞƌĐŚĂŶŐĞŝŵƉƌŽǀĞŵĞŶƚƐ͕ ŚŝŐŚŽĐĐƵƉĂŶĐLJǀĞŚŝĐůĞ;,KsͿĂĐĐĞƐƐ͕ƉƌŝĐĞͲŵĂŶĂŐĞĚ ĨĂĐŝůŝƚŝĞƐ;ƚŽůůƐͬĞdžƉƌĞƐƐůĂŶĞƐͿ͕ĂŶĚƌĞŐŝŽŶĂůƚƌĂĨĨŝĐ ƐŝŐŶĂůƐLJŶĐŚƌŽŶŝnjĂƟŽŶŽĨĂƌƚĞƌŝĂůƐ͘ĚĚŝƟŽŶĂůůLJ͕ƚŚĞ ŽƵŶƚLJƉůĂŶƐƚŽĞŶĐŽƵƌĂŐĞĐĂƌƉŽŽůŝŶŐďLJŝŵƉƌŽǀŝŶŐ ,KsͲƚŽͲ,KsĐŽŶŶĞĐƚŽƌƐ͘dŚĞŽƵŶƚLJƉůĂŶƐƚŽƵƐĞ DĞĂƐƵƌĞDϮĨƵŶĚƐƚŽĮŶĂŶĐĞƚŚĞƐĞƉƌŽũĞĐƚƐƚŚƌŽƵŐŚ ϮϬϯϱ͘ dŚĞƌĞĚƵĐƟŽŶŐŽĂůĨŽƌϮϬϮϬŝƐƚŽƌĞĚƵĐĞŐƌĞĞŶŚŽƵƐĞ ŐĂƐĞŵŝƐƐŝŽŶƐďLJϮϱƉĞƌĐĞŶƚŽĨƚŚĞĐƵƌƌĞŶƚƌĂƚĞŝŶ ŽƌĚĞƌƚŽŵĞĞƚϭϵϵϬƐůĞǀĞů͕ĂŶĚĂƌĞĚƵĐƟŽŶŽĨϴϬ ƉĞƌĐĞŶƚŽĨĐƵƌƌĞŶƚƌĂƚĞƐďLJϮϬϱϬ͘dŚĞϯϮ^ĐŽƉŝŶŐ WůĂŶĐŽŶƚĂŝŶƐƚŚĞŵĂŝŶƐƚƌĂƚĞŐŝĞƐĂůŝĨŽƌŶŝĂǁŝůůƵƐĞ ƚŽƌĞĚƵĐĞŐƌĞĞŶŚŽƵƐĞŐĂƐĞƐ͘dŚĞƐĐŽƉŝŶŐƉůĂŶŚĂƐ ĂƌĂŶŐĞŽĨŐƌĞĞŶŚŽƵƐĞŐĂƐƌĞĚƵĐƟŽŶĂĐƟŽŶƐǁŚŝĐŚ ŝŶĐůƵĚĞĚŝƌĞĐƚƌĞŐƵůĂƟŽŶƐ͕ĂůƚĞƌŶĂƟǀĞĐŽŵƉůŝĂŶĐĞ ŵĞĐŚĂŶŝƐŵƐ͕ŵŽŶĞƚĂƌLJĂŶĚŶŽŶͲŵŽŶĞƚĂƌLJŝŶĐĞŶƟǀĞƐ͕ ǀŽůƵŶƚĂƌLJĂĐƟŽŶƐ͕ŵĂƌŬĞƚͲďĂƐĞĚŵĞĐŚĂŶŝƐŵƐƐƵĐŚ ĂƐĂĐĂƉͲĂŶĚͲƚƌĂĚĞƐLJƐƚĞŵ͕ĂŶĚĂŶϯϮƉƌŽŐƌĂŵ ŝŵƉůĞŵĞŶƚĂƟŽŶƌĞŐƵůĂƟŽŶƚŽĨƵŶĚƚŚĞƉƌŽŐƌĂŵ͘ ^ƵƐƚĂŝŶĂďůĞŽŵŵƵŶŝƟĞƐĂŶĚůŝŵĂƚĞWƌŽƚĞĐƟŽŶĐƚ dŚĞ^ƵƐƚĂŝŶĂďůĞŽŵŵƵŶŝƟĞƐĂŶĚůŝŵĂƚĞWƌŽƚĞĐƟŽŶ Đƚ;^ϯϳϱͿŽĨϮϬϬϴƉƌŽǀŝĚĞƐŝŶĐĞŶƟǀĞƐĨŽƌĐŝƟĞƐĂŶĚ ĚĞǀĞůŽƉĞƌƐƚŽďƌŝŶŐŚŽƵƐŝŶŐĂŶĚũŽďƐĐůŽƐĞƌƚŽŐĞƚŚĞƌ ĂŶĚƚŽŝŵƉƌŽǀĞƉƵďůŝĐƚƌĂŶƐŝƚ͘dŚĞŐŽĂůďĞŚŝŶĚ^ϯϳϱ ŝƐƚŽƌĞĚƵĐĞĂƵƚŽŵŽďŝůĞĐŽŵŵƵƟŶŐƚƌŝƉƐĂŶĚƚŚĞ ůĞŶŐƚŚŽĨĂƵƚŽŵŽďŝůĞƚƌŝƉƐ͕ƚŚƵƐŚĞůƉŝŶŐƚŽŵĞĞƚ ƚŚĞƐƚĂƚĞǁŝĚĞƚĂƌŐĞƚƐĨŽƌƌĞĚƵĐŝŶŐŐƌĞĞŶŚŽƵƐĞŐĂƐ ĞŵŝƐƐŝŽŶƐƐĞƚďLJϯϮ͘ ^ϯϳϱ ƌĞƋƵŝƌĞƐ ĞĂĐŚ ŵĞƚƌŽƉŽůŝƚĂŶ ƉůĂŶŶŝŶŐ ŽƌŐĂŶŝnjĂƚŝŽŶƚŽĂĚĚĂďƌŽĂĚĞƌǀŝƐŝŽŶĨŽƌŐƌŽǁƚŚ͕ ĐĂůůĞĚĂ͞^ƵƐƚĂŝŶĂďůĞŽŵŵƵŶŝƟĞƐ^ƚƌĂƚĞŐLJ͟;^^Ϳ͕ ƚŽŝƚƐƚƌĂŶƐƉŽƌƚĂƟŽŶƉůĂŶ͘dŚĞ^^ŵƵƐƚůĂLJŽƵƚĂ ƉůĂŶƚŽŵĞĞƚƚŚĞƌĞŐŝŽŶ͛ƐƚƌĂŶƐƉŽƌƚĂƟŽŶ͕ŚŽƵƐŝŶŐ͕ ĞĐŽŶŽŵŝĐ͕ĂŶĚĞŶǀŝƌŽŶŵĞŶƚĂůŶĞĞĚƐŝŶĂǁĂLJƚŚĂƚ ĞŶĂďůĞƐƚŚĞĂƌĞĂƚŽůŽǁĞƌŐƌĞĞŶŚŽƵƐĞŐĂƐĞŵŝƐƐŝŽŶƐ͘ dŚĞ^^ƐŚŽƵůĚŝŶƚĞŐƌĂƚĞƚƌĂŶƐƉŽƌƚĂƟŽŶ͕ůĂŶĚͲƵƐĞ͕ ĂŶĚŚŽƵƐŝŶŐƉŽůŝĐŝĞƐƚŽƉůĂŶĨŽƌĂĐŚŝĞǀĞŵĞŶƚŽĨ ƚŚĞĞŵŝƐƐŝŽŶƐƚĂƌŐĞƚĨŽƌƚŚĞŝƌƌĞŐŝŽŶ͘dŚĞ^ŽƵƚŚĞƌŶ ĂůŝĨŽƌŶŝĂƐƐŽĐŝĂƟŽŶŽĨ'ŽǀĞƌŶŵĞŶƚƐΖZdWĂŶĚ^^ ǁĞƌĞĂĚŽƉƚĞĚŝŶϮϬϭϲ;ĨƵƌƚŚĞƌĚŝƐĐƵƐƐĞĚŝŶ^ĞĐƟŽŶ ϭ͘ϱ͘Ϯ͕ZĞŐŝŽŶĂů͕ďĞůŽǁͿ͘ ƐĂƌĞƐƵůƚŽĨƚŚĞƐƚĂƚĞƌĞŐƵůĂƚŽƌLJƐĞƫŶŐĚĞƐĐƌŝďĞĚ ĂďŽǀĞ͕ƚŚŝƐ^ƉĞĐŝĮĐWůĂŶŝĚĞŶƟĮĞƐŽƉƉŽƌƚƵŶŝƟĞƐƚŽ ƌĞĚƵĐĞŐƌĞĞŶŚŽƵƐĞŐĂƐĞŵŝƐƐŝŽŶƐǁŝƚŚŝŶƚŚĞ^W ĂƌĞĂ͘ California Complete Streets Act dŚĞ ĂůŝĨŽƌŶŝĂ ŽŵƉůĞƚĞ ^ƚƌĞĞƚƐ Đƚ ;ϭϯϱϴͿ ŽĨ ϮϬϬϴƌĞƋƵŝƌĞƐĐŝƌĐƵůĂƟŽŶĞůĞŵĞŶƚƐƚŽĂĚĚƌĞƐƐƚŚĞ ƚƌĂŶƐƉŽƌƚĂƟŽŶƐLJƐƚĞŵĨƌŽŵĂŵƵůƟͲŵŽĚĂůƉĞƌƐƉĞĐƟǀĞ͘ dŚĞďŝůůƐƚĂƚĞƐƚŚĂƚƐƚƌĞĞƚƐ͕ƌŽĂĚƐ͕ĂŶĚŚŝŐŚǁĂLJƐŵƵƐƚ ͞ŵĞĞƚƚŚĞŶĞĞĚƐŽĨĂůůƵƐĞƌƐŝŶĂŵĂŶŶĞƌƐƵŝƚĂďůĞƚŽ ƚŚĞƌƵƌĂů͕ƐƵďƵƌďĂŶ͕ŽƌƵƌďĂŶĐŽŶƚĞdžƚŽĨƚŚĞŐĞŶĞƌĂů ƉůĂŶ͘͟ƐƐĞŶƚŝĂůůLJ͕ƚŚŝƐďŝůůƌĞƋƵŝƌĞƐĂĐŝƌĐƵůĂƚŝŽŶ ĞůĞŵĞŶƚƚŽƉůĂŶĨŽƌĂůůŵŽĚĞƐŽĨƚƌĂŶƐƉŽƌƚĂƟŽŶǁŚĞƌĞ ĂƉƉƌŽƉƌŝĂƚĞ͕ŝŶĐůƵĚŝŶŐǁĂůŬŝŶŐ͕ďŝŬŝŶŐ͕ĐĂƌƚƌĂǀĞů͕ĂŶĚ HEARING DRAFT OCTOBER 2018| INTRODUCTION | 15 1 KƌĂŶŐĞŽƵŶƚLJŽŶŐĞƐƟŽŶDĂŶĂŐĞŵĞŶƚWƌŽŐƌĂŵ /ŶϮϬϭϳ͕KƌĂŶŐĞŽƵŶƚLJdƌĂŶƐƉŽƌƚĂƚŝŽŶƵƚŚŽƌŝƚLJ ;KdͿƵƉĚĂƚĞĚŝƚƐŽŶŐĞƐƟŽŶDĂŶĂŐĞŵĞŶƚWƌŽŐƌĂŵ ;DWͿ ƚŽ ĂƐƐĞƐƐ ƚŚĞ ŽǀĞƌĂůů ƉĞƌĨŽƌŵĂŶĐĞ ŽĨ ƚŚĞ ŚŝŐŚǁĂLJƐLJƐƚĞŵ͕ǁŚŝĐŚƉƌŽǀŝĚĞƐĚĞĐŝƐŝŽŶŵĂŬĞƌƐ ƋƵĂŶƟƚĂƟǀĞŝŶƉƵƚĨŽƌĨƵŶĚŝŶŐŝŵƉƌŽǀĞŵĞŶƚƐĂŶĚ ƉƌŽŐƌĂŵƐ͘ dŚĞ KƌĂŶŐĞ ŽƵŶƚLJ DW ŶŽƚĞƐ ŵĂũŽƌ ĂƌƚĞƌŝĂůƐĂŶĚĂƐƐĞƐƐĞƐƚŚĞŝƌĐŽŶŐĞƐƟŽŶ͘dŚĞƐĞĂƌƚĞƌŝĂůƐ ŝŶĐůƵĚĞĞĂĐŚŽƵůĞǀĂƌĚ͘ Kd͛ƐƚƌĂĨĨŝĐĐŽŶŐĞƐƚŝŽŶŵĂŶĂŐĞŵĞŶƚƉŽůŝĐLJŝƐ ŝŶƚĞŶĚĞĚƚŽĚĞƚĞƌŵŝŶĞĂƉƉƌŽƉƌŝĂƚĞƚƌĂŶƐƉŽƌƚĂƟŽŶ ƉůĂŶŶŝŶŐĂĐƟŽŶƐŝŶƌĞƐƉŽŶƐĞƚŽĂƉĂƌƟĐƵůĂƌůĞǀĞůŽĨ ƐĞƌǀŝĐĞ;>K^Ϳ͘ƐĂƌĞƐƵůƚ͕ĂŶŝŶƚĞƌƐĞĐƟŽŶ͛ƐƌĞĂĐŚŝŶŐ ĂƉĂƌƟĐƵůĂƌ>K^ĚŽĞƐŶŽƚŶĞĐĞƐƐĂƌŝůLJŝŶĚŝĐĂƚĞƚŚĂƚ ŶŽĂĚĚŝƟŽŶĂůĚĞǀĞůŽƉŵĞŶƚĐĂŶďĞƐƵƉƉŽƌƚĞĚĂƚŽƌ ĂƌŽƵŶĚƚŚĂƚŝŶƚĞƌƐĞĐƟŽŶ͘/ŶƐƚĞĂĚ͕ƚŚĞůŽĐĂůĂŐĞŶĐLJ ǁŝůůŶĞĞĚƚŽƌĞƐƉŽŶĚƚŽŝŶƚĞƌƐĞĐƟŽŶ>K^ǁŝƚŚĂƚŚƌĞĞͲ ƟĞƌĞĚĂƉƉƌŽĂĐŚŽƌŝĞŶƚĞĚƚŽ͗ ϭ͘ DĂŶĂŐŝŶŐƐƉĞĞĚƐĂŶĚŵŽƚŽƌŝƐƚďĞŚĂǀŝŽƌĂƚ ŝŶƚĞƌƐĞĐƟŽŶƐǁŝƚŚŚŝŐŚ>K^ Ϯ͘ ZĞǀŝĞǁŝŶŐƚƌĂĸĐŐƌŽǁƚŚƉĂƩĞƌŶƐǁŚĞŶ ĐŽŶŐĞƐƟŽŶďĞŐŝŶƐƚŽĂƉƉĞĂƌĂŶĚƉůĂŶŶŝŶŐ ĨŽƌĂƉƉƌŽƉƌŝĂƚĞǁĂLJƐƚŽĂĚĚƌĞƐƐĂĚĚŝƟŽŶĂů ĐŽŶŐĞƐƟŽŶ ϯ͘ dĂŬŝŶŐƐƚĞƉƐƚŽŵĂŶĂŐĞĐŽŶŐĞƐƟŽŶ͕ŝŶĐůƵĚŝŶŐ ŵŽǀŝŶŐĨƌŽŵŝŶƚĞƌƐĞĐƟŽŶͲƐƉĞĐŝĮĐŵĞƚƌŝĐƐƚŽ >K^ĨŽƌĂŶĞŶƟƌĞĐŽƌƌŝĚŽƌ tŝƚŚŝŶƚŚĞ^WĂƌĞĂ͕ĞĂĐŚŽƵůĞǀĂƌĚŝƐƚŚĞŽŶůLJ ĚĞƐŝŐŶĂƚĞĚDWĨĂĐŝůŝƚLJ͘&ŽƵƌŶĞĂƌďLJDWŝŶƚĞƌƐĞĐƟŽŶƐ ǁĞƌĞĂůƐŽĂŶĂůLJnjĞĚĂƐĂƉĂƌƚŽĨƚŚĞŶǀŝƌŽŶŵĞŶƚĂů /ŵƉĂĐƚZĞƉŽƌƚĨŽƌƚŚŝƐ^ƉĞĐŝĮĐWůĂŶ͘ Orange County Transit Master Plan/ OC Transit Vision dŚĞKƌĂŶŐĞŽƵŶƚLJdƌĂŶƐƉŽƌƚĂƟŽŶƵƚŚŽƌŝƚLJ;KdͿ ƌĞĐĞŶƚůLJĚĞǀĞůŽƉĞĚĂĐŽŵƉƌĞŚĞŶƐŝǀĞdƌĂŶƐŝƚDĂƐƚĞƌ WůĂŶ;dDWͿĨŽƌKƌĂŶŐĞŽƵŶƚLJ͕ƚŚĞĚŽĐƵŵĞŶƚŝƐ ĂůƐŽƌĞĨĞƌƌĞĚƚŽĂƐKdƌĂŶƐŝƚsŝƐŝŽŶ͘dŚĞdDWŝƐ ĂŶŝŶƚĞŐƌĂƚĞĚďƵƐ͕ƌĂŝů͕ĂŶĚƉĂƌĂͲƚƌĂŶƐŝƚƉůĂŶƚŚĂƚ ƉƌŽǀŝĚĞƐŚŝŐŚͲůĞǀĞůŝŶƐŝŐŚƚŝŶƚŽƚŚĞŽƵŶƚLJΖƐůŽŶŐͲ ƚĞƌŵƚƌĂŶƐŝƚŶĞĞĚƐ͕ŚŝŐŚůŝŐŚƚƐŝŵƉŽƌƚĂŶƚĐŽŶŶĞĐƟŽŶƐ ƚŽŽƚŚĞƌƚƌĂŶƐŝƚƉƌŽũĞĐƚƐ͕ĂŶĚŝĚĞŶƟĮĞƐŽƉƉŽƌƚƵŶŝƚLJ ĐŽƌƌŝĚŽƌƐƚŚĂƚŵĂLJŵĞƌŝƚŝŶǀĞƐƚŵĞŶƚŝŶŚŝŐŚͲƋƵĂůŝƚLJ ƚƌĂŶƐŝƚƐĞƌǀŝĐĞ͕ƐƵĐŚĂƐƐƚƌĞĞƚĐĂƌƐŽƌďƵƐƌĂƉŝĚƚƌĂŶƐŝƚ͘ KdƌĂŶƐŝƚsŝƐŝŽŶŝƐĂϮϬͲLJĞĂƌƉůĂŶĨŽƌĞŶŚĂŶĐŝŶŐ ĂŶĚĞdžƉĂŶĚŝŶŐƉƵďůŝĐƚƌĂŶƐŝƚƐĞƌǀŝĐĞ͕ŝƚƐǀŝƐŝŽŶŝƐƚŽ ΗƉƌŽǀŝĚĞĐŽŵƉĞůůŝŶŐĂŶĚĐŽŵƉĞƟƟǀĞƚƌĂŶƐŝƚƐĞƌǀŝĐĞ ƚŚĂƚĞdžƉĂŶĚƐƚƌĂŶƐƉŽƌƚĂƟŽŶĐŚŽŝĐĞƐĨŽƌĐƵƌƌĞŶƚƌŝĚĞƌƐ͕ RELEVANT OC TRANSIT VISION MODE DEFINITIONS X ZĂƉŝĚƵƐ͗^ĞƌǀŝĐĞŝƐƐŝŵŝůĂƌƚŽƚŚĞ ĞdžŝƐƟŶŐƌĂǀŽ͊ƐĞƌǀŝĐĞ͕ŽƉĞƌĂƟŶŐŝŶ ŵŝdžĞĚƚƌĂĸĐďƵƚŝƐĚŝƐƟŶŐƵŝƐŚĞĚĨƌŽŵ ƌĞŐƵůĂƌďƵƐƐĞƌǀŝĐĞďLJĂůŝŵŝƚĞĚŶƵŵďĞƌ ŽĨƐƚŽƉƐ͕ŵĂŬŝŶŐƐĞƌǀŝĐĞĨĂƐƚĞƌĂŶĚŵŽƌĞ ƌĞůŝĂďůĞ͖ŝƚŵĂLJĂůƐŽŝŶĐůƵĚĞĐƵƐƚŽŵ ďƌĂŶĚŝŶŐ͕ƚƌĂŶƐŝƚƉƌŝŽƌŝƚLJĂƚƚƌĂĸĐ ƐŝŐŶĂůƐĂŶĚŽƚŚĞƌĨĞĂƚƵƌĞƐ͘ X ƵƐZĂƉŝĚdƌĂŶƐŝƚ͗^ĞƌǀŝĐĞǁŚĞƌĞĂ ŵĂũŽƌŝƚLJŽĨƚŚĞůŝŶĞŽƉĞƌĂƚĞƐŝŶĂ ƐĞƉĂƌĂƚĞĚƌŝŐŚƚͲŽĨͲǁĂLJĚĞĚŝĐĂƚĞĚĨŽƌ ƉƵďůŝĐƚƌĂŶƐƉŽƌƚĂƟŽŶƵƐĞĚƵƌŝŶŐƉĞĂŬ ƉĞƌŝŽĚƐĂŶĚŝŶĐůƵĚĞƐĨĞĂƚƵƌĞƐƚŚĂƚ ĞŵƵůĂƚĞƚŚĞƐĞƌǀŝĐĞƐƉƌŽǀŝĚĞĚďLJƌĂŝů ŽƌĮdžĞĚŐƵŝĚĞͲǁĂLJƚƌĂŶƐŝƚƐLJƐƚĞŵƐ͕ ŝŶĐůƵĚŝŶŐĚĞĮŶĞĚƐƚĂƟŽŶƐ͖ƚƌĂŶƐŝƚƐŝŐŶĂů ƉƌŝŽƌŝƚLJ͖ŚŝŐŚͲĨƌĞƋƵĞŶĐLJďŝĚŝƌĞĐƟŽŶĂů ƐĞƌǀŝĐĞƐĨŽƌĂƐƵďƐƚĂŶƟĂůƉĂƌƚŽĨ ǁĞĞŬĚĂLJƐĂŶĚǁĞĞŬĞŶĚĚĂLJƐ͕ƉƌĞͲďŽĂƌĚ ƟĐŬĞƟŶŐ͕ƉůĂƞŽƌŵůĞǀĞůďŽĂƌĚŝŶŐ͕ĂŶĚ ƐĞƉĂƌĂƚĞďƌĂŶĚŝŶŐ͘ ĂƩƌĂĐƚƐŶĞǁƌŝĚĞƌƐ͕ĂŶĚĞƋƵŝƚĂďůLJƐƵƉƉŽƌƚƐŝŵŵĞĚŝĂƚĞ ĂŶĚůŽŶŐͲƚĞƌŵŵŽďŝůŝƚLJŝŶKƌĂŶŐĞŽƵŶƚLJΗ͘ dƌĂŶƐŝƚKƉƉŽƌƚƵŶŝƚLJŽƌƌŝĚŽƌƐ͗dŚĞWůĂŶŝĚĞŶƟĮĞƐĂ ƚŽƚĂůŽĨƚĞŶĐŽƌƌŝĚŽƌƐĨŽƌĨƵƚƵƌĞŝŶǀĞƐƚŵĞŶƚŝŶƌĂŝůŽƌďƵƐ ƌĂƉŝĚƚƌĂŶƐŝƚƐĞƌǀŝĐĞ͘dǁŽŽĨƚŚĞŽƉƉŽƌƚƵŶŝƚLJĐŽƌƌŝĚŽƌƐ ĂƌĞůŽĐĂƚĞĚǁŝƚŚŝŶƚŚĞ^WĂƌĞĂ͘dŚĞĮƌƐƚƐƉĂŶƐƚŚĞ ůĞŶŐƚŚŽĨĞĂĐŚŽƵůĞǀĂƌĚĨƌŽŵƚŚĞ&ƵůůĞƌƚŽŶWĂƌŬĂŶĚ ZŝĚĞƚŽŽǁŶƚŽǁŶ,ƵŶƟŶŐƚŽŶĞĂĐŚ͕ĂŶĚƚŚĞƐĞĐŽŶĚ ƌƵŶƐĂůŽŶŐ>ŝŶĐŽůŶǀĞŶƵĞͬ>ĂWĂůŵĂǀĞŶƵĞ͕ŝŶĐůƵĚŝŶŐ ƚŚĞ>ŝŶĐŽůŶǀĞŶƵĞŝŶƚĞƌƐĞĐƟŽŶĂƚĞĂĐŚŽƵůĞǀĂƌĚ͘ dŚĞĞĂĐŚŽƵůĞǀĂƌĚƐĞŐŵĞŶƚŚĂƐďĞĞŶŝĚĞŶƟĮĞĚĨŽƌ ƵƐZĂƉŝĚdƌĂŶƐŝƚĂŶĚĂƌĂƉŝĚďƵƐůŝŶĞǁĂƐŝĚĞŶƟĮĞĚĨŽƌ >ŝŶĐŽůŶǀĞŶƵĞ͘ 16 | INTRODUCTION | HEARING DRAFT OCTOBER 2018 ŶĂŚĞŝŵΖƐ ŝĐLJĐůĞ DĂƐƚĞƌ WůĂŶ ǁĂƐ ĂĚŽƉƚĞĚ ŝŶ ϮϬϭϳ͘  dŚĞ DĂƐƚĞƌ WůĂŶ ŐƵŝĚĞƐ ƚŚĞ ŝŵƉůĞŵĞŶƚĂƟŽŶ ŽĨ ĐŝƚLJǁŝĚĞ ďŝŬĞǁĂLJƐ͘ 1.5.3 Local ĚĚŝƟŽŶĂůůLJ͕ŽƚŚĞƌŝƚLJƌĞŐƵůĂƚŽƌLJĚŽĐƵŵĞŶƚƐĂīĞĐƚ ĚĞǀĞůŽƉŵĞŶƚǁŝƚŚŝŶƚŚĞ^WĂƌĞĂ͘&ŽůůŽǁŝŶŐŝƐĂďƌŝĞĨ ŽǀĞƌǀŝĞǁŽĨĂƉƉůŝĐĂďůĞŝƚLJĚŽĐƵŵĞŶƚƐ͘ ZĞůĂƟŽŶƐŚŝƉƚŽƚŚĞ'ĞŶĞƌĂůWůĂŶ dŚĞ^WŝƐĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞŐŽĂůƐĂŶĚƉŽůŝĐŝĞƐŽĨ ƚŚĞŝƚLJŽĨŶĂŚĞŝŵΖƐ'ĞŶĞƌĂůWůĂŶ͘dŚĞĞŶǀŝƌŽŶŵĞŶƚĂů ĚŽĐƵŵĞŶƚĂƟŽŶ;W/ZͿƚŚĂƚĂĐĐŽŵƉĂŶŝĞƐƚŚŝƐ^ƉĞĐŝĮĐ WůĂŶŝŶĐůƵĚĞƐĂĚŝƐĐƵƐƐŝŽŶŽĨĞĂĐŚŽĨƚŚĞĂƉƉůŝĐĂďůĞ 'ĞŶĞƌĂůWůĂŶůĞŵĞŶƚΖƐŐŽĂůƐĂŶĚƉŽůŝĐŝĞƐ͕ĂŶĚŚŽǁ ƚŚĞLJĂƌĞŝŵƉůĞŵĞŶƚĞĚƚŚƌŽƵŐŚƚŚĞ^W͘ ZĞůĂƟŽŶƐŚŝƉƚŽƚŚĞŽŶŝŶŐKƌĚŝŶĂŶĐĞ dŚŝƐ^ƉĞĐŝĮĐWůĂŶĚĞĮŶĞƐƌĞŐƵůĂƟŽŶƐĂŶĚĚĞǀĞůŽƉŵĞŶƚ ƐƚĂŶĚĂƌĚƐƚŚĂƚĂƉƉůLJƚŽƚŚĞ^WĂƌĞĂ͘tŚĞŶĂƐƉĞĐŝĮĐ ƉůĂŶŝƐĂĚŽƉƚĞĚďLJŽƌĚŝŶĂŶĐĞ͕ƚŚĞƉůĂŶĞīĞĐƟǀĞůLJ ƌĞƉůĂĐĞƐƉŽƌƟŽŶƐŽƌĂůůŽĨƚŚĞĐƵƌƌĞŶƚnjŽŶŝŶŐĐŽĚĞĨŽƌ ĂƐƉĞĐŝĮĞĚĂƌĞĂĂŶĚďĞĐŽŵĞƐĂŶŝŶĚĞƉĞŶĚĞŶƚƐĞƚŽĨ ƌĞŐƵůĂƟŽŶƐ͘dŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶŚĂƐ ďĞĞŶĂĚŽƉƚĞĚďLJŽƌĚŝŶĂŶĐĞĂŶĚŝƐƚŚĞnjŽŶŝŶŐĨŽƌƚŚĞ ƉƌŽũĞĐƚĂƌĞĂ͘tŚĞƌĞƚŚŝƐ^ƉĞĐŝĮĐWůĂŶŝƐƐŝůĞŶƚ͕ƚŚĞ ƌĞůĞǀĂŶƚƐĞĐƟŽŶƐĂŶĚƌĞƋƵŝƌĞŵĞŶƚƐŽĨdŝƚůĞϭϴ͕ŽŶŝŶŐ KƌĚŝŶĂŶĐĞ͕ŽĨƚŚĞŶĂŚĞŝŵDƵŶŝĐŝƉĂůŽĚĞƐŚĂůůĂƉƉůLJ͘ City of Anaheim Bicycle Master Plan dŚĞŝƚLJΖƐϮϬϭϳŝĐLJĐůĞDĂƐƚĞƌWůĂŶ;DWͿŝƐĂƉŽůŝĐLJ ĚŽĐƵŵĞŶƚƚŚĂƚŐƵŝĚĞƐŝŵƉůĞŵĞŶƚĂƟŽŶŽĨĐŝƚLJǁŝĚĞ ďŝŬĞǁĂLJƐ͘/ƚŝƐŝŶƚĞŶĚĞĚƚŽŝŵƉƌŽǀĞďŝĐLJĐůŝŶŐƐĂĨĞƚLJ͕ ĐŽŵĨŽƌƚ͕ĂŶĚĂĐĐĞƐƐŝďŝůŝƚLJ͘dŚĞDWŝĚĞŶƚŝĨŝĞƐĂ ŶĞƚǁŽƌŬŽĨĞdžŝƐƟŶŐĂŶĚƉƌŽƉŽƐĞĚďŝŬĞǁĂLJƐƚŚĂƚǁŝůů ŝŵƉƌŽǀĞŵƵůƟͲŵŽĚĂůĐŽŶŶĞĐƟǀŝƚLJĂŶĚŝŶĐƌĞĂƐĞďŝĐLJĐůĞ ƵƐĞ͘dŚĞDWƉƌŽƉŽƐĞƐĂŶĞƚǁŽƌŬŽĨŽŶͲƐƚƌĞĞƚďŝŬĞ ůĂŶĞƐĂŶĚƌŽƵƚĞƐĂŶĚŽīͲƐƚƌĞĞƚďŝŬĞƉĂƚŚƐƚŽĐŽŶŶĞĐƚ ƌĞƐŝĚĞŶƚƐ͕ǀŝƐŝƚŽƌƐ͕ĂŶĚǁŽƌŬĞƌƐƚŽƚŚĞŝƌĚĞƐƟŶĂƟŽŶƐ͘ &ŽƌƚŚĞ^WĂƌĞĂ͕ƚŚĞDWŝĚĞŶƟĮĞƐĞdžŝƐƟŶŐĂŶĚ ŶĞǁŽŶͲƐƚƌĞĞƚĐŽŶŶĞĐƟŽŶŽŶĂůůƚŚƌĞĞŽĨƚŚĞĐƌŽƐƐͲ ƐƚƌĞĞƚƐƚŽĞĂĐŚŽƵůĞǀĂƌĚ͗>ŝŶĐŽůŶǀĞŶƵĞ͕KƌĂŶŐĞ ǀĞŶƵĞ͕ĂŶĚĂůůZŽĂĚ͘/ƚĂůƐŽƉƌŽƉŽƐĞƐĐŽŶŶĞĐƟŶŐ ĂŶŽīͲƐƚƌĞĞƚƉĂƚŚĂůŽŶŐĂƌďŽŶƌĞĞŬ͘'ŝǀĞŶƚŚĞŚŝŐŚ ƐƉĞĞĚƐŽŶĞĂĐŚŽƵůĞǀĂƌĚ͕ƚŚĞDWĚŽĞƐŶŽƚŝĚĞŶƟĨLJ ďŝŬĞǁĂLJƐŽŶƚŚŝƐĐŽƌƌŝĚŽƌ͘^ĞĞDŽďŝůŝƚLJŝŶŚĂƉƚĞƌϰ ĨŽƌŵŽƌĞŝŶĨŽƌŵĂƟŽŶƌĞŐĂƌĚŝŶŐďŝĐLJĐůĞĨĂĐŝůŝƟĞƐŝŶƚŚĞ ^WĂƌĞĂ͘ tŝƚŚŝŶƚŚĞ^WĂƌĞĂ͕ƚŚĞDWƉƌŽƉŽƐĞƐĂŶĞdžƚĞŶƐŝŽŶ ŽĨƚŚĞtĞƐƚŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌdƌĂŝů͘hƐŝŶŐƚŚĞ ĞdžŝƐƟŶŐKƌĂŶŐĞŽƵŶƚLJ&ůŽŽĚŽŶƚƌŽůŝƐƚƌŝĐƚĐŚĂŶŶĞů͕ ƚŚĞĞdžƚĞŶƐŝŽŶǁŽƵůĚĐŽŶŶĞĐƚƚŚĞĞdžŝƐƟŶŐzŽƵƚŚĞŶƚĞƌ ƚƌĂŝůĨƌŽŵĞĂĐŚŽƵůĞǀĂƌĚĞĂƐƚĂůŽŶŐĂƌďŽŶƌĞĞŬ HEARING DRAFT OCTOBER 2018| INTRODUCTION | 17 1 dŚĞ ŝƚLJΖƐ ƋƵĂůŝƚLJ ƌĞŶƚĂů ŚŽƵƐŝŶŐ ƉƌŽŐƌĂŵ ĂƐŬƐ ƉƌŽƉĞƌƚLJ ŽǁŶĞƌƐ ƚŽ ƉƌŽĂĐƟǀĞůLJ ŝĚĞŶƟĨLJ ĂŶĚ ďƌŝŶŐ ƐƵďƐƚĂŶĚĂƌĚ ĐŽŶĚŝƟŽŶƐ ŝŶƚŽ ĐŽŵƉůŝĂŶĐĞ ǁŝƚŚ ƚŚĞ ŝƚLJΖƐ ďƵŝůĚŝŶŐ ĐŽĚĞ͘ ŚĂŶŶĞů͕^ĐŚǁĞŝƚnjĞƌWĂƌŬ͕ĂŶĚĂĐƌŽƐƐĂůĞǀĞŶƵĞ ĮŶĂůůLJƚĞƌŵŝŶĂƟŶŐĂƚĂƉŽƐƐŝďůĞĚĞŵŽŶƐƚƌĂƟŽŶƐŝƚĞ ĂĚũĂĐĞŶƚƚŽ>ŝŶĐŽůŶǀĞŶƵĞ͘WŽƐƐŝďůĞŝŵƉƌŽǀĞŵĞŶƚƐ ŝŶĐůƵĚĞĂďŝŬĞƉĂƚŚĂŶĚĂĚĚŝƟŽŶĂůĞŶŚĂŶĐĞŵĞŶƚƐƚŽ ĐƌĞĂƚĞĂΗƐĂĨĞƌŽƵƚĞƚŽƐĐŚŽŽůΗ͘ Quality Rental Housing and Motel Properties Program ĚŽƉƚĞĚďLJŽƌĚŝŶĂŶĐĞŝŶϮϬϭϰ͕ƚŚŝƐŝƚLJǁŝĚĞĐŽĚĞ ĞŶĨŽƌĐĞŵĞŶƚƉƌŽŐƌĂŵǁĂƐĚĞǀĞůŽƉĞĚƚŽĞŶƐƵƌĞƚŚĂƚ ĞǀĞƌLJŽŶĞŝŶƚŚĞŝƚLJŚĂƐĂƐĂĨĞĂŶĚƐĞĐƵƌĞŚŽŵĞ͘dŚĞ ƉƌŽŐƌĂŵƌĞƋƵŝƌĞƐƉƌŽƉĞƌƚLJŽǁŶĞƌƐƚŽƉƌŽͲĂĐƟǀĞůLJ ŝĚĞŶƟĨLJĂŶĚďƌŝŶŐƐƵďƐƚĂŶĚĂƌĚĐŽŶĚŝƟŽŶƐŽŶŵƵůƟͲ ĨĂŵŝůLJƌĞƐŝĚĞŶƟĂůŚŽƵƐŝŶŐƉƌŽƉĞƌƚLJŝŶƚŽĐŽŵƉůŝĂŶĐĞ ǁŝƚŚƐƚĂƚĞĂŶĚůŽĐĂůďƵŝůĚŝŶŐĂŶĚŚŽƵƐŝŶŐůĂǁƐĂŶĚͬ ŽƌǁŝƚŚŵĂŝŶƚĞŶĂŶĐĞƐƚĂŶĚĂƌĚƐĞƐƚĂďůŝƐŚĞĚďLJƚŚĞ ƉƌŽŐƌĂŵ͘/ŶϮϬϭϳ͕ƚŚĞƉƌŽŐƌĂŵǁĂƐĞdžƉĂŶĚĞĚƚŽ ŝŶĐůƵĚĞƌĞƐŝĚĞŶƟĂůŵŽƚĞůƉƌŽƉĞƌƟĞƐǁŝƚŚůŽŶŐͲƚĞƌŵ ƐƚĂLJŐƵĞƐƚƐ;ϯϬĚĂLJƐŽƌůŽŶŐĞƌͿ͘dŚĞƉƌŽŐƌĂŵĂĚĚƌĞƐƐĞƐ ŝŶƚĞƌŝŽƌĂŶĚĞdžƚĞƌŝŽƌŝƐƐƵĞƐƐƵĐŚĂƐďƌŽŬĞŶǁŝŶĚŽǁƐ ĂŶĚĚŽŽƌƐ͕ůĂŶĚƐĐĂƉŝŶŐ͕ďƌŽŬĞŶƉŝƉĞƐ͕ƵŶƉĞƌŵŝƩĞĚ ƌŽŽŵĂĚĚŝƟŽŶƐ͕ĞƚĐ͘ƉƌŽƉĞƌƚLJŽǁŶĞƌ͛ƐĨĂŝůƵƌĞƚŽ ĐŽŵƉůLJǁŝƚŚƚŚĞƉƌŽŐƌĂŵĐŽƵůĚƌĞƐƵůƚŝŶĮŶĞƐ͕ĂƐ ǁĞůů ĂƐ ĐƌŝŵŝŶĂů ƉƌŽƐĞĐƵƚŝŽŶ͘ ŽĚĞ ĞŶĨŽƌĐĞŵĞŶƚ ŽĨĨŝĐĞƌƐƌĞůLJŽŶƚŚŝƐƉƌŽŐƌĂŵƚŽĞŶĨŽƌĐĞŚŽƵƐŝŶŐ ƐƚĂŶĚĂƌĚƐƚŚƌŽƵŐŚŽƵƚƚŚĞŝƚLJĂŶĚtĞƐƚŶĂŚĞŝŵ͘ dŚĞŽĚĞŶĨŽƌĐĞŵĞŶƚŝǀŝƐŝŽŶĐŽůůĂďŽƌĂƚĞƐǁŝƚŚƚŚĞ ŝƚLJ͛ƐWŽůŝĐĞĞƉĂƌƚŵĞŶƚĂŶĚWůĂŶŶŝŶŐĂŶĚƵŝůĚŝŶŐ ĞƉĂƌƚŵĞŶƚƚŽĂƉƉƌŽƉƌŝĂƚĞůLJĂĚĚƌĞƐƐŝƐƐƵĞƐ͘ Anaheim Long Range Property Management Plan dŚĞŝƚLJŽĨŶĂŚĞŝŵĂĚŽƉƚĞĚĂŶĚƐƵďŵŝƩĞĚƚŽƚŚĞƐƚĂƚĞ ŝƚƐ>ŽŶŐZĂŶŐĞWƌŽƉĞƌƚLJDĂŶĂŐĞŵĞŶƚWůĂŶŝŶϮϬϭϯƚŽ ŐƵŝĚĞƌĞŵĂŝŶŝŶŐƉƌŽƉĞƌƟĞƐŽǁŶĞĚďLJƚŚĞŝƚLJ͛ƐĨŽƌŵĞƌ ƌĞĚĞǀĞůŽƉŵĞŶƚĂŐĞŶĐLJ͘tŝƚŚŝŶƚŚĞƉƌŽũĞĐƚĂƌĞĂ͕ƚŚŝƐ ĚŽĐƵŵĞŶƚĚĞƐĐƌŝďĞƐƚŚĞĚŝƐƉŽƐŝƟŽŶŽĨƚŚĞtĞƐƚŐĂƚĞ ƐŝƚĞĂƚƚŚĞĐŽƌŶĞƌŽĨ>ŝŶĐŽůŶǀĞŶƵĞĂŶĚĞĂĐŚ ŽƵůĞǀĂƌĚ͘dŚĞtĞƐƚŐĂƚĞƉƌŽƉĞƌƚLJŝƐĂƉƉƌŽdžŝŵĂƚĞůLJ ϮϱĂĐƌĞƐ͘WĂƌĐĞůƐǁĞƌĞĐŽŶƐŽůŝĚĂƚĞĚƚŽĐƌĞĂƚĞƚŚĞƐŝƚĞ͖ ƉƌĞǀŝŽƵƐƵƐĞƐŽŶƚŚŽƐĞƉĂƌĐĞůƐĐŽŶƐŝƐƚĞĚŽĨƌĞƚĂŝůͬ ĐŽŵŵĞƌĐŝĂů͕ŵŽďŝůĞŚŽŵĞƉĂƌŬ͕ĂŶĚůĂŶĚĮůů͘dŚĞƐŝƚĞ ŝƐŶŽǁƉƌŽƉŽƐĞĚƚŽƌĞĚĞǀĞůŽƉǁŝƚŚƌĞƚĂŝůͬĐŽŵŵĞƌĐŝĂů ĂŶĚƌĞƐŝĚĞŶƟĂůƵƐĞƐͶƉƌŽƉŽƐĞĚƚĞŶĂŶƚƐĐŽƵůĚŝŶĐůƵĚĞ ĂŐƌŽĐĞƌLJƐƚŽƌĞ͕ƌĞƐƚĂƵƌĂŶƚƐ͕ŚŽƚĞů͕ĂŶĚŵĂŝŶƐƚƌĞĞƚ ƉĂƐĞŽ͕ƉƵďůŝĐƉůĂnjĂ͕ĂŶĚŵƵůƟƉůĞͲĨĂŵŝůLJŚŽƵƐŝŶŐ͘/Ŷ ϮϬϭϱƚŚĞŝƚLJƌĞĐĞŝǀĞĚĮŶĂůĂƉƉƌŽǀĂůĨƌŽŵƚŚĞƐƚĂƚĞ ƚŽŵŽǀĞĨŽƌǁĂƌĚǁŝƚŚĚŝƐƉŽƐŝƟŽŶŽĨƚŚŝƐƉƌŽƉĞƌƚLJ͘ 18 | INTRODUCTION | HEARING DRAFT OCTOBER 2018 1.6 ENVIRONMENTAL CLEARANCE dŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶǁĂƐĂĚŽƉƚĞĚŝŶ ĐŽŵƉůŝĂŶĐĞǁŝƚŚƚŚĞƌĞƋƵŝƌĞŵĞŶƚƐŽĨƚŚĞĂůŝĨŽƌŶŝĂ ŶǀŝƌŽŶŵĞŶƚĂůYƵĂůŝƚLJĐƚ;YͿ;ĂůŝĨŽƌŶŝĂWƵďůŝĐ ZĞƐŽƵƌĐĞƐŽĚĞ͕ΑΑϮϭϬϬϬĞƚƐĞƋ͘Ϳ͘WƵƌƐƵĂŶƚƚŽ ƚŚĞY'ƵŝĚĞůŝŶĞƐ;dŝƚůĞϭϰ͕ĂůŝĨŽƌŶŝĂŽĚĞŽĨ ZĞŐƵůĂƟŽŶƐ͕ŚĂƉƚĞƌϯ͕ΑΑϭϱϬϬϬĞƚƐĞƋ͘Ϳ͕ƚŚĞŝƚLJ ŽĨŶĂŚĞŝŵƉƌĞƉĂƌĞĚĂŶ/ŶŝƟĂů^ƚƵĚLJĂŶĚEŽƟĐĞŽĨ WƌĞƉĂƌĂƟŽŶĂŶĚŵĂĚĞƚŚĞƐĞĚŽĐƵŵĞŶƚƐĂǀĂŝůĂďůĞƚŽ ƌĞƐƉŽŶƐŝďůĞĂŐĞŶĐŝĞƐ͕ƚƌƵƐƚĞĞĂŐĞŶĐŝĞƐ͕ĂŶĚŝŶƚĞƌĞƐƚĞĚ ƉĂƌƚŝĞƐĨŽƌĂϯϬͲĚĂLJƉƵďůŝĐƌĞǀŝĞǁƉĞƌŝŽĚ͕ǁŚŝĐŚ ĞdžƚĞŶĚĞĚĨƌŽŵƉƌŝůϭϯ͕ϮϬϭϳƚŚƌŽƵŐŚDĂLJϭϮ͕ϮϬϭϳ͘ dŚƌŽƵŐŚƚŚĞ/ŶŝƟĂů^ƚƵĚLJ͕ƚŚĞŝƚLJĚĞƚĞƌŵŝŶĞĚƚŚĂƚ ŝŵƉůĞŵĞŶƚĂƟŽŶŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶĐŽƵůĚƌĞƐƵůƚŝŶ ƉŽƚĞŶƟĂůůLJƐŝŐŶŝĮĐĂŶƚĞŶǀŝƌŽŶŵĞŶƚĂůŝŵƉĂĐƚƐĂŶĚƚŚĂƚ ƚŚĞƉƌĞƉĂƌĂƟŽŶŽĨĂWƌŽŐƌĂŵĞŶǀŝƌŽŶŵĞŶƚĂůŝŵƉĂĐƚ ƌĞƉŽƌƚ;W/ZͿǁĂƐƌĞƋƵŝƌĞĚ͘ dŚĞĞŶǀŝƌŽŶŵĞŶƚĂůĚŽĐƵŵĞŶƚĂƟŽŶĨŽƌƚŚĞ^WŝƐ ĂW/Z;^ƚĂƚĞůĞĂƌŝŶŐŚŽƵƐĞEŽ͘ϬϭϳϬϰϭϬϰϮͿ͘hƐĞ ŽĨĂW/ZƉƌŽǀŝĚĞƐƚŚĞŝƚLJŽĨŶĂŚĞŝŵǁŝƚŚƚŚĞ ŽƉƉŽƌƚƵŶŝƚLJƚŽĐŽŶƐŝĚĞƌďƌŽĂĚƉŽůŝĐLJĂůƚĞƌŶĂƟǀĞƐĂŶĚ ƉƌŽŐƌĂŵǁŝĚĞŵŝƟŐĂƟŽŶŵĞĂƐƵƌĞƐ͘/ƚĂůƐŽƉƌŽǀŝĚĞƐ ƚŚĞŝƚLJǁŝƚŚŐƌĞĂƚĞƌŇĞdžŝďŝůŝƚLJƚŽĂĚĚƌĞƐƐƉƌŽũĞĐƚͲ ƐƉĞĐŝĮĐĂŶĚĐƵŵƵůĂƟǀĞĞŶǀŝƌŽŶŵĞŶƚĂůŝŵƉĂĐƚƐ͘ ŐĞŶĐŝĞƐƚLJƉŝĐĂůůLJƉƌĞƉĂƌĞW/ZƐĨŽƌƉƌŽŐƌĂŵƐŽƌ ƐĞƌŝĞƐŽĨƌĞůĂƚĞĚĂĐƟŽŶƚŚĂƚĂƌĞůŝŶŬĞĚŐĞŽŐƌĂƉŚŝĐĂůůLJ͖ ĂƌĞůŽŐŝĐĂůƉĂƌƚƐŽĨĂĐŚĂŝŶŽĨĐŽŶƚĞŵƉůĂƚĞĚĞǀĞŶƚƐ͕ ƌƵůĞƐ͕ƌĞŐƵůĂƟŽŶƐ͕ŽƌƉůĂŶƐƚŚĂƚŐŽǀĞƌŶƚŚĞĐŽŶĚƵĐƚ ŽĨĂĐŽŶƟŶƵŝŶŐƉƌŽŐƌĂŵ͖ŽƌĂƌĞŝŶĚŝǀŝĚƵĂůĂĐƟǀŝƟĞƐ ĐĂƌƌŝĞĚŽƵƚƵŶĚĞƌƚŚĞƐĂŵĞĂƵƚŚŽƌŝƚLJĂŶĚŚĂǀŝŶŐ ŐĞŶĞƌĂůůLJƐŝŵŝůĂƌĞŶǀŝƌŽŶŵĞŶƚĂůĞīĞĐƚƐƚŚĂƚĐĂŶďĞ ŵŝƟŐĂƚĞĚŝŶƐŝŵŝůĂƌǁĂLJƐ͘ dŚĞ W/Z ƉƌĞƉĂƌĞĚ ĨŽƌ ƚŚĞ ^W ŵĞĞƚƐ ƚŚĞ ƌĞƋƵŝƌĞŵĞŶƚƐŽĨΑϭϱϭϲϴŽĨƚŚĞY'ƵŝĚĞůŝŶĞƐ͕ĂŶĚ ƐƵďƐĞƋƵĞŶƚƉƌŽũĞĐƚƐƚŚĂƚĂƌĞǁŝƚŚŝŶƚŚĞƐĐŽƉĞŽĨƚŚŝƐ /ZŵĂLJďĞƐƵďũĞĐƚƚŽĂŵŽƌĞůŝŵŝƚĞĚĞŶǀŝƌŽŶŵĞŶƚĂů ƌĞǀŝĞǁƉƌŽĐĞƐƐ͕ĂƐŐƵŝĚĞĚďLJƚŚĞƉƌŽǀŝƐŝŽŶƐŽĨY͘ dŚŝƐĂƉƉƌŽĂĐŚŝƐĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞƟĞƌŝŶŐƉƌŽǀŝƐŝŽŶ ŝŶĂůŝĨŽƌŶŝĂWƵďůŝĐZĞƐŽƵƌĐĞƐŽĚĞΑϮϭϬϴϯ͘ϯĂŶĚ Y'ƵŝĚĞůŝŶĞƐΑϭϱϭϴϯĨŽƌΗWƌŽũĞĐƚƐĐŽŶƐŝƐƚĞŶƚ ǁŝƚŚĂŽŵŵƵŶŝƚLJWůĂŶ͕'ĞŶĞƌĂůWůĂŶŽƌŽŶŝŶŐ͘ΗdŚŝƐ ƟĞƌŝŶŐŽƉƉŽƌƚƵŶŝƚLJŝƐŽŶůLJĂǀĂŝůĂďůĞĨŽƌƉůĂŶƐ;Ğ͘Ő͕͘ ƐƉĞĐŝĮĐƉůĂŶͿĨŽƌǁŚŝĐŚĂŶ/ZŚĂƐďĞĞŶƉƌĞƉĂƌĞĚ͘ dŝĞƌŝŶŐ ƵŶĚĞƌ ƚŚĞƐĞ ƉƌŽǀŝƐŝŽŶƐ ǁŝůů ƌĞƋƵŝƌĞ ĞŶǀŝƌŽŶŵĞŶƚĂů ƌĞǀŝĞǁ ĂŶĚ ĚŽĐƵŵĞŶƚĂƚŝŽŶ ƚŽ ƐƵďƐƚĂŶƚŝĂƚĞƚŚĂƚĂƐƵďƐĞƋƵĞŶƚƉƌŽũĞĐƚĚŽĞƐŶŽƚ ƌĞƐƵůƚŝŶĂŶLJŶĞǁƉŽƚĞŶƟĂůůLJƐŝŐŶŝĮĐĂŶƚŝŵƉĂĐƚƐ͘^ƵĐŚ ƌĞǀŝĞǁ;ƵŶĚĞƌϮϭϬϴϯ͘ϯͬϭϱϬϴϯͿĐŽƵůĚďĞĚŽĐƵŵĞŶƚĞĚ ŝŶƚŚĞĨŽƌŵŽĨĂŶŝŶŝƟĂůƐƚƵĚLJƚŽĞŶƐƵƌĞƚŽƉŝĐͲďLJͲƚŽƉŝĐ ƌĞǀŝĞǁĂŶĚ ƐƵďƐƚĂŶƚŝĂƚŝŽŶ͘KŶĐĞĐŽŶƐŝƐƚĞŶĐLJ ŚĂƐ ďĞĞŶƐƵďƐƚĂŶƟĂƚĞĚĂŶĚƌĞǀŝĞǁƐŚŽǁƐƚŚĂƚƚŚĞƉƌŽũĞĐƚ ǁŽƵůĚŶŽƚƌĞƐƵůƚŝŶŶĞǁƐŝŐŶŝĮĐĂŶƚŝŵƉĂĐƚƐ͕ŶĞŝƚŚĞƌ ĂŵŝƟŐĂƚĞĚŶĞŐĂƟǀĞĚĞĐůĂƌĂƟŽŶŶŽƌĂŶ/ZǁŽƵůĚ ďĞƌĞƋƵŝƌĞĚ͘DŽƌĞŝŶĨŽƌŵĂƟŽŶƌĞůĂƚĞĚƚŽ/ZƟĞƌŝŶŐ ĂŶĚYƌĞƋƵŝƌĞŵĞŶƚƐĂƌĞƉƌŽǀŝĚĞĚŝŶŚĂƉƚĞƌϱ͕ ĚŵŝŶŝƐƚƌĂƟŽŶĂŶĚ/ŵƉůĞŵĞŶƚĂƟŽŶ͘ /ŶĂĚĚŝƟŽŶƚŽĂŵŽƌĞůŝŵŝƚĞĚƌĞǀŝĞǁƉƌŽĐĞƐƐ͕ŝŶĮůů ĂŶĚƚƌĂŶƐŝƚͲŽƌŝĞŶƚĞĚŝŶĮůůƉƌŽũĞĐƚƐŵĂLJƋƵĂůŝĨLJĨŽƌ ƐƚƌĞĂŵůŝŶĞĚĞŶǀŝƌŽŶŵĞŶƚĂůƌĞǀŝĞǁ͘Y'ƵŝĚĞůŝŶĞƐ Αϭϱϭϴϯ͘ϯĂůůŽǁƐĞůŝŐŝďůĞƉƌŽũĞĐƚƐƚŽƐƚƌĞĂŵůŝŶĞƚŚĞ ĞŶǀŝƌŽŶŵĞŶƚĂůƌĞǀŝĞǁƉƌŽĐĞƐƐďLJůŝŵŝƟŶŐƚŚĞƚŽƉŝĐƐ ƐƵďũĞĐƚƚŽƌĞǀŝĞǁĂƚƚŚĞƉƌŽũĞĐƚůĞǀĞů͘WƵďůŝĐZĞƐŽƵƌĐĞƐ ŽĚĞ ΑΑ ϮϭϬϵϵ ĂŶĚ Ϯϭϭϱϱ͘ϰ ĂůƐŽ ůŝŵŝƚ ƌĞǀŝĞǁ ŽĨ ĞŶǀŝƌŽŶŵĞŶƚĂůƚŽƉŝĐƐĂŶĚĞdžĞŵƉƚĐĞƌƚĂŝŶƚLJƉĞƐŽĨ ƉƌŽũĞĐƚƐ͘ CHAPTER 2: THEMES, VISION, + PRINCIPLES 20 | VISION | HEARING DRAFT OCTOBER 2018 dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 | VISION | 21 2 dŚƌŽƵŐŚŽƵƚƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶŽƵƚƌĞĂĐŚƉŚĂƐĞƐĞǀĞƌĂůŬĞLJƚŚĞŵĞƐĞŵĞƌŐĞĚ͘dŚĞƐĞƚŚĞŵĞƐŚĂǀĞ ďĞĞŶĐĂƌƌŝĞĚƚŚƌŽƵŐŚŽƵƚƚŚĞ^ƉĞĐŝĮĐWůĂŶĂŶĚĂƌĞĚĞŶŽƚĞĚďLJƚŚĞĨŽůůŽǁŝŶŐŝĐŽŶƐ͘ ,ĞĂůƚŚΘ^ĂĨĞƚLJ͗&ŽĐƵƐŽŶŝŵƉƌŽǀŝŶŐƚŚĞŚĞĂůƚŚĂŶĚǁĞůĨĂƌĞŽĨŽƵƌƌĞƐŝĚĞŶƚƐ͘ ŚĂƌĂĐƚĞƌΘWůĂĐĞ͗ƌĞĂƚĞĂƐƚƌŽŶŐĞƌĐŽŵŵƵŶŝƚLJŝĚĞŶƟƚLJƚŚƌŽƵŐŚĚŝǀĞƌƐĞƉůĂĐĞŵĂŬŝŶŐƐƚƌĂƚĞŐŝĞƐ͘ ĐŽŶŽŵLJΘsŝƚĂůŝƚLJ͗/ŶǀĞƐƚƌĞƐŽƵƌĐĞƐƚŽĂƩƌĂĐƚŶĞǁ͕ĐŽŵŵƵŶŝƚLJͲƐĞƌǀŝŶŐďƵƐŝŶĞƐƐĞƐ͘ DŽďŝůŝƚLJKƉƟŽŶƐ͗WƌŽǀŝĚĞǀŝĂďůĞŵŽďŝůŝƚLJŽƉƟŽŶƐĨŽƌĂůů͘ 2.1 KEY THEMES 2 THEMES, VISION, + GUIDING PRINCIPLES dŚĞ<ĞLJdŚĞŵĞƐ͕sŝƐŝŽŶ͕ĂŶĚ'ƵŝĚŝŶŐWƌŝŶĐŝƉůĞƐƉƌĞƐĞŶƚĞĚŝŶƚŚŝƐĐŚĂƉƚĞƌǁĞƌĞĚĞǀĞůŽƉĞĚǁŝƚŚŝŶƉƵƚĨƌŽŵƚŚĞ ĐŽŵŵƵŶŝƚLJƚŚƌŽƵŐŚŽƵƚƚŚĞŽƵƚƌĞĂĐŚƉŚĂƐĞŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶƉƌŽĐĞƐƐ͘dŚĞLJĂƌĞƚŚĞĨŽƵŶĚĂƟŽŶŽĨƚŚĞWůĂŶ ĂŶĚŶŽƚŽŶůLJŚĞůƉƚŽŐƵŝĚĞƚŚĞĐƌĞĂƟŽŶŽĨƚŚĞWůĂŶďƵƚǁŝůůĐŽŶƟŶƵĞƚŽŐƵŝĚĞĨƵƚƵƌĞůĂŶĚƵƐĞĚĞĐŝƐŝŽŶƐĂŶĚ ĚĞǀĞůŽƉŵĞŶƚĂůŽŶŐƚŚĞĞĂĐŚŽƵůĞǀĂƌĚĐŽƌƌŝĚŽƌĨŽƌLJĞĂƌƐƚŽĐŽŵĞ͘ 22 | VISION | HEARING DRAFT OCTOBER 2018 HEARING DRAFT OCTOBER 2018 | VISION | 23 2 dŚŝƐŝƐĂǀŝƐŝŽŶĨŽƌŚŽǁƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶĂƌĞĂǁŝůůůŽŽŬϮϱLJĞĂƌƐĨƌŽŵŶŽǁ͘dŚĞĐŚĂŶŐĞƐĂƌĞ ĞdžƉĞĐƚĞĚƚŽƚĂŬĞƉůĂĐĞŽǀĞƌƚŚĞŶĞdžƚϮϱLJĞĂƌƐ͕ǁŝƚŚŬĞLJŝŵƉƌŽǀĞŵĞŶƚƐƉƌŝŽƌŝƟnjĞĚĨŽƌĞĂƌůLJĂĐƟŽŶ͘ dŚĞĞĂĐŚŽƵůĞǀĂƌĚĐŽƌƌŝĚŽƌĂƌĞĂŝƐƚŚĞŚĞĂƌƚŽĨtĞƐƚŶĂŚĞŝŵ͘/ƚŝƐƐĂĨĞ͕ĂƩƌĂĐƟǀĞ͕ĂŶĚĞĐŽŶŽŵŝĐĂůůLJ ƚŚƌŝǀŝŶŐ͘/ƚŝƐďŽƚŚĂĚĞƐƟŶĂƟŽŶĂŶĚĂŐĂƚĞǁĂLJƚŽƚŚĞĐŝƚLJ͘dŚĞĐŽƌƌŝĚŽƌŚĂƐĂƵŶŝƋƵĞďůĞŶĚŽĨďƵƐŝŶĞƐƐĞƐ that serve local residents and draw nearby tourists. Together with its neighborhoods of new and established homes, there is a sense of community along the corridor that creates a desirable place to live, work, and socialize. DĂŶLJƌĞƐŝĚĞŶƚƐŚĂǀĞƉůĂŶƚĞĚĚĞĞƉƌŽŽƚƐŚĞƌĞ͕ĂŶĚƚŚĞĞƐƚĂďůŝƐŚĞĚŶĞŝŐŚďŽƌŚŽŽĚƐŽĨtĞƐƚŶĂŚĞŝŵĂƌĞƚŚĞ ĐŽƌƌŝĚŽƌ͛ƐĂŶĐŚŽƌ͘ůƵƐƚĞƌƐŽĨƌĞƚĂŝůƐŚŽƉƐ͕ƌĞƐƚĂƵƌĂŶƚƐ͕ĐŽīĞĞŚŽƵƐĞƐ͕ĂŶĚŽƚŚĞƌůŽĐĂůͲƐĞƌǀŝŶŐďƵƐŝŶĞƐƐĞƐĂůŽŶŐ ƚŚĞďŽƵůĞǀĂƌĚĐƌĞĂƚĞĨƵŶƉůĂĐĞƐƚŽŐĂƚŚĞƌǁŝƚŚĨƌŝĞŶĚƐĂŶĚĨĂŵŝůLJ͘'ƌŽǁŶĐŚŝůĚƌĞŶĐŽŵĞďĂĐŬƚŽůŝǀĞ͕ǁŽƌŬ͕ ƐƚĂƌƚďƵƐŝŶĞƐƐĞƐ͕ĂŶĚƌĂŝƐĞĨĂŵŝůŝĞƐďĞĐĂƵƐĞŽĨƚŚĞŝƌƐƚƌŽŶŐƟĞƐƚŽƚŚĞĐŽŵŵƵŶŝƚLJĂŶĚƚŚĞĚĞƐŝƌĂďŝůŝƚLJŽĨƚŚĞ ŶĞŝŐŚďŽƌŚŽŽĚ͘ dŚĞĮƌƐƚƟŵĞLJŽƵƐĞĞƚŚŝƐƐĞŐŵĞŶƚŽĨĞĂĐŚŽƵůĞǀĂƌĚ͕LJŽƵŬŶŽǁLJŽƵŚĂǀĞĂƌƌŝǀĞĚƐŽŵĞƉůĂĐĞƐƉĞĐŝĂů͘tŚĂƚ ƵƐĞĚƚŽďĞĂŚŝŐŚͲƐƉĞĞĚŚŝŐŚǁĂLJǁŝƚŚŝŶĐŽŵƉĂƟďůĞƵƐĞƐĂŶĚƵŶĚĞƌƵƟůŝnjĞĚƉƌŽƉĞƌƟĞƐŚĂƐďĞĞŶƚƌĂŶƐĨŽƌŵĞĚƚŽ ĂƚŚƌŝǀŝŶŐĐŽŵŵĞƌĐŝĂůĂŶĚƌĞƐŝĚĞŶƟĂůĐŽƌƌŝĚŽƌƚŚĂƚŝƐŝŶǀŝƟŶŐĂŶĚƐĂĨĞƚŽǁĂůŬ͕ĐƌŽƐƐ͕ƌŝĚĞĂďŝŬĞ͕ŽƌƚĂŬĞƚƌĂŶƐŝƚ͘ tŝĚĞƐŝĚĞǁĂůŬƐǁŝƚŚƚƌĞĞƐƉƌŽǀŝĚĞƐŚĂĚĞ͕ĂŶĚƵƉŐƌĂĚĞĚƚƌĂŶƐŝƚƐƚŽƉƐĂƌĞƌŽƵƟŶĞůLJƵƐĞĚďLJƌĞƐŝĚĞŶƚƐ͕ǁŽƌŬĞƌƐ͕ ĂŶĚƚŽƵƌŝƐƚƐ͘EƵŵĞƌŽƵƐƉůĂnjĂƐ͕ƉĂƐĞŽƐ͕ƉŽĐŬĞƚƉĂƌŬƐ͕ĂŶĚŽƵƚĚŽŽƌĞĂƟŶŐĂƌĞĂƐŚĂǀĞƐƉƌƵŶŐƵƉĂƐĂŶŝŶƚĞŐƌĂů ƉĂƌƚŽĨĞĂĐŚŶĞǁĚĞǀĞůŽƉŵĞŶƚƉƌŽũĞĐƚ͘EĞǁďŝŬĞĨĂĐŝůŝƟĞƐŝŶƚŚĞĂƌĞĂĐŽŶŶĞĐƚƚŽĂĐŝƚLJǁŝĚĞƐLJƐƚĞŵŽĨďŝŬĞƉĂƚŚƐ ůŝŶŬŝŶŐƐĐŚŽŽůƐ͕ƉĂƌŬƐ͕ĂŶĚĚĞƐƟŶĂƟŽŶƐĂůŽŶŐƚŚĞďŽƵůĞǀĂƌĚ͘/ŵƉƌŽǀĞĚůŝŐŚƟŶŐ͕ůĂŶĚƐĐĂƉŝŶŐ͕ĂŶĚƐŝŐŶĂŐĞĂĚĚ ƚŽƚŚĞĂƉƉĞĂůĂŶĚĞŶŚĂŶĐĞƚŚĞƐĂĨĞƚLJŽĨƚŚĞďŽƵůĞǀĂƌĚ͘dŚĞƐĞŝŵƉƌŽǀĞŵĞŶƚƐĂůƐŽƉƌŽŵŽƚĞĂŚĞĂůƚŚLJůŝĨĞƐƚLJůĞ ƚŚƌŽƵŐŚŽƵƚƚŚĞtĞƐƚŶĂŚĞŝŵĐŽŵŵƵŶŝƚLJ͘ dŚĞŝŵƉƌŽǀĞŵĞŶƚƐƚŽĞĂĐŚŽƵůĞǀĂƌĚŚĂǀĞĐƌĞĂƚĞĚĂƐĞƫŶŐĨŽƌŶĞǁŚŝŐŚͲƋƵĂůŝƚLJƌĞƐŝĚĞŶĐĞƐĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ͘ dŚŝƐŚŽƵƐŝŶŐŚĂƐƌĞƉůĂĐĞĚĂŐŝŶŐĂŶĚŽďƐŽůĞƚĞďƵŝůĚŝŶŐƐĂŶĚĂĚĚĞĚŶĞǁůŝĨĞĂŶĚĂĐƟǀŝƚLJƚŽƚŚĞƐƚƌĞĞƚ͘dŚĞŶĞǁ ŚŽƵƐŝŶŐĐŽŵƉůĞŵĞŶƚƐƚŚĞŵŝdžŽĨƵƐĞƐĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌĂŶĚŝƐĐŽŵƉĂƟďůĞǁŝƚŚĂĚũĂĐĞŶƚƐŝŶŐůĞͲĨĂŵŝůLJŚŽŵĞƐ͘ dŚŝƐŶĞǁŚŽƵƐŝŶŐĂůƐŽƐƵƉƉŽƌƚƐůŽĐĂůďƵƐŝŶĞƐƐĞƐ͕ƉƌŽǀŝĚĞƐĂŵŝdžŽĨĚĞŶƐŝƟĞƐ͕ŝŶĐƌĞĂƐĞƐŽƵƌƉƌŽƉĞƌƚLJǀĂůƵĞƐ͕ĂŶĚ ŵĞĞƚƐƚŚĞŚŝŐŚĚĞŵĂŶĚĨŽƌŚŽƵƐŝŶŐŝŶŽƵƌĐŽŵŵƵŶŝƚLJ͘ dŚĞƌĞŵĂŝŶŝŶŐŵŽƚĞůƐŚĂǀĞďĞĞŶƌĞƉŽƐŝƟŽŶĞĚƚŽƐƵƉƉŽƌƚůŽĐĂůƚŽƵƌŝƐƚƐĨƌŽŵŶĂŚĞŝŵĂŶĚƵĞŶĂWĂƌŬĂŶĚ ƐĞƌǀĞƚŚĞůŽĚŐŝŶŐŶĞĞĚƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚĐŽŵŵĞƌĐŝĂůĂŶĚŵĞĚŝĐĂůƵƐĞƐŝŶƚŚĞĂƌĞĂ͘dŚĞLJŽīĞƌĂƋƵĂůŝƚLJůŽĚŐŝŶŐ ĞdžƉĞƌŝĞŶĐĞƚŽƉĞŽƉůĞǁŚŽĂƌĞĂƩƌĂĐƚĞĚƚŽƚŚĞůŽĐĂůďƵƐŝŶĞƐƐĞƐĂŶĚĂŵĞŶŝƟĞƐ͘ KƵƌĐŽŵŵƵŶŝƚLJƉƌŝĚĞŝƐƵŶŵŝƐƚĂŬĂďůĞͶũƵƐƚĂƩĞŶĚĂĐŽŵŵƵŶŝƚLJĞǀĞŶƚ͕ůŽŽŬĂƚŽƵƌŶĞŝŐŚďŽƌŚŽŽĚƐĂŶĚƐƚƌĞĞƚƐ͕ ŽƌƚĂůŬǁŝƚŚĂůŽĐĂůďƵƐŝŶĞƐƐŽǁŶĞƌ͘dŚŝƐĐŽƌƌŝĚŽƌŝƐƚƌƵůLJƚŚĞŚĞĂƌƚĂŶĚŚƵďŽĨtĞƐƚŶĂŚĞŝŵ͘ 2.2 VISION 24 | VISION | HEARING DRAFT OCTOBER 2018 /ŶĨŽƌŵĞĚďLJƚŚĞ<ĞLJdŚĞŵĞƐĂŶĚsŝƐŝŽŶ͕ƚŚĞĨŽůůŽǁŝŶŐƉƌŝŶĐŝƉůĞƐǁĞƌĞĚĞǀĞůŽƉĞĚǁŝƚŚƚŚĞŽŵŵƵŶŝƚLJĚǀŝƐŽƌLJ ŽŵŵŝƩĞĞ;ͿƚŽŐƵŝĚĞƚŚĞƉƌĞƉĂƌĂƟŽŶŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶ͛ƐƉƌŽǀŝƐŝŽŶƐƌĞůĂƚĞĚƚŽůĂŶĚƵƐĞ͕ƵƌďĂŶĚĞƐŝŐŶ͕ njŽŶŝŶŐ͕ ŵŽďŝůŝƚLJ͕ ŝŶĨƌĂƐƚƌƵĐƚƵƌĞ͕ ĂŶĚ ƌĞĐŽŵŵĞŶĚĂƟŽŶƐ ĨŽƌ ŝŵƉůĞŵĞŶƚĂƟŽŶ͘ dŚĞ ƉƌŝŶĐŝƉůĞƐ ďĞůŽǁ ĂƌĞ ŶŽƚ ƉƌĞƐĞŶƚĞĚŝŶĂŶLJƉĂƌƟĐƵůĂƌŽƌĚĞƌ͘ X ŶƐƵƌĞƚŚĂƚĂŶLJƌĞĚĞƐŝŐŶŽĨĞĂĐŚŽƵůĞǀĂƌĚ ĐŽŶƟŶƵĞƐƚŽĨĂĐŝůŝƚĂƚĞƌĞŐŝŽŶĂůƚŚƌŽƵŐŚͲƚƌĂĸĐ ƚŽĨƌĞĞǁĂLJƐĂŶĚŽƚŚĞƌĐŝƟĞƐŝŶƚŚĞŽƵŶƚLJ͘ X ĞǀĞůŽƉĂďĞĂƵƟĮĐĂƟŽŶƉƌŽŐƌĂŵƚŚĂƚŝŶĐůƵĚĞƐ Ă ƐƚƌĞĞƚƐĐĂƉĞ ƉůĂŶ ĂŶĚ ĮŶĂŶĐŝŶŐ ƐƚƌĂƚĞŐŝĞƐ ƚŽ ŝŵƉƌŽǀĞ ĞĂĐŚ ŽƵůĞǀĂƌĚ ďLJ ĂĚĚƌĞƐƐŝŶŐ ĞůĞŵĞŶƚƐƐƵĐŚĂƐůŝŐŚƟŶŐ͕ůĂŶĚƐĐĂƉŝŶŐ͕ƐŝŐŶĂŐĞ͕ ĂŶĚƐƚƌĞĞƚĨƵƌŶŝƚƵƌĞ͘ X ŽŽƌĚŝŶĂƚĞǁŝƚŚƚŚĞĐŝƟĞƐŽĨƵĞŶĂWĂƌŬĂŶĚ ^ƚĂŶƚŽŶƚŽĞŶƐƵƌĞƚŚĂƚƚŚĞŝŵƉƌŽǀĞŵĞŶƚƐĂƌĞ ĐŽŽƌĚŝŶĂƚĞĚĂŶĚĐŽŵƉůĞŵĞŶƚĂƌLJ͘ X ŽŽƌĚŝŶĂƚĞǁŝƚŚŶĂŚĞŝŵWƵďůŝĐhƟůŝƟĞƐĂŶĚ ^ŽƵƚŚĞƌŶ ĂůŝĨŽƌŶŝĂ ĚŝƐŽŶ ŽŶ ƚŚĞ ƵŶĚĞƌͲ ŐƌŽƵŶĚŝŶŐŽĨŽǀĞƌŚĞĂĚƵƟůŝƚLJůŝŶĞƐ͘ 2.3 GUIDING PRINCIPLES X ƩƌĂĐƚ ĂĚĚŝƟŽŶĂů ƌĞƚĂŝů ƵƐĞƐ ĂŶĚ ƐĞƌǀŝĐĞƐ ƚŚĂƚ ŵĞĞƚ ƚŚĞ ŶĞĞĚƐ ŽĨ ƚŚĞ tĞƐƚ ŶĂŚĞŝŵ ĐŽŵŵƵŶŝƚLJ͘ X WƌŽŵŽƚĞĂŶĞŶǀŝƌŽŶŵĞŶƚƚŚĂƚŝƐĂƩƌĂĐƟǀĞƚŽ ĚĞƐƟŶĂƟŽŶƌĞƚĂŝů͕ƐƵĐŚĂƐůŽĐĂůĨŽŽĚĂƌƟƐĂŶƐ ĂŶĚŽƚŚĞƌƐƉĞĐŝĂůŝnjĞĚƌĞƚĂŝůĞƌƐ͘ X ůůŽǁĨŽƌĂƌĂŶŐĞŽĨŚŽƵƐŝŶŐ;ƐƚĂŶĚͲĂůŽŶĞŽƌŝŶ ŵŝdžĞĚƵƐĞƐͿƚŚĂƚĂĐƟǀĂƚĞƐƚŚĞĐŽƌƌŝĚŽƌ͕ďƵƚĮƚƐ ŝŶǁŝƚŚƚŚĞƐƚƌĞĞƚĂŶĚĂĚũĂĐĞŶƚƌĞƐŝĚĞŶƟĂů͘ X WƌŽŵŽƚĞƚŚĞĞƐƚĂďůŝƐŚŵĞŶƚŽĨŚŽƐƉŝƚĂůŝƚLJƵƐĞƐ ŝŶƚŚĞŶŽƌƚŚĞƌŶƉŽƌƟŽŶŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ ŶĞĂƌƚŚĞƵĞŶĂWĂƌŬŶƚĞƌƚĂŝŶŵĞŶƚŽŶĞƚŚĂƚ ĐĂƚĞƌƚŽƚŽƵƌŝƐƚƐ͘ X ŶƐƵƌĞ ƚŚĂƚ ƉĞƌŵŝƩĞĚ ĂŶĚ ĐŽŶĚŝƟŽŶĂů ƵƐĞƐ ĂůůŽǁĞĚŝŶƚŚĞ^ƉĞĐŝĮĐWůĂŶƐƵƉƉŽƌƚƚŚĞǀŝƐŝŽŶ ĨŽƌĞĂĐŚŽƵůĞǀĂƌĚ͘ X ŶƐƵƌĞ ƚŚĂƚ ŶĞǁ ƉƌŽũĞĐƚƐ ĂůŽŶŐ ĞĂĐŚ ŽƵůĞǀĂƌĚĂƌĞŽĨŚŝŐŚƋƵĂůŝƚLJĂŶĚĚĞƐŝŐŶĞĚƚŽ ŝŶƚĞŐƌĂƚĞǁĞůůǁŝƚŚĞdžŝƐƟŶŐƐƵƌƌŽƵŶĚŝŶŐƵƐĞƐ ĂŶĚĚĞǀĞůŽƉŵĞŶƚ͘ PROVIDE FOR A BALANCED MIX OF USESIMPROVE THE BOULEVARD HEARING DRAFT OCTOBER 2018 | VISION | 25 2 X WƌŝŽƌŝƟnjĞ ĚĞǀĞůŽƉŵĞŶƚ ŽĨ ƚŚĞ tĞƐƚŐĂƚĞ ƐŝƚĞ ƚŽ ĂƩƌĂĐƚ ĚĞƐŝƌĂďůĞ ƵƐĞƐ ƚŚĂƚ ƐĞƌǀĞ ƚŚĞ ůŽĐĂů ĐŽŵŵƵŶŝƚLJ ĂŶĚ ĐĂƉŝƚĂůŝnjĞ ŽŶ ƚŚĞ ƐŝƚĞ͛Ɛ ƉƌŽdžŝŵŝƚLJƚŽƵĞŶĂWĂƌŬ͛ƐŶƚĞƌƚĂŝŶŵĞŶƚŽŶĞ͘ X ŶƐƵƌĞƚŚĂƚĚĞǀĞůŽƉŵĞŶƚŽŶƚŚĞtĞƐƚŐĂƚĞƐŝƚĞ ĐƌĞĂƚĞƐĂƐĞŶƐĞŽĨƉůĂĐĞĂŶĚƐĞƌǀĞƐĂƐĂƉůĞĂƐĂŶƚ ŐĂƚŚĞƌŝŶŐĂƌĞĂĨŽƌtĞƐƚŶĂŚĞŝŵƌĞƐŝĚĞŶƚƐ͘ X /ĚĞŶƟĨLJŽƚŚĞƌĂƌĞĂƐĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌĨŽƌŶĞǁ ƌĞƚĂŝůĚĞǀĞůŽƉŵĞŶƚĂŶĚĐƌĞĂƚĞŽƉƉŽƌƚƵŶŝƟĞƐƚŽ ŵĂŬĞŝƚŚĂƉƉĞŶ͘ X ĞĚŝĐĂƚĞƐƚĂīƌĞƐŽƵƌĐĞƐ͕ĂƐĨĞĂƐŝďůĞ͕ƚŽĨŽĐƵƐ ŽŶĞĐŽŶŽŵŝĐĚĞǀĞůŽƉŵĞŶƚǁŝƚŚŝŶƚŚĞ^ƉĞĐŝĮĐ WůĂŶĂƌĞĂƚŽĂƩƌĂĐƚ ŶĞǁ ďƵƐŝŶĞƐƐĞƐ ĂŶĚ ĚĞǀĞůŽƉŵĞŶƚ͘ BOOST THE ECONOMY X ůůŽǁ ĨŽƌ Ă ǀĂƌŝĞƚLJ ŽĨ ŶĞǁ ƌĞƐŝĚĞŶƟĂů ĚĞǀĞůŽƉŵĞŶƚͶŝŶƚŚĞƌŝŐŚƚůŽĐĂƟŽŶƐͶƚŽƐƚ ĚĞŵĂŶĚĨŽƌƋƵĂůŝƚLJƌĞƐƚĂƵƌĂŶƚƐ͕ĐŽīĞĞŚŽƵƐĞƐ͕ ŐƌŽĐĞƌLJƐƚŽƌĞƐ͕ĂŶĚŽƚŚĞƌĨŽŽĚͬďĞǀĞƌĂŐĞĂŶĚ ƌĞƚĂŝůǀĞŶƵĞƐ͘ X /ŵƉůĞŵĞŶƚ ĞĐŽŶŽŵŝĐ ĚĞǀĞůŽƉŵĞŶƚ ƐƚƌĂƚĞŐŝĞƐ ƚŽŝŶĐƌĞĂƐĞƚŚĞƌĂƚĞŽĨŶĞǁďƵƐŝŶĞƐƐĨŽƌŵĂƟŽŶ͕ ĂƩƌĂĐƚďƵƐŝŶĞƐƐĞƐƚŽƚŚĞĂƌĞĂ͕ĂŶĚůŽǁĞƌƚŚĞ ĂƌĞĂ͛ƐƵŶĞŵƉůŽLJŵĞŶƚƌĂƚĞ͘ X ŶĐŽƵƌĂŐĞŝŶǀĞƐƚŵĞŶƚŝŶƚŚĞĂƌĞĂďLJĐƌĞĂƟŶŐ ŽƉƉŽƌƚƵŶŝƟĞƐĨŽƌŝŶĮůůĚĞǀĞůŽƉŵĞŶƚ͘ X džƉůŽƌĞƚŚĞŽƉƉŽƌƚƵŶŝƚLJƚŽĐƌĞĂƚĞĂƵƐŝŶĞƐƐ /ŵƉƌŽǀĞŵĞŶƚ ŝƐƚƌŝĐƚ ƚŽ ĨĂĐŝůŝƚĂƚĞ ƉƵďůŝĐ ŝŵƉƌŽǀĞŵĞŶƚƐŝŶƚŚĞĂƌĞĂ͘ X /ŶĐƌĞĂƐĞ ŶĞǁ ďƵƐŝŶĞƐƐ ĨŽƌŵĂƟŽŶ ŝŶ tĞƐƚ ŶĂŚĞŝŵ͘ 26 | VISION | HEARING DRAFT OCTOBER 2018 PROMOTE SUSTAINABLE DEVELOPMENT & INFRASTRUCTURE IMPROVEMENTS X ƌĞĂƚĞ ĂŶ ŝŶĐĞŶƟǀĞ ƉƌŽŐƌĂŵ ƚŚĂƚ ƉƌŽŵŽƚĞƐ ƐƵƐƚĂŝŶĂďůĞĚĞǀĞůŽƉŵĞŶƚĂŶĚŝŶĮůůƉƌŽũĞĐƚƐŝŶ ƚŚĞĂƌĞĂ͘ X WƌŽŵŽƚĞĂŶĚƐƚƌĞŶŐƚŚĞŶƉƵďůŝĐƚƌĂŶƐƉŽƌƚĂƟŽŶ ŽƉƟŽŶƐ͘ X WĂƌƚŶĞƌ ǁŝƚŚ ƚŚĞ ŝƚLJ͛Ɛ WƵďůŝĐ hƟůŝƟĞƐ ĂŶĚ WƵďůŝĐtŽƌŬƐĞƉĂƌƚŵĞŶƚƐƚŽĞŶƐƵƌĞĂĚĞƋƵĂƚĞ ƐĞǁĞƌ͕ǁĂƚĞƌ͕ĂŶĚƐƚŽƌŵĚƌĂŝŶĨĂĐŝůŝƟĞƐŵĞĞƚ ƚŚĞĨƵƚƵƌĞĚĞŵĂŶĚƐŽĨƚŚĞĂƌĞĂ͘ 2.3 GUIDING PRINCIPLES (CONTINUED) IMPROVE SAFETY & LIVING CONDITIONS X džƉůŽƌĞƚŚĞƵƐĞŽĨƚĞĐŚŶŽůŽŐLJƚŽĚĞƚĞƌĐƌŝŵĞ ĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ;ƐƵĐŚĂƐĞŶŚĂŶĐĞĚůŝŐŚƟŶŐ ĂŶĚƐĞĐƵƌŝƚLJĐĂŵĞƌĂƐͿ͘ X ZĞƋƵŝƌĞ ŶĞǁ ĚĞǀĞůŽƉŵĞŶƚ ƚŽ ĂƉƉůLJ ƌŝŵĞ WƌĞǀĞŶƟŽŶ dŚƌŽƵŐŚ ŶǀŝƌŽŶŵĞŶƚĂů ĞƐŝŐŶ ;WdͿ ĐŽŶĐĞƉƚƐ ŝŶ ƐŝƚĞ ĚĞƐŝŐŶ ĂŶĚ ďƵŝůĚŝŶŐ ĚĞƐŝŐŶĨŽƌŶĞǁĚĞǀĞůŽƉŵĞŶƚ͘ X ŽŶƟŶƵĞƚŽǁŽƌŬǁŝƚŚƚŚĞWŽůŝĐĞĞƉĂƌƚŵĞŶƚ͕ ŝƚLJĚŵŝŶŝƐƚƌĂƟŽŶ͕ĂŶĚƐŽĐŝĂůƐĞƌǀŝĐĞŐƌŽƵƉƐ ƚŽŝĚĞŶƟĨLJŚŽǁƚŚĞ^ƉĞĐŝĮĐWůĂŶĐĂŶŚĞůƉƚŽ ĂĚĚƌĞƐƐƚŚĞŝƐƐƵĞŽĨƉƌŽǀŝĚŝŶŐƚĞŵƉŽƌĂƌLJĂŶĚ ƉĞƌŵĂŶĞŶƚ ŚŽƵƐŝŶŐ ĂŶĚͬŽƌ ƐĞƌǀŝĐĞƐ ĨŽƌ ƚŚĞ ŚŽŵĞůĞƐƐĂŶĚĨĂŵŝůŝĞƐůŝǀŝŶŐŝŶŵŽƚĞůƐ͘ X ŽŶƟŶƵĞƚŽǁŽƌŬǁŝƚŚƚŚĞWŽůŝĐĞĞƉĂƌƚŵĞŶƚ ĂŶĚ ŽŵŵƵŶŝƚLJ ^ĞƌǀŝĐĞƐ ĞƉĂƌƚŵĞŶƚ ƚŽ ĞŶĐŽƵƌĂŐĞŚŽŵĞůĞƐƐŝŶĚŝǀŝĚƵĂůƐǁŝƚŚŝŶƚŚĞĂƌĞĂ ƚŽĂĐĐĞƐƐĞŵĞƌŐĞŶĐLJƐŚĞůƚĞƌƐ͕ƚƌĂŶƐŝƟŽŶĂůĂŶĚͬ ŽƌƐƵƉƉŽƌƟǀĞŚŽƵƐŝŶŐ͕ĂŶĚƌĞůĂƚĞĚƐĞƌǀŝĐĞƐ͘ X ŽŶƟŶƵĞƚŽǁŽƌŬǁŝƚŚƚŚĞŽĚĞŶĨŽƌĐĞŵĞŶƚ ŝǀŝƐŝŽŶĂŶĚƚŚĞWŽůŝĐĞĞƉĂƌƚŵĞŶƚƚŽŝĚĞŶƟĨLJ ŚŽǁ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ ĐĂŶ ŚĞůƉ ĂĚĚƌĞƐƐ ƚŚĞ ŝƐƐƵĞƐ ƌĞůĂƚĞĚ ƚŽ ŝůůĞŐĂů ĂŶĚ ƵŶĚĞƐŝƌĂďůĞ ĂĐƟǀŝƟĞƐĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ͘ X ŽŶƟŶƵĞƚŽǁŽƌŬǁŝƚŚƚŚĞWŽůŝĐĞĞƉĂƌƚŵĞŶƚ ĂŶĚ ĐŽŵŵƵŶŝƚLJ ŵĞŵďĞƌƐ ƚŽ ŵĂdžŝŵŝnjĞ ƚŚĞ ďĞŶĞĮƚƐŽĨĐŽŵŵƵŶŝƚLJƉŽůŝĐŝŶŐ͘ HEARING DRAFT OCTOBER 2018 | VISION | 27 2 CREATE ADDITIONAL GATHERING & RECREATION AREAS X WůĂŶĨŽƌƚŚĞĞdžƚĞŶƐŝŽŶŽĨĂďŝŬĞǁĂLJĂůŽŶŐƚŚĞ ĂƌďŽŶ ƌĞĞŬ ŚĂŶŶĞů͕ ŝŶ ĐŽŶĨŽƌŵĂŶĐĞ ǁŝƚŚ ƚŚĞŝƚLJ͛ƐŝĐLJĐůĞDĂƐƚĞƌWůĂŶ͘ X /ĚĞŶƟĨLJĂƌĞĂƐǁŚĞƌĞƉƵďůŝĐƉůĂnjĂƐ͕ƉĂƐĞŽƐ͕ĂŶĚ ŽƚŚĞƌŽƉĞŶƐƉĂĐĞĂŵĞŶŝƟĞƐĐĂŶďĞƉƌŽǀŝĚĞĚĂƐ ŶĞǁĚĞǀĞůŽƉŵĞŶƚŽĐĐƵƌƐŽǀĞƌƟŵĞŽƌĂƐĞĂĐŚ ŽƵůĞǀĂƌĚŝƐŝŵƉƌŽǀĞĚ͘ X WƌŽǀŝĚĞ ŐƵŝĚĞůŝŶĞƐ ĨŽƌ ĞŶŚĂŶĐĞĚ ůŝŐŚƟŶŐ ƚŽ ƌĞĚƵĐĞĐƌŝŵĞĂŶĚŝŵƉƌŽǀĞƐĂĨĞƚLJĂŶĚĂĞƐƚŚĞƟĐƐ ŝŶƉƵďůŝĐƐƉĂĐĞƐ͘ X ^ƵƉƉŽƌƚŝŵƉƌŽǀĞŵĞŶƚƐƚŽůŽĐĂůƉĂƌŬƐƐĞƌǀŝŶŐ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ ĂƌĞĂ ƚŚĂƚ ǁŝůů ŵĂŬĞ ƚŚĞŵ ĚĞƐŝƌĂďůĞŐĂƚŚĞƌŝŶŐƐƉĂĐĞƐĨŽƌƚŚĞƐƵƌƌŽƵŶĚŝŶŐ ŶĞŝŐŚďŽƌŚŽŽĚƐ͘ X ŶĐŽƵƌĂŐĞ ĂĚĚŝƟŽŶĂů ĂŵĞŶŝƟĞƐ ĂŶĚ ƉƌŽŐƌĂŵŵŝŶŐĨŽƌƐĞŶŝŽƌƐŝŶƚŚĞĂƌĞĂ͕ŝŶĐůƵĚŝŶŐ ƚŚĞƉŽƐƐŝďŝůŝƚLJŽĨũŽŝŶƚƵƐĞŽĨƚŚĞĨĂĐŝůŝƟĞƐĂƚƚŚĞ tĞƐƚŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌ͘ X ĂƉŝƚĂůŝnjĞ ŽŶ tĞƐƚ ŶĂŚĞŝŵ͛Ɛ ƉƌŽdžŝŵŝƚLJ ƚŽ ĞŶƚĞƌƚĂŝŶŵĞŶƚ ǀĞŶƵĞƐ ƐƵĐŚ ĂƐ <ŶŽƩ͛ƐĞƌƌLJ &Ăƌŵ͕ĚǀĞŶƚƵƌĞŝƚLJ͕ĂŶĚŽƚŚĞƌƐƚŽƉƌŽŵŽƚĞ ƚŚĞĐŽƌƌŝĚŽƌĂƐĂƵŶŝƋƵĞƉůĂĐĞĨŽƌƐŚŽƉƉŝŶŐĂŶĚ ĚŝŶŝŶŐ͘ X ĞǀĞůŽƉĂĐŽŵƉĞůůŝŶŐďƌĂŶĚ;ĂĚŝƐƟŶĐƟǀĞŶĂŵĞ͕ ƉůĂĐĞ͕ĂŶĚĨĞĞůͿƚŽƉƌŽŵŽƚĞƚŚĞtĞƐƚŶĂŚĞŝŵ ĐŽŵŵƵŶŝƚLJĂŶĚƚŚĞĞĂĐŚŽƵůĞǀĂƌĚĐŽƌƌŝĚŽƌ͘ X ŶĐŽƵƌĂŐĞ LJŽƵƚŚ ŝŶ ƚŚĞ ĂƌĞĂ ƚŽ ŐĞƚ ŝŶǀŽůǀĞĚ ǁŝƚŚƚŚĞ^ƉĞĐŝĮĐWůĂŶƉƌŽĐĞƐƐĂŶĚďĞLJŽŶĚĂŶĚ ŐŝǀĞƚŚĞŵĂĚŝƌĞĐƚƐƚĂŬĞŝŶƚŚĞĨƵƚƵƌĞŽĨƚŚĞŝƌ ŶĞŝŐŚďŽƌŚŽŽĚƐ͘ PROMOTE & BRAND THE CORRIDOR 28 | VISION | HEARING DRAFT OCTOBER 2018 dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ CHAPTER 3:CONTEXT 30 | CONTEXT | HEARING DRAFT OCTOBER 2018 dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 |CONTEXT | 31 3 dŚŝƐ ĐŚĂƉƚĞƌ ƉƌŽǀŝĚĞƐ ĐŽŶƚĞdžƚƵĂů ŝŶĨŽƌŵĂƟŽŶ ĨŽƌ ƚŚĞ^WĂƌĞĂĂŶĚŶĞŝŐŚďŽƌŝŶŐĐŝƟĞƐ͘dŚĞƐĞĐƟŽŶƐ ďĞůŽǁƐƵŵŵĂƌŝnjĞƚŚĞĚĞǀĞůŽƉŵĞŶƚŚŝƐƚŽƌLJĂůŽŶŐƚŚĞ ĐŽƌƌŝĚŽƌ͕ ƚŚĞ ĞdžŝƐƟŶŐ ůĂŶĚ ƵƐĞƐ ǁŝƚŚŝŶ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶĂƌĞĂĂŶĚƚŚŽƐĞŽĨĐŝƟĞƐĂĚũĂĐĞŶƚƚŽƚŚĞŶŽƌƚŚĂŶĚ ƐŽƵƚŚ͘ĚĚŝƟŽŶĂůůLJ͕ƚŚŝƐĐŚĂƉƚĞƌƉƌŽǀŝĚĞƐĂƐLJŶŽƉƐŝƐ ŽĨ ƚŚĞ ĞdžŝƐƟŶŐ ŵĂƌŬĞƚ ĐŽŶĚŝƟŽŶƐ ĨŽƌ ƚŚĞ ĐŽƌƌŝĚŽƌ ĂŶĚ ƐƵƌƌŽƵŶĚŝŶŐ ĂƌĞĂ͘ &ŝŶĂůůLJ͕ ƚŚĞ ĐŚĂƉƚĞƌ ŽƵƚůŝŶĞƐ ĞdžŝƐƟŶŐĂŶĚŽŶŐŽŝŶŐĞīŽƌƚƐƚŽĨĂĐŝůŝƚĂƚĞƐƵƐƚĂŝŶĂďůĞ ůŝǀŝŶŐĂŶĚĚĞǀĞůŽƉŵĞŶƚǁŝƚŚŝŶƚŚĞ^WĂƌĞĂĂŶĚƚŚĞ ŝƚLJŽĨŶĂŚĞŝŵ͘ 3.1 HISTORY ĞǀĞůŽƉŵĞŶƚĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚĐĂŶďĞƚƌĂĐĞĚ ďĂĐŬƚŽƚŚĞϭϴϵϬƐƚŽĂĨĂƌŵŚŽƵƐĞƚŚĂƚǁĂƐŽŶĐĞ ƐƵƌƌŽƵŶĚĞĚďLJŽƌĂŶŐĞŐƌŽǀĞƐ͘ƵƌŝŶŐƚŚĞĞĂƌůLJϭϵϰϬƐ ĂŶĚΖϱϬƐ͕ƚŚĞĮƌƐƚŵŽƚĞůƐǁĞƌĞďƵŝůƚƚŽĂĐĐŽŵŵŽĚĂƚĞ ƚŚĞƚƌĂǀĞůŝŶŐƉƵďůŝĐ͘:ƵƐƚƉƌŝŽƌƚŽƚŚĞϭϵϲϬƐ͕ĂƐƚŚĞ ƉŽƉƵůĂƟŽŶƐƚĂƌƚĞĚƚŽŐƌŽǁ͕ƚŚĞĂƌĞĂŬŶŽǁŶĂƐtĞƐƚ ŶĂŚĞŝŵǁĂƐĂŶŶĞdžĞĚďLJƚŚĞŝƚLJĂŶĚƚŚĞŽƌĂŶŐĞ ŐƌŽǀĞƐ ǁĞƌĞ ĐůĞĂƌĞĚ ƚŽ ŵĂŬĞ ǁĂLJ ĨŽƌ ƌĞƐŝĚĞŶƟĂů ĚĞǀĞůŽƉŵĞŶƚ͘ƵƌŝŶŐƚŚŝƐƟŵĞ͕ƚŚĞĮƌƐƚƌĞƐŝĚĞŶƟĂů ƐƵďĚŝǀŝƐŝŽŶƐ ĂŶĚ ŵƵůƟͲĨĂŵŝůLJ ĚĞǀĞůŽƉŵĞŶƚƐ ǁĞƌĞ ďƵŝůƚĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ͘KƚŚĞƌůĂŶĚƵƐĞƐĨŽůůŽǁĞĚ͕ ƐƵĐŚ ĂƐ Ă ŚŽƐƉŝƚĂů͕ ŽĸĐĞƐ͕ ĂŶĚ ĂĚĚŝƟŽŶĂů ŵŽƚĞůƐ͘ /ƚ ǁĂƐ ĂůƐŽ ĚƵƌŝŶŐ ƚŚŝƐ ƟŵĞ ƚŚĂƚ ĞĂĐŚ ŽƵůĞǀĂƌĚ ƌĞĐĞŝǀĞĚ ŝƚƐ ŶĂŵĞ͘ Ɛ ƚŚĞ ŽŶůLJ ŶŽƌƚŚͬƐŽƵƚŚ ƌŽƵƚĞ ǁŝƚŚ ĚŝƌĞĐƚ ĂĐĐĞƐƐ ƚŽ ƚŚĞ ĐŽĂƐƚĂů ĐŝƟĞƐ ŽĨ KƌĂŶŐĞ ŽƵŶƚLJ͕ĂƐƚƌĞĞƚͲŶĂŵŝŶŐĐŽŵŵŝƩĞĞƐĞƩůĞĚŽŶĞĂĐŚ ŽƵůĞǀĂƌĚďĞĐĂƵƐĞƚŚĞƌŽĂĚǁĂLJǁĂƐŬŶŽǁŶĂƐƚŚĞ ͞ZŽĂĚƚŽ^ƵŵŵĞƌ͘͟DĂŶLJŽĨƚŚĞŵŽƚĞůƐĂƚƚŚŝƐƟŵĞ ƉƌŽǀŝĚĞĚ ĂĐĐŽŵŵŽĚĂƟŽŶƐ ĨŽƌ ďĞĂĐŚ ŐŽĞƌƐ ĂŶĚ ǀŝƐŝƚŽƌƐƚŽ<ŶŽƩ͛ƐĞƌƌLJ&Ăƌŵ͕ůŽĐĂƚĞĚũƵƐƚŶŽƌƚŚŽĨ tĞƐƚŶĂŚĞŝŵŝŶƵĞŶĂWĂƌŬ͘ DŽƌĞ ƐĞƌǀŝĐĞͲŽƌŝĞŶƚĞĚ ůĂŶĚ ƵƐĞƐ ǁĞƌĞ ŶĞĞĚĞĚ ƚŽ ƐƵƉƉŽƌƚ ƚŚĞ ŐƌŽǁŝŶŐ ŶƵŵďĞƌ ŽĨ ƌĞƐŝĚĞŶƚƐ ĂŶĚ ƚŽƵƌŝƐƚƐ͘dŚĞĮƌƐƚĐŽƌŶĞƌƌĞƚĂŝůĞƌƐǁĞƌĞĞƐƚĂďůŝƐŚĞĚ ĂůŽŶŐ>ŝŶĐŽůŶĂŶĚKƌĂŶŐĞǀĞŶƵĞƐĚƵƌŝŶŐƚŚĞϭϵϳϬƐ͖ ŵŽƚĞůĂŶĚŵƵůƟͲĨĂŵŝůLJĚĞǀĞůŽƉŵĞŶƚĂůƐŽĞdžƉĂŶĚĞĚ ĚƵƌŝŶŐ ƚŚŝƐ ƉĞƌŝŽĚ͘ dŚĞ ϭϵϴϬƐ ďƌŽƵŐŚƚ ŵŽƌĞ ĐŽŵŵĞƌĐŝĂůƌĞƚĂŝůƵƐĞƐƚŽƚŚĞĂƌĞĂ͕ŝŶĐůƵĚŝŶŐďŝŐďŽdž ƌĞƚĂŝůĞƌƐĂŶĚƐƚƌŝƉŵĂůůƐ͘ƵƌŝŶŐƚŚĞϭϵϵϬƐƚŚĞĂƌĞĂ ĞdžƉĞƌŝĞŶĐĞĚǀĞƌLJůŝƩůĞĚĞǀĞůŽƉŵĞŶƚ͘,ŽǁĞǀĞƌ͕ƚŚĞƌĞ ǁĂƐƌĞŶĞǁĞĚŝŶƚĞƌĞƐƚĚƵƌŝŶŐƚŚĞĮƌƐƚĚĞĐĂĚĞŽĨƚŚĞ ϮϬϬϬƐ ǁŝƚŚ ƚŚĞ ĚĞǀĞůŽƉŵĞŶƚ ŽĨ Ă ŶĞǁ ƚŽǁŶŚŽŵĞ ƉƌŽũĞĐƚ͕ƐŝŶŐůĞͲĨĂŵŝůLJŝŶĮůůŶĞŝŐŚďŽƌŚŽŽĚƐ͕ƚŚĞtĞƐƚ ĞĂĐŚŽƵůĞǀĂƌĚĂƚ>ŝŶĐŽůŶ͕ŶĂŚĞŝŵ͕ĐĂϭϵϲϳ ^ŽƵƌĐĞ͗KƌĂŶŐĞŽƵŶƚLJƌĐŚŝǀĞƐ ĞĂĐŚŽƵůĞǀĂƌĚĂƚ>ŝŶĐŽůŶ͕ŶĂŚĞŝŵ͕ĐĂϭϵϲϳ ^ŽƵƌĐĞ͗KƌĂŶŐĞŽƵŶƚLJƌĐŚŝǀĞƐ ĞĂĐŚŽƵůĞǀĂƌĚĂƚ>ŝŶĐŽůŶǀĞŶƵĞ͕ŶĂŚĞŝŵ͕ϮϬϭϱ 3 CONTEXT: HISTORY & EXISTING LAND USE 32 | CONTEXT | HEARING DRAFT OCTOBER 2018 ŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌ͕ĂŶĚĂĚĚŝƟŽŶĂůƌĞƚĂŝůĐĞŶƚĞƌƐ͘ &ŝŐƵƌĞϯͲϭ͕ĞǀĞůŽƉŵĞŶƚƌĂƐ͕ƐŚŽǁƐƚŚĞƉƌŽŐƌĞƐƐŝŽŶ ŽĨĚĞǀĞůŽƉŵĞŶƚŝŶƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͘ /ƚ ǁĂƐ ĂůƐŽ ĚƵƌŝŶŐ ƚŚĞ ĞĂƌůLJ ϮϬϬϬƐ ƚŚĂƚ ƚŚĞ ŝƚLJ͛Ɛ ƌĞĚĞǀĞůŽƉŵĞŶƚĂŐĞŶĐLJ;ŶŽǁƚŚĞ^ƵĐĐĞƐƐŽƌŐĞŶĐLJ ƚŽƚŚĞŶĂŚĞŝŵZĞĚĞǀĞůŽƉŵĞŶƚŐĞŶĐLJͿĂŶĚ,ŽƵƐŝŶŐ ŐĞŶĐLJĂĐƋƵŝƌĞĚƉƌŽƉĞƌƟĞƐŝŶƚŚĞĂƌĞĂ͘dŚĞƐĞŝŶĐůƵĚĞ ƚŚĞtĞƐƚŐĂƚĞĞŶƚĞƌƐŝƚĞĂƚƚŚĞĐŽƌŶĞƌŽĨĞĂĐŚĂŶĚ >ŝŶĐŽůŶ͕ĂƐǁĞůůĂƐƚŚĞ^ŝůǀĞƌDŽŽŶDŽƚĞůƐŝƚĞŶŽƌƚŚ ŽĨƚŚĞtĞƐƚŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌ͘WůĂŶƐĨŽƌƚŚĞƐĞ ƉƌŽũĞĐƚƐĂƌĞĚŝƐĐƵƐƐĞĚůĂƚĞƌŝŶƚŚŝƐĐŚĂƉƚĞƌ͘ 3.2 EXISTING LAND USES OF BEACH BOULEVARD AND THE SURROUNDING CITIES  ǀĂƌŝĞƚLJ ŽĨ ĂƵƚŽͲŽƌŝĞŶƚĞĚ ůĂŶĚ ƵƐĞƐ ŇĂŶŬ ĞĂĐŚ ŽƵůĞǀĂƌĚ͘/ŶĂĚĚŝƟŽŶƚŽƐĞƌǀŝŶŐƚŚĞtĞƐƚŶĂŚĞŝŵ ĐŽŵŵƵŶŝƚLJ͕ŵĂŶLJŽĨƚŚĞƐĞƵƐĞƐƐƵƉƉŽƌƚƚŽƵƌŝƐƚͲ ƌĞůĂƚĞĚ ĂĐƟǀŝƟĞƐ ŝŶ ƵĞŶĂ WĂƌŬ ĂŶĚTŚĞ ŶĂŚĞŝŵ ZĞƐŽƌƚΡ͘ dŚĞ ƐĞĐƟŽŶƐ ďĞůŽǁ ĚĞƐĐƌŝďĞ ƚŚĞ ĞdžŝƐƟŶŐ ĐŽŶĚŝƟŽŶƐŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂĂƐǁĞůůĂƐƚŚŽƐĞ ŽĨƚŚĞŶĞŝŐŚďŽƌŝŶŐĐŝƟĞƐŽĨƵĞŶĂWĂƌŬĂŶĚ^ƚĂŶƚŽŶ͘ 3.2.1 Beach Boulevard Specific Plan Area Existing Land Uses džŝƐƟŶŐůĂŶĚƵƐĞƐŝŶƚŚĞ^WĂƌĞĂŝŶĐůƵĚĞƌĞƐŝĚĞŶƟĂů͕ ĐŽŵŵĞƌĐŝĂů͕ĂŶĚƉƵďůŝĐĚĞƐŝŐŶĂƟŽŶƐ͘ZĞƐŝĚĞŶƟĂůƵƐĞƐ ŝŶĐůƵĚĞďŽƚŚƐŝŶŐůĞͲĂŶĚŵƵůƟͲĨĂŵŝůLJĚĞǀĞůŽƉŵĞŶƚ͘ ǀĂƌŝĞƚLJŽĨŚŽƵƐŝŶŐƚLJƉĞƐĐĂŶďĞĨŽƵŶĚŝŶƚŚĞĂƌĞĂ͕ ŝŶĐůƵĚŝŶŐĚƵƉůĞdžĞƐ͕ĨŽƵƌƉůĞdžĞƐ͕ƚŽǁŶŚŽŵĞƐ͕ŐĂƌĚĞŶ ĂƉĂƌƚŵĞŶƚƐ͕ ĂŶĚ ŵŽďŝůĞ ŚŽŵĞƐ͘ ŽŵŵĞƌĐŝĂů ƵƐĞƐ ŝŶĐůƵĚĞ͕ŽĸĐĞ͕ƌĞƚĂŝů͕ĂŶĚƐĞƌǀŝĐĞƐƐƵĐŚĂƐƌĞƐƚĂƵƌĂŶƚƐ ĂŶĚ ŵŽƚĞůƐ͕ ŐĂƐ ƐƚĂƟŽŶƐ͕ ĂŶ ĂƵƚŽ ĚĞĂůĞƌƐŚŝƉ͕ ĂŶĚ ƐĂůǀĂŐĞLJĂƌĚ͘DĞĚŝĐĂůƵƐĞƐŝŶƚŚĞĂƌĞĂŝŶĐůƵĚĞƚŚĞ tĞƐƚŶĂŚĞŝŵDĞĚŝĐĂůĞŶƚĞƌ;ŚŽƐƉŝƚĂůͿĂƐǁĞůůĂƐ ƐĞǀĞƌĂůďƵŝůĚŝŶŐƐƉƌŽǀŝĚŝŶŐŵĞĚŝĐĂůŽĸĐĞƐƉĂĐĞ͘dǁŽ ƉĂƌŬƐŝŶƚŚĞ^WĂƌĞĂĂĐĐŽƵŶƟŶŐĨŽƌϴƉĞƌĐĞŶƚŽĨ ƚŚĞůĂŶĚ͘dŚĞtĞƐƚŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌŝƐƚŚĞŽŶůLJ ƉƵďůŝĐͲŝŶƐƟƚƵƟŽŶĂů ƵƐĞ ǁŝƚŚŝŶ ƚŚĞ ĂƌĞĂ͘ ,ŽǁĞǀĞƌ͕ ƐĞǀĞƌĂů ƐĐŚŽŽůƐ͕ ŝŶĐůƵĚŝŶŐ dǁŝůĂ ZĞŝĚ ĂŶĚ ƌĂĚĞŶͲ WŽǁĞůůĞůĞŵĞŶƚĂƌLJƐĐŚŽŽůƐĂŶĚtĞƐƚĞƌŶ,ŝŐŚ^ĐŚŽŽů͕ ĂƌĞůĞƐƐƚŚĂŶĂƋƵĂƌƚĞƌŵŝůĞĨƌŽŵƚŚĞĐŽƌƌŝĚŽƌ͘&ŝŐƵƌĞ ϯͲϮ͕džŝƐƟŶŐ >ĂŶĚ hƐĞ͕ ƐŚŽǁƐ ƚŚĞ ĞdžŝƐƟŶŐ ƵƐĞƐ ŝŶ ƚŚĞ^WĂƌĞĂ͕ĂŶĚ&ŝŐƵƌĞϯͲϯ͕džŝƐƟŶŐ >ĂŶĚ hƐĞ ƌĞĂŬĚŽǁŶ͕ƉƌŽǀŝĚĞƐĞĂĐŚůĂŶĚƵƐĞďLJƉĞƌĐĞŶƚĂŐĞŽĨ ƚŚĞWůĂŶĂƌĞĂ͘ DĂŶLJŽĨƚŚĞƐƵƌƌŽƵŶĚŝŶŐƌĞƐŝĚĞŶƟĂůŶĞŝŐŚďŽƌŚŽŽĚƐŝŶtĞƐƚŶĂŚĞŝŵĂƌĞ ĂĚũĂĐĞŶƚƚŽƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͘ZĞƐŝĚĞŶƚƐŽĨ ƚŚĞƐĞĂƌĞĂƐ ĞdžƉƌĞƐƐĞĚĂĚĞƐŝƌĞƚŽŝŵƉƌŽǀĞƚŚĞĐŽŵŵĞƌĐŝĂůĐĞŶƚĞƌƐĂůŽŶŐƚŚĞďŽƵůĞǀĂƌĚ͘ DŽƚĞůƵƐĞƐĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚǀĂƌLJĨƌŽŵŶĂƟŽŶĂůĐŚĂŝŶƐƚŽůŽĐĂůůLJ ŽǁŶĞĚĂŶĚŽƉĞƌĂƚĞĚĂĐĐŽŵŵŽĚĂƟŽŶƐ͘ ŶƚĞƌƚĂŝŶŵĞŶƚƵƐĞƐƐƵĐŚĂƐZŽĐŬΖŶƌĞǁƐĚƌĂǁŵŝůůŝŽŶƐŽĨǀŝƐŝƚŽƌƐƚŽ ƚŚĞĞĂĐŚŽƵůĞǀĂƌĚĐŽƌƌŝĚŽƌŝŶƵĞŶĂWĂƌŬ͘ HEARING DRAFT OCTOBER 2018 |CONTEXT | 33 3 Figure 3-1 Development Eras BROADWAY ORANGE AVE LINCOLN AVE BEACHBLVDWESTERN AVEBALL RD DALE AVECity of Buena Park City of Stanton Development Eras 1940s & 1950s 1960s 1970s 1980s 2000s Vacant Flood Control Channel Park Right of Way Specific Plan Area City Boundary 0 500 1,000 Feet ^ŽƵƌĐĞ͗ŝƚLJŽĨŶĂŚĞŝŵϮϬϭϲ 34 | CONTEXT | HEARING DRAFT OCTOBER 2018 dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 |CONTEXT | 35 3 BROADWAY ORANGE AVE LINCOLN AVE BEACHBLVDWESTERN AVEBALL RD DALE AVEExisting Land Use Single Family Residence Mobile Home Park Condominium/Townhouse Fourplex Apartment Park Athletic Club Car Wash Auto Salvage Yard Retail Use Service Station Auto Dealership Hotel/Motel Religious Use Community or Charity Group City Facility OC Flood Control District Retirement Facility Nursing Home Medical Office Hospital Vacant Right of Way Specific Plan Area City Boundary 0 500 1,000 Feet City of Buena Park City of Stanton &ŝŐƵƌĞϯͲϮdžŝƐƟŶŐ>ĂŶĚhƐĞ ^ŽƵƌĐĞ͗ŝƚLJŽĨŶĂŚĞŝŵϮϬϭϲ 36 | CONTEXT | HEARING DRAFT OCTOBER 2018 dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 |CONTEXT | 37 3 tŝƚŚƉƌŽdžŝŵŝƚLJƚŽŵĂŶLJŶŽƚĂďůĞǀĂĐĂƟŽŶĚĞƐƟŶĂƟŽŶƐ͕ ŝŶĐůƵĚŝŶŐŝƐŶĞLJůĂŶĚ͕<ŶŽƩΖƐĞƌƌLJ&Ăƌŵ͕ĂŶĚƉŽƉƵůĂƌ ďĞĂĐŚĞƐ͕ŵŽƚĞůƵƐĞƐǁĞƌĞŽŶĐĞĂǀŝĂďůĞĞĐŽŶŽŵŝĐƵƐĞ ƚŚĂƚĐŽŶƚƌŝďƵƚĞĚƚŽƚŚĞtĞƐƚŶĂŚĞŝŵĐŽŵŵƵŶŝƚLJ͘ dŽĚĂLJŵĂŶLJŽĨƚŚĞŵŽƚĞůƐŚĂǀĞƌĞĂĐŚĞĚƚŚĞĞŶĚŽĨ ƚŚĞŝƌƵƐĞĨƵůĐLJĐůĞĂƐƚŚĞLJŚĂǀĞŶŽƚŬĞƉƚƉĂĐĞǁŝƚŚƚŚĞ ĐŚĂŶŐŝŶŐƚŽƵƌŝƐŵŵĂƌŬĞƚ͘^ŽŵĞŽĨƚŚĞƐĞŽůĚĞƌŵŽƚĞůƐ ĂƌĞƉůĂŐƵĞĚďLJĐƌŝŵŝŶĂůĂĐƟǀŝƚLJĂŶĚĐŽŶƚƌŝďƵƚĞƚŽƚŚĞ ĂƌĞĂΖƐŚŝŐŚĐƌŝŵĞƌĂƚĞ͕ǁŚŝĐŚŝƐŶĞĂƌůLJƐŝdžƟŵĞƐƚŚĞ ĐŝƚLJǁŝĚĞĂǀĞƌĂŐĞ͘ dŚĞƐŽƵƚŚĞƌŶĞĚŐĞŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂŝƐĂĚũĂĐĞŶƚ ƚŽůŽĐĂů͕ůĞƐƐĞƌͲŬŶŽǁŶĞŶƚĞƌƚĂŝŶŵĞŶƚƵƐĞƐ͘dŚŝƐĂƌĞĂ ďŽƌĚĞƌƐ ĚǀĞŶƚƵƌĞ ŝƚLJ ;ĚŝƐĐƵƐƐĞĚ ĨƵƌƚŚĞƌ ďĞůŽǁͿ͕ ĂŶĚ ŝƐ ŚŽŵĞ ƚŽ ,ŽďďLJ ŝƚLJ ĂŶĚ ƚŚĞ tŚŝƚĞ ,ŽƵƐĞ ǀĞŶƚĞŶƚĞƌ͘dŚĞĞǀĞŶƚĐĞŶƚĞƌŝƐĂƵŶŝƋƵĞĨĂĐŝůŝƚLJƚŚĂƚ ǁĂƐďƵŝůƚĂƐĂŵƵƐĞƵŵŝŶϭϵϳϴ͘dŚĞŽƌŝŐŝŶĂůďƵŝůĚŝŶŐ ŝƐ Ă ŽŶĞͲŚĂůĨͲƐĐĂůĞ ƌĞƉůŝĐĂ ŽĨ ƚŚĞ tŚŝƚĞ ,ŽƵƐĞ ŝŶ tĂƐŚŝŶŐƚŽŶ͘͘ dŚƌĞĞǀĂĐĂŶƚƐŝƚĞƐĐŽŵƉƌŝƐĞƌŽƵŐŚůLJϭϮƉĞƌĐĞŶƚŽĨ ƚŚĞůĂŶĚǁŝƚŚŝŶƚŚĞ^WĂƌĞĂ͘dŚĞƐĞƉĂƌĐĞůƐƌĞĂĚŝůLJ ŽīĞƌƚŚĞŽƉƉŽƌƚƵŶŝƚLJĨŽƌŶĞǁĚĞǀĞůŽƉŵĞŶƚĂůŽŶŐƚŚĞ ĐŽƌƌŝĚŽƌ͘dŚĞĨŽƌŵĞƌ^ŝůǀĞƌDŽŽŶDŽƚĞůƐŝƚĞŝƐŶŽƌƚŚ ŽĨƚŚĞtĞƐƚŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌ͘dŚĞƉƌŽƉĞƌƚLJŝƐĂ ϮͲĂĐƌĞƉĂƌĐĞůŽǁŶĞĚďLJƚŚĞŝƚLJ͛Ɛ,ŽƵƐŝŶŐƵƚŚŽƌŝƚLJ͘ dŚŝƐ ƉƌŽƉĞƌƚLJ ŝƐ ŝĚĞŶƟĮĞĚďLJƚŚĞŝƚLJ͛ƐϮϬϭϰͲϮϬϮϭ ,ŽƵƐŝŶŐ ůĞŵĞŶƚ ;ƉĂƌƚ ŽĨ ƚŚĞ ŝƚLJ͛Ɛ 'ĞŶĞƌĂů WůĂŶͿ ĂƐ Ă ŚŽƵƐŝŶŐ ŽƉƉŽƌƚƵŶŝƚLJ ƐŝƚĞ ĂŶĚ ŝƐ ĚĞƐŝŐŶĂƚĞĚ ZĞƐŝĚĞŶƟĂůͲ>Žǁ DĞĚŝƵŵ͕ ǁŚŝĐŚ ŵĞĂŶƐ ƚŚĂƚ ƚŚĞ ƉƌŽƉĞƌƚLJŵƵƐƚďĞƵƐĞĚĨŽƌƌĞƐŝĚĞŶƟĂůĚĞǀĞůŽƉŵĞŶƚ͘ dŚĞƐĞĐŽŶĚƐŝƚĞŝƐĂŽŶĞͲĂĐƌĞǀĂĐĂŶƚ͕ƉƌŝǀĂƚĞůLJͲŽǁŶĞĚ ƉĂƌĐĞůďĞŚŝŶĚƚŚĞŵĞĚŝĐĂůŽĸĐĞƐĂƚƚŚĞĐŽƌŶĞƌŽĨ KƌĂŶŐĞǀĞŶƵĞĂŶĚĞĂĐŚŽƵůĞǀĂƌĚ͘dŚĞƚŚŝƌĚƐŝƚĞ ŝƐƚŚĞĐŽƌŶĞƌŽĨ>ŝŶĐŽůŶǀĞŶƵĞĂŶĚĞĂĐŚŽƵůĞǀĂƌĚ͘ dŚŝƐƉƌŽƉĞƌƚLJŝƐŬŶŽǁŶĂƐƚŚĞtĞƐƚŐĂƚĞƐŝƚĞ͕ŽǁŶĞĚďLJ ƚŚĞŝƚLJ͕ĂŶĚŝƐĚŝƐĐƵƐƐĞĚŝŶŵŽƌĞĚĞƚĂŝůƚŚƌŽƵŐŚŽƵƚ ƚŚŝƐWůĂŶ͘&ŝŐƵƌĞϯͲϮ͕džŝƐƟŶŐ>ĂŶĚhƐĞ͕ĂůƐŽŝĚĞŶƟĮĞƐ ƚŚĞǀĂĐĂŶƚƉƌŽƉĞƌƟĞƐĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ͘ 3.2.2 Existing Uses in Neighboring Cities DŽǀŝŶŐŶŽƌƚŚĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚŝƐƚŚĞ ƵĞŶĂ WĂƌŬ ŶƚĞƌƚĂŝŶŵĞŶƚŽŶĞ͕ ǁŚŝĐŚ ĐŽǀĞƌƐ ĂŶ ĂƉƉƌŽdžŝŵĂƚĞůLJϮͲŵŝůĞƐƚƌĞƚĐŚŽĨĞĂĐŚŽƵůĞǀĂƌĚ͘dŚĞ ĂŶĐŚŽƌĂƩƌĂĐƟŽŶƐĨŽƌƚŚĞnjŽŶĞĂƌĞ<ŶŽƩ͛ƐĞƌƌLJ&Ăƌŵ ĂŶĚ^ŽĂŬŝƚLJtĂƚĞƌWĂƌŬ͖ŽƚŚĞƌĂƩƌĂĐƟŽŶƐŝŶĐůƵĚĞ DĞĚŝĞǀĂůdŝŵĞƐ͕ZŽĐŬĂŶĚƌĞǁƐ͕ĂŶĚWŝƌĂƚĞŝŶŶĞƌ dŚĞĂƚĞƌĂƐǁĞůůĂƐĂƉƉƌŽdžŝŵĂƚĞůLJϮϱƌĞƐƚĂƵƌĂŶƚƐĂŶĚ ϭϱŚŽƚĞůƐ͘dŚĞŶĞǁĞƐƚĚĞǀĞůŽƉŵĞŶƚŝŶƚŚĞĂƌĞĂŝƐĂ ƉƌŽũĞĐƚĐĂůůĞĚdŚĞ^ŽƵƌĐĞ͘dŚŝƐŵĞŐĂĞŶƚĞƌƚĂŝŶŵĞŶƚ ϭϭ͘Ϯй Ϭ͘ϰй Ϭ͘ϯй ϭ͘ϲй Ϭ͘ϳй Ϭ͘ϲй Ϭ͘Ϯй ϰ͘ϲй ϭϭ͘ϱй ϱ͘ϭй ϭϮ͘Ϭй ϯ͘ϭй ϭ͘Ϯй Ϭ͘ϱй ϭ͘Ϭй Ϯ͘ϰй Ϭ͘ϲй Ϭ͘ϰй ϴ͘ϭй Ϯ͘ϳй ϰ͘ϱй ϭϰ͘ϳй ϭϮ͘ϰй &ŝŐƵƌĞϯͲϯdžŝƐƟŶŐ>ĂŶĚhƐĞƌĞĂŬĚŽǁŶ 38 | CONTEXT | HEARING DRAFT OCTOBER 2018 ŶŽĚĞ͕ ƚŚŝƐ ŽǀĞƌ ƌĞůŝĂŶĐĞ ŽŶ ŽŶĞ ƐĞĐƚŽƌ ĐĂŶ ďĞ ƉƌŽďůĞŵĂƟĐĨŽƌƐĞǀĞƌĂůƌĞĂƐŽŶƐ͕ŽƵƚůŝŶĞĚĂƐĨŽůůŽǁƐ͘ KǀĞƌƚŚĞƉĂƐƚĮǀĞLJĞĂƌƐ͕ũŽďŐƌŽǁƚŚŝŶtĞƐƚŶĂŚĞŝŵ ŚĂƐďĞĞŶůĂĐŬůƵƐƚĞƌǁŚĞŶĐŽŵƉĂƌĞĚƚŽƚŚĞŝƚLJŽĨ ŶĂŚĞŝŵ͘&ƌŽŵϮϬϭϭƚŽϮϬϭϲ͕ũŽďƐŝŶtĞƐƚŶĂŚĞŝŵ ŐƌĞǁďLJϮ͘ϭƉĞƌĐĞŶƚ͘DĞĂŶǁŚŝůĞ͕ƚŚĞƚŽƚĂůŶƵŵďĞƌŽĨ ũŽďƐŐƌĞǁďLJϴ͘ϴƉĞƌĐĞŶƚŝŶƚŚĞŝƚLJŽĨŶĂŚĞŝŵŽǀĞƌ ƚŚĞƐĂŵĞƟŵĞƉĞƌŝŽĚ͘ tĞƐƚŶĂŚĞŝŵŝƐŶŽƚĂũŽďͲĚĞŶƐĞŶĞŝŐŚďŽƌŚŽŽĚ͘/Ŷ ϮϬϭϱ͕ƚŚĞƌĂƟŽŽĨůŽĐĂůũŽďƐƚŽĞŵƉůŽLJĞĚƌĞƐŝĚĞŶƚƐ ǁĂƐ ƌĞůĂƟǀĞůLJ ůŽǁ͕ ǁŝƚŚ Ϭ͘Ϯϰ ũŽďƐ ƉĞƌ ĞŵƉůŽLJĞĚ ƌĞƐŝĚĞŶƚ͘ŶĂŚĞŝŵ͕ŽŶƚŚĞŽƚŚĞƌŚĂŶĚ͕ŚĂƐĂŵƵĐŚ ŚŝŐŚĞƌƌĂƟŽŽĨϭ͘ϬϴůŽĐĂůũŽďƐƉĞƌĞŵƉůŽLJĞĚƌĞƐŝĚĞŶƚƐ͘ tŚŝůĞ ƚŚĞ ĚŝīĞƌĞŶĐĞ ĐĂŶ ďĞ ŝŶ ƉĂƌƚ ĂƩƌŝďƵƚĞĚ ƚŽ njŽŶŝŶŐĂŶĚůĂŶĚƵƐĞ;ƚŚĞŵĂũŽƌŝƚLJŽĨtĞƐƚŶĂŚĞŝŵ ŝƐƌĞƐŝĚĞŶƟĂůͿ͕ƚŚŝƐĚŽĞƐŶŽƚŵĞĂŶƚŚĞĐŽƌƌŝĚŽƌůĂĐŬƐ ƚŚĞĂǀĂŝůĂďůĞĐŽŵŵĞƌĐŝĂůƐƉĂĐĞĨŽƌŶĞǁďƵƐŝŶĞƐƐĞƐƚŽ ŐƌŽǁ͘/ŶĨĂĐƚ͕ĂŚŝŐŚŽĸĐĞǀĂĐĂŶĐLJƌĂƚĞǁŝƚŚŝŶĂŽŶĞͲ ŵŝůĞƌĂĚŝƵƐŽĨĞĂĐŚŽƵůĞǀĂƌĚƐƵŐŐĞƐƚƐƚŚĂƚƐƉĂĐĞ ŝƐŶŽƚĂĐŽŶƐƚƌĂŝŶƚƚŽĞĐŽŶŽŵŝĐŐƌŽǁƚŚĂƐŝƚŵŝŐŚƚďĞ ĞůƐĞǁŚĞƌĞ͘ 3.3.2 Key Industries &ŽƌϮϬϭϲ͕ƚŚĞĮǀĞůĂƌŐĞƐƚƐĞĐƚŽƌƐŝŶtĞƐƚŶĂŚĞŝŵďLJ ƚŚĞŶƵŵďĞƌŽĨũŽďƐǁĞƌĞ,ĞĂůƚŚĂƌĞ;ϯϵ͘ϬƉĞƌĐĞŶƚͿ͕ 'ŽǀĞƌŶŵĞŶƚ ;ϭϲ͘ϭ ƉĞƌĐĞŶƚͿ͕ ĐĐŽŵŵŽĚĂƟŽŶ ĂŶĚ 'ŽŽĚ ^ĞƌǀŝĐĞƐ ;ϭϯ͘ϯ ƉĞƌĐĞŶƚͿ͕ ĂŶĚ ZĞƚĂŝů ;ϭϭ͘Ϭ ƉĞƌĐĞŶƚͿ͘ dŚĞŝƚLJŽĨŶĂŚĞŝŵĂƐĂǁŚŽůĞ͕ŽŶƚŚĞŽƚŚĞƌŚĂŶĚ͕ŚĂƐ ĂƐŝŐŶŝĮĐĂŶƚůLJŵŽƌĞĚŝǀĞƌƐŝĮĞĚĞĐŽŶŽŵLJƚŚĂŶtĞƐƚ ŶĂŚĞŝŵ͘/ŶŶĂŚĞŝŵ͕ŶŽƐŝŶŐůĞŝŶĚƵƐƚƌLJĐŽŵƉƌŝƐĞĚ ŵŽƌĞƚŚĂŶϭϱ͘ϯƉĞƌĐĞŶƚŽĨƚŚĞŝƚLJ͛ƐƚŽƚĂůũŽďĐŽƵŶƚ͘ /ŶϮϬϭϲ͕ƚŚĞůĂƌŐĞƐƚƐĞĐƚŽƌƐǁĞƌĞƌƚƐ͕ŶƚĞƌƚĂŝŶŵĞŶƚ͕ ĂŶĚZĞĐƌĞĂƟŽŶ;ϭϱ͘ϯƉĞƌĐĞŶƚͿ͕ĐĐŽŵŵŽĚĂƟŽŶĂŶĚ &ŽŽĚ ^ĞƌǀŝĐĞƐ ;ϭϭ͘ϵ ƉĞƌĐĞŶƚͿ͕ DĂŶƵĨĂĐƚƵƌŝŶŐ ;ϭϬ͘ϯ ƉĞƌĐĞŶƚͿ͕,ĞĂůƚŚĂƌĞ;ϭϬ͘ϳƉĞƌĐĞŶƚͿ͕ĂŶĚŽŶƐƚƌƵĐƟŽŶ ;ϵ͘ϭƉĞƌĐĞŶƚͿ͘dĂďůĞϯͲϭ͕ŵƉůŽLJŵĞŶƚďLJ/ŶĚƵƐƚƌLJ ϮϬϭϭͲϮϬϭϲ͕ƉƌŽǀŝĚĞƐĂĐŽŵƉĂƌŝƐŽŶŽĨĞŵƉůŽLJŵĞŶƚďLJ ŝŶĚƵƐƚƌLJĨŽƌtĞƐƚŶĂŚĞŝŵĂŶĚƚŚĞŝƚLJĂƐĂǁŚŽůĞ͘ dŚĞ ŝƚLJ ŽĨ ŶĂŚĞŝŵ ŝŶĐůƵĚĞƐ Ă ĐĞŶƚƌĂů ďƵƐŝŶĞƐƐ ĚŝƐƚƌŝĐƚĂŶĚĂůĂƌŐĞĞŶƚĞƌƚĂŝŶŵĞŶƚĂŶĚƚŽƵƌŝƐŵƐĞĐƚŽƌ͘ ĐŽŶŽŵŝĐ ĚĂƚĂ ĨŽƌ ĐĞƌƚĂŝŶ ƐĞĐƚŽƌƐ ŝƐ ƐƵƉƉƌĞƐƐĞĚ ďLJƚŚĞĂůŝĨŽƌŶŝĂǁŚĞŶƚŚĞƌĞĂƌĞĨĞǁĞƌƚŚĂŶ ƚŚƌĞĞ ĞƐƚĂďůŝƐŚŵĞŶƚƐ ŝŶ ĂŶ ŝŶĚƵƐƚƌLJ͕ Žƌ ŝĨ Ă ƐŝŶŐůĞ ĞŵƉůŽLJĞƌ ŵĂŬĞƐ ƵƉ ŵŽƌĞ ƚŚĂŶ ϴϬ ƉĞƌĐĞŶƚ ŽĨ ƚŚĞ ĞŵƉůŽLJŵĞŶƚŝŶƚŚĂƚŝŶĚƵƐƚƌLJ͘'ŝǀĞŶƚŚĞŝŶŇƵĞŶĐĞŽĨ ŝƐŶĞLJůĂŶĚZĞƐŽƌƚŽŶŶĂŚĞŝŵΖƐůŽĐĂůĞĐŽŶŽŵLJ͕ϮϬϭϭ ŚƵďŝƐĂϰϬϬ͕ϬϬϬͲƐƋƵĂƌĞͲĨŽŽƚƐƉĂĐĞƚŚĂƚĐŽŵďŝŶĞƐ ĚŝŶŝŶŐ͕ ƐŚŽƉƉŝŶŐ͕ Ă ŚŽƚĞů͕ ϰ  ƚŚĞĂƚĞƌ͕ ƌĞĐŽƌĚŝŶŐ ƐƚƵĚŝŽ͕ĂŶĚϱͲƐƚŽƌLJŽĸĐĞƚŽǁĞƌ͘/ƚŝƐĞƐƟŵĂƚĞĚƚŚĂƚ ƚŚĞŶƚĞƌƚĂŝŶŵĞŶƚŽŶĞŐĞŶĞƌĂƚĞƐϲ͘ϰŵŝůůŝŽŶǀŝƐŝƚƐ ĂŶŶƵĂůůLJ͘ dŽ ƚŚĞ ƐŽƵƚŚ ŝƐ ĚǀĞŶƚƵƌĞ ŝƚLJ͕ Ă ϮͲĂĐƌĞ ĨĂŵŝůLJͲ ŽƌŝĞŶƚĞĚ ƚŚĞŵĞ ƉĂƌŬ ƚŚĂƚ ƐƚƌĂĚĚůĞƐ ƚŚĞ ďŽƵŶĚĂƌLJ ďĞƚǁĞĞŶŶĂŚĞŝŵĂŶĚ^ƚĂŶƚŽŶ͘/ƚŝƐĞƐƟŵĂƚĞĚƚŚĂƚ ƚŚĞƚŚĞŵĞƉĂƌŬĚƌĂǁƐďĞƚǁĞĞŶϮϬϬ͕ϬϬϬĂŶĚϰϬϬ͕ϬϬϬ ǀŝƐŝƚŽƌƐ Ă LJĞĂƌ͘ KƚŚĞƌ ƵƐĞƐ ĂĚũĂĐĞŶƚ ƚŽ ƚŚĞ ^W ĂƌĞĂŝŶĐůƵĚĞĂƐĂůǀĂŐĞLJĂƌĚ;ƐƉĂŶƐďŽƚŚ^ƚĂŶƚŽŶĂŶĚ ŶĂŚĞŝŵͿĂƐǁĞůůĂƐƐŝŶŐůĞͲĂŶĚŵƵůƟͲĨĂŵŝůLJƌĞƐŝĚĞŶƟĂů ŶĞŝŐŚďŽƌŚŽŽĚƐ͘ 3.3 EXISTING MARKET CONDITIONS dŚŝƐƐĞĐƟŽŶƉƌŽǀŝĚĞƐĂŶĂƐƐĞƐƐŵĞŶƚŽĨƚŚĞĞdžŝƐƟŶŐ ĐŽŶĚŝƟŽŶƐ;ϮϬϭϰͶϮϬϭϲͿŽĨƚŚĞůŽĐĂůĞĐŽŶŽŵLJŝŶtĞƐƚ ŶĂŚĞŝŵ͘dŚŝƐĞǀĂůƵĂƟŽŶůŽŽŬƐĂƚĞŵƉůŽLJŵĞŶƚƚƌĞŶĚƐ ƚŚƌŽƵŐŚĚĂƚĂƉƌŽǀŝĚĞĚďLJƚŚĞĂůŝĨŽƌŶŝĂŵƉůŽLJŵĞŶƚ ĞǀĞůŽƉŵĞŶƚĞƉĂƌƚŵĞŶƚ;ͿYƵĂƌƚĞƌůLJĞŶƐƵƐ ŽĨŵƉůŽLJŵĞŶƚĂŶĚtĂŐĞƐ;YtͿ͕ϮϬϭϯĂŶĚϮϬϭϳ ƌĞƉŽƌƚƐ ĨƌŽŵ ŶĂŚĞŝŵ͛Ɛ tŽƌŬĨŽƌĐĞ ĞǀĞůŽƉŵĞŶƚ ŽĂƌĚ;tͿ͕ĂŶĚĂŵĂƌŬĞƚĨĞĂƐŝďŝůŝƚLJƐƚƵĚLJĨŽƌůĂŶĚ ƵƐĞĐŚĂŶŐĞƐƉƵďůŝƐŚĞĚďLJ<ĞLJƐĞƌDĂƌƐƚŽŶƐƐŽĐŝĂƚĞƐ ;<DͿŝŶϮϬϭϱ͘ŶĂŶĂůLJƐŝƐŽĨĞdžŝƐƟŶŐŝŶǀĞŶƚŽƌLJĨŽƌ ŽĸĐĞƐƉĂĐĞ͕ŝŶĐůƵĚŝŶŐŽĐĐƵƉĂŶĐLJĂŶĚǀĂĐĂŶĐLJƌĂƚĞƐ ǁĂƐ ŽďƚĂŝŶĞĚ ďLJ ŽƐƚĂƌ͘ >ĂƐƚůLJ͕ ŬĞLJ ĚĞŵŽŐƌĂƉŚŝĐ ŝŶĨŽƌŵĂƟŽŶ ĨƌŽŵ EŝĞůƐĞŶ ĂŶĚ ƚŚĞ ϮϬϭϰ ŵĞƌŝĐĂŶ ŽŵŵƵŶŝƚLJ ^ƵƌǀĞLJ ;^Ϳ ƉƌŽǀŝĚĞ ŝŶƐŝŐŚƚ ŝŶƚŽ ƚŚĞ ƉŽƉƵůĂƟŽŶĂŶĚĨƵƚƵƌĞƚƌĞŶĚƐ͘ 3.3.1 Economic Overview &ƌŽŵĂŶĞĐŽŶŽŵŝĐĚĞǀĞůŽƉŵĞŶƚƉĞƌƐƉĞĐƟǀĞ͕tĞƐƚ ŶĂŚĞŝŵĚŝīĞƌƐŝŶƐĞǀĞƌĂůŬĞLJǁĂLJƐĨƌŽŵƚŚĞŝƚLJŽĨ ŶĂŚĞŝŵĂƐĂǁŚŽůĞ͗/ƚĨĞĂƚƵƌĞƐĂůĂƌŐĞƌŚĞĂůƚŚĐĂƌĞ ƐĞĐƚŽƌ͕ƐůŽǁĞƌĞŵƉůŽLJŵĞŶƚŐƌŽǁƚŚ͕ĂŶĚůĂĐŬŽĨŶĞǁ ƉƌŝǀĂƚĞŝŶǀĞƐƚŵĞŶƚ͘ /ŶϮϬϭϲ͕ĂƉƉƌŽdžŝŵĂƚĞůLJϯϵ͘ϬƉĞƌĐĞŶƚŽĨũŽďƐŝŶtĞƐƚ ŶĂŚĞŝŵǁĞƌĞƌĞůĂƚĞĚƚŽŚĞĂůƚŚĐĂƌĞ͕ĂŵƵĐŚŚŝŐŚĞƌ ƉĞƌĐĞŶƚĂŐĞƚŚĂŶŝŶŶĂŚĞŝŵ;ϭϬ͘ϳƉĞƌĐĞŶƚͿ͘dŚŝƐŝƐ ĚƵĞŝŶƉĂƌƚƚŽƚŚĞtĞƐƚŶĂŚĞŝŵDĞĚŝĐĂůĞŶƚĞƌ͕Ă ϮϭϵͲďĞĚ ĂĐƵƚĞ ĐĂƌĞ ŚŽƐƉŝƚĂů ǁŝƚŚ ƐĞǀĞƌĂů ŚƵŶĚƌĞĚ ĞŵƉůŽLJĞĞƐ͕ƚŚĂƚŝƐǁŝƚŚŝŶƚŚĞ^ƉĞĐŝĮĐWůĂŶƌĞĂĂƚƚŚĞ ŝŶƚĞƌƐĞĐƟŽŶŽĨĞĂĐŚŽƵůĞǀĂƌĚĂŶĚKƌĂŶŐĞǀĞŶƵĞ͘ tŚŝůĞƚŚĞŚŽƐƉŝƚĂůĂŶĚŵĞĚŝĐĂůŽĸĐĞĐůƵƐƚĞƌĞĚĂůŽŶŐ ĞĂĐŚŽƵůĞǀĂƌĚĐƌĞĂƚĞĂŶŝŵƉŽƌƚĂŶƚĞŵƉůŽLJŵĞŶƚ HEARING DRAFT OCTOBER 2018 |CONTEXT | 39 3 t^dE,/DΈ/WKϵϮϴϬϰΉ CITY OF ANAHEIM /Eh^dZzΈΉ ϮϬϭϭΈΉ EMPLOYMENT ϮϬϭϲΈΉ EMPLOYMENT PERCENT CHANGE ϮϬϭϭΈΉ EMPLOYMENT ϮϬϭϲΈΉ EMPLOYMENT PERCENT CHANGE ŐƌŝĐƵůƚƵƌĞ͕&ŽƌĞƐƚƌLJ͕ &ŝƐŚŝŶŐĂŶĚ,ƵŶƟŶŐ;ĂͿ Eͬ Eͬ Eͬ ϭϲϳ ϭϮϮ ͲϮϲ͘ϵй DŝŶŝŶŐ͕YƵĂƌƌLJŝŶŐ͕ĂŶĚKŝů ĂŶĚ'ĂƐdžƚƌĂĐƟŽŶ Ϭ Ϭ Ϭй Eͬ Eͬ Eͬ hƟůŝƟĞƐ Eͬ Ϭ Eͬ ϰϰϰ ϰϴϵ ϭϬ͘ϭй ŽŶƐƚƌƵĐƟŽŶ ϮϬϴ Ϯϭϯ Ϯ͘ϰй ϭϭ͕ϴϱϵ ϭϲ͕ϬϬϱ ϯϱ͘Ϭй DĂŶƵĨĂĐƚƵƌŝŶŐ ϭϴϰ ϮϬϯ ϭϬ͘ϯй ϭϵ͕ϯϰϲ ϭϴ͕Ϭϳϭ Ͳϲ͘ϲй tŚŽůĞƐĂůĞdƌĂĚĞ ϲϯ ϵϱ ϱϬ͘ϴй ϵ͕ϱϯϬ ϭϬ͕ϱϯϲ ϭϬ͘ϲй ZĞƚĂŝůdƌĂĚĞ ϭ͕Ϭϵϰ ϭ͕Ϭϯϴ Ͳϱ͘ϭй ϭϭ͕ϳϮϯ ϭϮ͕ϲϬϭ ϳ͘ϱй dƌĂŶƐƉŽƌƚĂƟŽŶĂŶĚ tĂƌĞŚŽƵƐŝŶŐ ϲϯ ϰϮ Ͳϯϯ͘ϯй ϰ͕Ϭϵϰ ϯ͕ϰϬϴ Ͳϭϲ͘ϴй /ŶĨŽƌŵĂƟŽŶ Eͬ Eͬ Eͬ Ϯ͕ϭϬϭ ϭ͕ϲϰϳ ͲϮϭ͘ϲй &ŝŶĂŶĐĞĂŶĚ/ŶƐƵƌĂŶĐĞ ϭϮϬ ϭϯϭ ϵ͘Ϯй ϯ͕ϳϲϮ ϯ͕ϲϴϱ ͲϮ͘Ϭй ZĞĂůƐƚĂƚĞĂŶĚZĞŶƚĂů ĂŶĚ>ĞĂƐŝŶŐ ϭϳϳ ϭϳϬ Ͳϰ͘Ϭй Ϯ͕ϵϱϴ Ϯ͕ϳϵϮ Ͳϱ͘ϲй WƌŽĨĞƐƐŝŽŶĂůĂŶĚdĞĐŚŶŝĐĂů ^ĞƌǀŝĐĞƐ ϭϮϬ ϭϰϮ ϭϴ͘ϯй ϱ͕ϰϮϵ ϱ͕ϯϴϯ ͲϬ͘ϴй DĂŶĂŐĞŵĞŶƚŽĨ ŽŵƉĂŶŝĞƐĂŶĚ ŶƚĞƌƉƌŝƐĞƐ Eͬ Eͬ Eͬ ϭ͕ϴϮϮ Ϯ͕ϭϲϬ ϭϴ͘ϲй ĚŵŝŶ͕^ƵƉƉŽƌƚĂŶĚ tĂƐƚĞDĂŶĂŐĞŵĞŶƚ ϳϱϭ ϯϭϰ Ͳϱϴ͘Ϯй ϭϮ͕ϭϯϳ ϭϯ͕ϱϴϴ ϭϮ͘Ϭй ĚƵĐĂƟŽŶĂů^ĞƌǀŝĐĞƐ ϭϮϯ ϴϱ ͲϯϬ͘ϵй Ϯ͕Ϭϵϯ ϭ͕ϵϬϬ Ͳϵ͘Ϯй ,ĞĂůƚŚĂƌĞĂŶĚ^ŽĐŝĂů ƐƐŝƐƚĂŶĐĞ ϯ͕ϬϱϬ ϯ͕ϲϳϴ ϮϬ͘ϲй ϭϰ͕ϯϯϰ ϭϴ͕ϴϲϭ ϯϭ͘ϲй ƌƚƐ͕ŶƚĞƌƚĂŝŶŵĞŶƚ͕ĂŶĚ ZĞĐƌĞĂƟŽŶ ϴϯ ϲϯ ͲϮϰ͘ϭй Eͬ Ϯϲ͕ϵϮϲ Eͬ ĐĐŽŵŵŽĚĂƟŽŶĂŶĚ&ŽŽĚ ^ĞƌǀŝĐĞƐ ϵϴϬ ϭ͕Ϯϱϴ Ϯϴ͘ϰй ϮϬ͕Ϯϴϳ ϮϬ͕ϵϮϵ ϯ͘Ϯй KƚŚĞƌ^ĞƌǀŝĐĞƐ;ĞdžĐĞƉƚ WƵďůŝĐĚŵŝŶŝƐƚƌĂƟŽŶͿ ϳϲϵ ϯϯϱ Ͳϱϲ͘ϰй ϰ͕ϵϱϭ ϰ͕Ϯϵϴ Ͳϭϯ͘Ϯй 'ŽǀĞƌŶŵĞŶƚ ϭ͕ϯϮϯ ϭ͕ϱϭϳ ϭϰ͘ϳй ϭϰ͕ϴϰϮ ϭϮ͕Ϭϳϴ Ͳϭϴ͘ϲϬй EŽƚůƐĞǁŚĞƌĞůĂƐƐŝĮĞĚ ϰϳ ϴϰ ϳϴ͘ϳй Ϯϱϯ ϰϭϱ ϲϰ͘Ϭй TOTAL ϵ͕ϮϮϴ ϵ͕ϰϮϱ Ϯ͘ϭй ϭϲϭ͕ϲϴϲ ϭϳϱ͕ϵϳϱ ϴ͘ϴй d>ϯͳϭDW>KzDEdz/Eh^dZz͕ϮϬϭϭ͵ϮϬϭϲ Sources: Quarterly Census of Employment and Wages (QCEW), CA EDD, 2011, 2016; BAE, 2017. Notes: Universe consists of all wage and salary employment by place of work. Does not include self-employed persons not on payroll (A) Cells shown as N/A represent data suppressed due to EDD disclosure rules. (B) Represents average annual employment reported by quarter. N/A - Data not available 'ŽǀĞƌŶŵĞŶƚĨŽƌƚŚĞŝƚLJŽĨŶĂŚĞŝŵĐŽŵďŝŶĞƐĞƐƟŵĂƚĞƐĨŽƌ&ĞĚĞƌĂů͕^ƚĂƚĞ͕ĂŶĚ>ŽĐĂů'ŽǀĞƌŶŵĞŶƚ:ŽďƐ͘ 40 | CONTEXT | HEARING DRAFT OCTOBER 2018 ĞŵƉůŽLJŵĞŶƚĮŐƵƌĞƐĨŽƌƚŚĞƌƚƐĂŶĚŶƚĞƌƚĂŝŶŵĞŶƚ ƐĞĐƚŽƌĂƌĞŶŽƚůŝƐƚĞĚďLJĂůŝĨŽƌŶŝĂ͘,ŽǁĞǀĞƌ͕ ĂƐƐƵŵŝŶŐƚŚĂƚĞƐƟŵĂƚĞƐĨŽƌDŝŶŝŶŐ͕ƚŚĞŽŶůLJ ŽƚŚĞƌ ĐĂƚĞŐŽƌLJ ƐƵƉƉƌĞƐƐĞĚ ďLJ ĂůŝĨŽƌŶŝĂ ͕ ŚĞůĚ ĐŽŶƐƚĂŶƚĨƌŽŵϮϬϭϭƚŽϮϬϭϲ͕ŝƚĐĂŶďĞĚĞĚƵĐĞĚƚŚĂƚ ƚŚĞ ƌƚƐ ĂŶĚ ŶƚĞƌƚĂŝŶŵĞŶƚ ŝŶĚƵƐƚƌLJ ĐŽŵƉƌŝƐĞĚ ĂƉƉƌŽdžŝŵĂƚĞůLJϭϵ͕ϰϴϰũŽďƐŝŶϮϬϭϭ͘dŚŝƐǁŽƵůĚŵĂŬĞ ƌƚƐ ĂŶĚ ŶƚĞƌƚĂŝŶŵĞŶƚ ŶĂŚĞŝŵ͛Ɛ ĨĂƐƚĞƐƚͲŐƌŽǁŝŶŐ ĞŵƉůŽLJŵĞŶƚƐĞĐƚŽƌ͕ŐƌŽǁŝŶŐďLJϯϴ͘ϮƉĞƌĐĞŶƚďĞƚǁĞĞŶ ϮϬϭϭĂŶĚϮϬϭϲ͘ 3.3.3 Local Employment Trends ůƚŚŽƵŐŚ ƚŚĞ ŚĞĂůƚŚ ĐĂƌĞ ŝŶĚƵƐƚƌLJ ŚĂƐ Ă ƐŝŐŶŝĮĐĂŶƚ ƉƌĞƐĞŶĐĞŝŶtĞƐƚŶĂŚĞŝŵ͕ŝƚŚĂƐŶŽƚƉĞƌĨŽƌŵĞĚĂƐ ǁĞůůĂƐŝƚŚĂƐĐŝƚLJǁŝĚĞ͘&ƌŽŵϮϬϭϭƚŽϮϬϭϲ͕ƚŚĞŶƵŵďĞƌ ŽĨtĞƐƚŶĂŚĞŝŵũŽďƐŝŶŚĞĂůƚŚĐĂƌĞŐƌĞǁďLJϮϬ͘ϲ ƉĞƌĐĞŶƚ͘dŚĞŝƚLJŽĨŶĂŚĞŝŵ͕ŝŶĐŽŶƚƌĂƐƚ͕ƐĂǁĂϯϭ͘ϲ ƉĞƌĐĞŶƚŝŶĐƌĞĂƐĞŝŶŚĞĂůƚŚĐĂƌĞͲƌĞůĂƚĞĚũŽďƐŽǀĞƌƚŚĞ ƐĂŵĞƟŵĞƉĞƌŝŽĚ͘ tĞƐƚŶĂŚĞŝŵ͛ƐůŽǁĞƌͲƚŚĂŶͲĞdžƉĞĐƚĞĚũŽďŐƌŽǁƚŚ ďĞƚǁĞĞŶϮϬϭϭƚŽϮϬϭϲƵŶĚĞƌƐĐŽƌĞƐƚŚĞĚŝĸĐƵůƟĞƐ ƚŚĂƚĐĂŶƌĞƐƵůƚĨƌŽŵƌĞůLJŝŶŐƚŽŽŚĞĂǀŝůLJŽŶĂƐŝŶŐůĞ ƐĞĐƚŽƌ͘ ŌĞƌ Ă ƐĞƌŝĞƐ ŽĨ ĨĂŝůĞĚ ŝŶƐƉĞĐƟŽŶƐ ĂŶĚ ƚŚĞ ůŽƐƐŽĨĨĞĚĞƌĂůĨƵŶĚŝŶŐ͕ŶĂŚĞŝŵ'ĞŶĞƌĂů,ŽƐƉŝƚĂů͕ ĂůŝƩůĞŽǀĞƌĂŵŝůĞĨƌŽŵĞĂĐŚŽƵůĞǀĂƌĚ͕ĐůŽƐĞĚŝŶ DĂLJϮϬϭϯ͘ƚŽŶĞƉŽŝŶƚ͕ƚŚĞŚŽƐƉŝƚĂůĂĐĐŽƵŶƚĞĚĨŽƌĂƐ ŵĂŶLJĂƐϲϵϬũŽďƐŝŶƚŚĞĂƌĞĂ͕ĂĐĐŽƌĚŝŶŐƚŽĂtŽƌŬĨŽƌĐĞ ĞǀĞůŽƉŵĞŶƚŽĂƌĚZĞƉŽƌƚ͘ :ŽďůŽƐƐĞƐŝŶtĞƐƚŶĂŚĞŝŵ͛ƐŚĞĂůƚŚĐĂƌĞƐĞĐƚŽƌĐŽƵůĚ ĂůƐŽƚŚƌĞĂƚĞŶƚŽƐƉŝůůŽǀĞƌŝŶƚŽŽƚŚĞƌƐĞĐƚŽƌƐůŝŬĞƌĞƚĂŝů͕ ĂƐĚĂLJƟŵĞŚĞĂůƚŚĐĂƌĞǁŽƌŬĞƌƐĐĂŶĐŽŶƚƌŝďƵƚĞƚŽĂ ƐŝŐŶŝĮĐĂŶƚĂŵŽƵŶƚŽĨƌĞƚĂŝůĚĞŵĂŶĚ͘ƐŝnjĞĂďůĞĂŵŽƵŶƚ ŽĨƌĞƚĂŝůůĞĂŬĂŐĞǁĂƐĨŽƵŶĚŝŶĂŵĂƌŬĞƚŽǀĞƌǀŝĞǁ ƉƵďůŝƐŚĞĚďLJ<ĞLJƐĞƌDĂƌƐƚŽŶƐƐŽĐŝĂƚĞƐ;<DͿŝŶϮϬϭϱ͕ ƉĂƌƟĐƵůĂƌůLJŝŶĐĂƚĞŐŽƌŝĞƐůŝŬĞĨŽŽĚƐƚŽƌĞƐ͕ĂŶĚĂƉƉĂƌĞů ƐƚŽƌĞƐ͘dŚŝƐůĂĐŬŽĨƋƵĂůŝƚLJƌĞƚĂŝůŚĂƐĂůƐŽďĞĞŶƌĞƉŽƌƚĞĚ ďLJůŽĐĂůƌĞƐŝĚĞŶƚƐĂƐĂŵĂũŽƌĐŽŶĐĞƌŶŝŶĂŶƵŵďĞƌŽĨ ƉƵďůŝĐŽƵƚƌĞĂĐŚƐĞƐƐŝŽŶƐ͘ &ŝŶĂůůLJ͕tĞƐƚŶĂŚĞŝŵĐƵƌƌĞŶƚůLJůĂĐŬƐƚŚĞƉƌĞƐĞŶĐĞŽĨ ĂƚŚƌŝǀŝŶŐ͕ĚLJŶĂŵŝĐƐĞĐƚŽƌǁŝƚŚƚŚĞƉŽƚĞŶƟĂůƚŽƐƉƵƌ ŐƌŽǁƚŚĞůƐĞǁŚĞƌĞ͘LJĐŽŶƚƌĂƐƚ͕ŶĂŚĞŝŵ͛ƐƌƚƐĂŶĚ ŶƚĞƌƚĂŝŶŵĞŶƚƐĞĐƚŽƌŝƐĐƵƌƌĞŶƚůLJƚŚƌŝǀŝŶŐ͖ϭϳ͘ϵŵŝůůŝŽŶ ŐƵĞƐƚƐǀŝƐŝƚĞĚŝƐŶĞLJůĂŶĚŝŶϮϬϭϲ͕ǁŚŝůĞĂůŝĨŽƌŶŝĂ ĚǀĞŶƚƵƌĞĂƩƌĂĐƚĞĚϵ͘ϯŵŝůůŝŽŶǀŝƐŝƚŽƌƐ;dͬKD ϮϬϭϲ dŚĞŵĞ /ŶĚĞdž ĂŶĚ DƵƐĞƵŵ /ŶĚĞdž͗ dŚĞ 'ůŽďĂů ƩƌĂĐƟŽŶƐƩĞŶĚĂŶĐĞZĞƉŽƌƚͿ͘:ƵƐƚĂƐƚŚĞŝƚLJŽĨ 'ĂƌĚĞŶ'ƌŽǀĞ͕ǁŚŝĐŚŝƐĂĚũĂĐĞŶƚƚŽŶĂŚĞŝŵĂŶĚƚŚĞ ŝƐŶĞLJůĂŶĚ ZĞƐŽƌƚ͕ ŚĂƐ ŵĂĚĞ ƐŝŐŶŝĮĐĂŶƚ ĞīŽƌƚƐ ƚŽ ƉƌŽǀŝĚĞĂŵĞŶŝƟĞƐƚŽƐƵĐĐĞƐƐĨƵůůLJĂƩƌĂĐƚƉĂƌŬǀŝƐŝƚŽƌƐ͕ ^dZE'd,^ X džŝƐƟŶŐĐůƵƐƚĞƌŽĨĨĂĐŝůŝƟĞƐ ƌĞůĂƚĞĚƚŽŚĞĂůƚŚĐĂƌĞ͕ĂŶ ŝŶĚƵƐƚƌLJƐĞĞŝŶŐŐƌŽǁƚŚ ŶĂƟŽŶǁŝĚĞ X ^ƚƌŽŶŐĐŽŵŵƵŶŝƚLJƉƌĞƐĞŶĐĞ͖ ĂĐƟǀĞŶĞŝŐŚďŽƌŚŽŽĚ ĂƐƐŽĐŝĂƟŽŶĂŶĚŝŶǀŽůǀĞĚ ƌĞƐŝĚĞŶƚƐ X dǁŝůĂZĞŝĚWĂƌŬ͕^ĐŚǁĞŝƚnjĞƌ WĂƌŬĂŶĚƚŚĞtĞƐƚŶĂŚĞŝŵ zŽƵƚŚĞŶƚĞƌĂƐĐŽŵŵƵŶŝƚLJ ĨŽĐĂůƉŽŝŶƚƐ X ^ƚƌŽŶŐĚĞŵĂŶĚĨŽƌŚŽƵƐŝŶŐ͖ ůŽǁƌĞŶƚĂůǀĂĐĂŶĐLJƌĂƚĞ KWWKZdhE/d/^ X >ĂƌŐĞ͕ŝƚLJͲŽǁŶĞĚƐŝƚĞƐĂƚ ĞĂĐŚŽƵůĞǀĂƌĚĂŶĚ>ŝŶĐŽůŶ ǀĞŶƵĞŽīĞƌƉŽƚĞŶƟĂůĨŽƌ ĐĂƚĂůLJƟĐĚĞǀĞůŽƉŵĞŶƚƐ X ŝƐƚƌŝĐƚĐŽƵůĚĐĂƉŝƚĂůŝnjĞŽŶ ǀŝƐŝƚŽƌƐĨƌŽŵƵĞŶĂWĂƌŬĂŶĚ <ŶŽƩ͛ƐĞƌƌLJ&Ăƌŵ X ZĞĐĞŶƚƐĂůĞŽĨŵŽƚĞůŽŶĂůů ZŽĂĚĐŽƵůĚƐŝŐŶĂůĂŶĞǁ ǁĂǀĞŽĨŵŽƚĞůƉƌŽƉĞƌƚLJ ƌĞĚĞǀĞůŽƉŵĞŶƚ X /ŶĚĞƉĞŶĚĞŶƚƌĞƚĂŝůĐŽƵůĚ ƉŽƚĞŶƟĂůůLJůŽĐĂƚĞŝŶƐƚƌŝƉ ŵĂůůĐĞŶƚĞƌƐĂƚĐŽŵƉĞƟƟǀĞ ƌĞŶƚƐ X EĞǁŵĂƌŬĞƚƌĂƚĞƌĞƐŝĚĞŶƟĂů ĐŽƵůĚƐƚůŽĐĂů ĚĞŵŽŐƌĂƉŚŝĐƐƚŽĂƩƌĂĐƚ ƌĞƚĂŝůĞƌƐSWOT AnalysisSTRENGTHS OPPORTUNITIES WEAKNESSES | THREATS (SWOT) HEARING DRAFT OCTOBER 2018 |CONTEXT | 41 3 ƚŚĞƌĞŵĂLJďĞƐŽŵĞƉŽƚĞŶƟĂůĨŽƌtĞƐƚŶĂŚĞŝŵ͕ĂŶĚ ƐƉĞĐŝĮĐĂůůLJĞĂĐŚŽƵůĞǀĂƌĚ͕ƚŽĂƩƌĂĐƚ<ŶŽƩ͛ƐĞƌƌLJ &ĂƌŵǀŝƐŝƚŽƌƐƚŽŶĞǁĂŵĞŶŝƟĞƐƚŚĂƚďĞŶĞĮƚďŽƚŚ ƚŽƵƌŝƐƚƐĂŶĚƚŚĞůŽĐĂůĐŽŵŵƵŶŝƚLJ͘ Health Care in Focus ĞƐƉŝƚĞ ƚŚĞƐĞ ƐĞƚďĂĐŬƐ ŝŶ tĞƐƚ ŶĂŚĞŝŵ͕ ŚĞĂůƚŚ ĐĂƌĞŚĂƐŶŽŶĞƚŚĞůĞƐƐďĞĞŶĂƌĂƉŝĚůLJŐƌŽǁŝŶŐƐĞĐƚŽƌ ŶĂƟŽŶǁŝĚĞ͘dŚŝƐŝƐĚƌŝǀĞŶďLJĂŶƵŵďĞƌŽĨĨĂĐƚŽƌƐ͕ ŝŶĐůƵĚŝŶŐĂŶĂŐŝŶŐďĂďLJŵĞƌƉŽƉƵůĂƟŽŶ͘dŚĞƐĞ ĚĞŵŽŐƌĂƉŚŝĐĐŚĂŶŐĞƐƐƵŐŐĞƐƚƚŚĂƚƚŚĞŚĞĂůƚŚĐĂƌĞ ƐĞĐƚŽƌǁŝůůůŝŬĞůLJĐŽŶƟŶƵĞƚŽŐƌŽǁ͘ ,ĞĂůƚŚĐĂƌĞŽĐĐƵƉĂƟŽŶƐĂŶĚŝŶĚƵƐƚƌŝĞƐĂƌĞĞdžƉĞĐƚĞĚ ƚŽĂĚĚƚŚĞŵŽƐƚũŽďƐŽĨĂŶLJEŽƌƚŚŵĞƌŝĐĂŶ/ŶĚƵƐƚƌLJ ůĂƐƐŝĮĐĂƟŽŶ^LJƐƚĞŵ;E/^ͿŝŶĚƵƐƚƌLJƐĞĐƚŽƌďĞƚǁĞĞŶ ϮϬϭϰĂŶĚϮϬϮϰ͕ĂĐĐŽƌĚŝŶŐƚŽƚŚĞh͘^͘ƵƌĞĂƵŽĨ>ĂďŽƌ ^ƚĂƟƐƟĐƐ͘ dŚĞ ƐĞĐƚŽƌ͛Ɛ ŵŽƐƚ ĐŽŵŵŽŶ ŽĐĐƵƉĂƟŽŶƐ ŝŶĐůƵĚĞƌĞŐŝƐƚĞƌĞĚŶƵƌƐĞƐ͕ŶƵƌƐĞĂƐƐŝƐƚĂŶƚƐ͕ƉĞƌƐŽŶĂů ĐĂƌĞ ĂŝĚĞƐ͕ ĂŶĚ ŚŽŵĞ ŚĞĂůƚŚ ĂŝĚĞƐ͘ /Ŷ ϮϬϭϲ͕ tĞƐƚ ŶĂŚĞŝŵ ũŽďƐ ŝŶ ŚĞĂůƚŚ ĐĂƌĞ ƉĂŝĚ ĂŶ ĂǀĞƌĂŐĞ ŽĨ Ψϯϳ͕ϮϭϯƉĞƌLJĞĂƌ͘ ƐƐƵĐŚ͕ŚĞĂůƚŚĐĂƌĞŝƐƚŚĞƐĞĐŽŶĚͲŚŝŐŚĞƐƚƉĂLJŝŶŐ ŽĨ tĞƐƚ ŶĂŚĞŝŵ͛Ɛ ƚŽƉ ĮǀĞ ŝŶĚƵƐƚƌŝĞƐ͕ ƚƌĂŝůŝŶŐ ŽŶůLJ 'ŽǀĞƌŶŵĞŶƚ Ăƚ Ψϲϯ͕ϭϲϭ͘ tĂŐĞƐ ŝŶ ƌĞƚĂŝů ĂŶĚ ĂĐĐŽŵŵŽĚĂƟŽŶ ĂŶĚ ĨŽŽĚ ƐĞƌǀŝĐĞƐ͕ ďLJ ĐŽŶƚƌĂƐƚ͕ ĂǀĞƌĂŐĞĚΨϮϵ͕ϳϵϱĂŶĚΨϭϳ͕ϴϵϵ͕ƌĞƐƉĞĐƟǀĞůLJ͘ 3.3.4 Labor Force Employed Residents by Industry /ŶϮϬϭϱ͕ƚŚĞƌĞǁĞƌĞĂƉƉƌŽdžŝŵĂƚĞůLJϰϱ͕ϭϮϮũŽďƐŚĞůĚďLJ ǁŽƌŬŝŶŐƌĞƐŝĚĞŶƚƐůŝǀŝŶŐŝŶtĞƐƚŶĂŚĞŝŵ͘ĐĐŽƌĚŝŶŐ ƚŽ >, ĚĂƚĂ͕ ϭϯ͘ϱ ƉĞƌĐĞŶƚ ŽĨ ũŽďƐ ŚĞůĚ ďLJ tĞƐƚ ŶĂŚĞŝŵƌĞƐŝĚĞŶƚƐĂƌĞůŽĐĂƚĞĚǁŝƚŚŝŶƚŚĞůĂƌŐĞƌŝƚLJ ŽĨŶĂŚĞŝŵ͘dŚŝƐŝŶĚŝĐĂƚĞƐƚŚĂƚĂƉƉƌŽdžŝŵĂƚĞůLJϴϲ͘ϱ ƉĞƌĐĞŶƚŽĨũŽďƐŚĞůĚďLJtĞƐƚŶĂŚĞŝŵƌĞƐŝĚĞŶƚƐĂƌĞ ůŽĐĂƚĞĚŽƵƚƐŝĚĞƚŚĞĐŝƚLJŝŶŽƚŚĞƌũƵƌŝƐĚŝĐƟŽŶƐ͕ŝŶĐůƵĚŝŶŐ >ŽƐŶŐĞůĞƐ;ϳ͘ϴƉĞƌĐĞŶƚͿ͕/ƌǀŝŶĞ;ϱ͘ϳƉĞƌĐĞŶƚͿ͕^ĂŶƚĂ ŶĂ;ϱ͘ϳƉĞƌĐĞŶƚͿ͕KƌĂŶŐĞ;ϰ͘ϬƉĞƌĐĞŶƚͿ͕ĂŶĚ'ĂƌĚĞŶ 'ƌŽǀĞ;ϯ͘ϵƉĞƌĐĞŶƚͿ͘ dŚĞŝŶĚƵƐƚƌŝĞƐƚŚĂƚĞŵƉůŽLJĞĚƚŚĞŚŝŐŚĞƐƚƉƌŽƉŽƌƟŽŶ ŽĨ ǁŽƌŬŝŶŐ tĞƐƚ ŶĂŚĞŝŵ ƌĞƐŝĚĞŶƚƐ ;ƌĞŐĂƌĚůĞƐƐ ŽĨ ũŽď ůŽĐĂƟŽŶͿ ǁĞƌĞ ŚĞĂůƚŚ ĐĂƌĞ ;ϭϯ͘ϵ ƉĞƌĐĞŶƚͿ͕ ĂĐĐŽŵŵŽĚĂƟŽŶ ĂŶĚ ĨŽŽĚ ƐĞƌǀŝĐĞƐ ;ϭϭ͘ϳ ƉĞƌĐĞŶƚͿ͕ ĂŶĚŵĂŶƵĨĂĐƚƵƌŝŶŐ;ϭϬ͘ϴƉĞƌĐĞŶƚͿ͘ƐŶŽƚĞĚŝŶdĂďůĞ ϯͲϮ͕ŵƉůŽLJŵĞŶƚďLJ/ŶĚƵƐƚƌLJ͕ϮϬϭϱ͕ƚŚĞƌĞĂƌĞŚŝŐŚĞƌ ƉĞƌĐĞŶƚĂŐĞƐ ŽĨ tĞƐƚ ŶĂŚĞŝŵ ƌĞƐŝĚĞŶƚƐ ǁŽƌŬŝŶŐ ŝŶ ƚŚĞƐĞ ŝŶĚƵƐƚƌŝĞƐ ƚŚĂŶ ŝŶ ƚŚĞ ŝƚLJ ŽǀĞƌĂůů͘ dŚĞƐĞ t<E^^^ X WĞƌĐĞŝǀĞĚůĂĐŬŽĨƐĂĨĞƚLJ͖ŚŝŐŚ ǀŽůƵŵĞŽĨƉŽůŝĐĞĐĂůůƐƉƵƚƐ ĚƌĂŝŶŽŶĐŝƚLJƌĞƐŽƵƌĐĞƐ X ,ŝŐŚůĂŶĚƉƌŝĐĞƐƉŽƚĞŶƟĂůůLJ ůŝŵŝƚŶĞǁĚĞǀĞůŽƉŵĞŶƚ ĨĞĂƐŝďŝůŝƚLJ X ZĞůĂƟǀĞůLJůŽǁŵĞĚŝĂŶ ŚŽƵƐĞŚŽůĚŝŶĐŽŵĞƐĂŶĚ ĞĚƵĐĂƟŽŶĂůĂƩĂŝŶŵĞŶƚ ŵĂŬĞƐĂƩƌĂĐƟŶŐŶĞǁƌĞƚĂŝů ĐŚĂůůĞŶŐŝŶŐ X >ĂĐŬŽĨĂŶŝĚĞŶƟĮĂďůĞ ͞ďƌĂŶĚ͟ŽƌƌĞƚĂŝůĚĞƐƟŶĂƟŽŶ͖ ůŝƩůĞĐŽŽƌĚŝŶĂƟŽŶĂŵŽŶŐ ŵĞƌĐŚĂŶƚƐ X hŶĚĞƌƉĞƌĨŽƌŵŝŶŐŽĸĐĞ ĂŶĚŵĞĚŝĐĂůƐƉĂĐĞǁŝƚŚ ƐŝŐŶŝĮĐĂŶƚǀĂĐĂŶĐŝĞƐ X džŝƐƟŶŐƌĞƚĂŝůĐŽŶĮŐƵƌĂƟŽŶƐ ĨŽůůŽǁĂƐƚƌŝƉŵĂůůĨŽƌŵĂƚ ŶŽƚĐŽŶĚƵĐŝǀĞƚŽƉĞĚĞƐƚƌŝĂŶ ĂĐƟǀŝƚLJ d,Zd^ X >ĂĐŬŽĨĚŝǀĞƌƐŝĮĐĂƟŽŶ͗ ŵƉůŽLJŵĞŶƚĚŽŵŝŶĂƚĞĚďLJ ŚĞĂůƚŚĐĂƌĞŝŶĚƵƐƚƌLJ;ϯϵйŽĨ ƚŽƚĂůũŽďƐͿ X ŽŶƟŶƵĞĚƌĞƚĂŝůůĞĂŬĂŐĞƚŽ ŶĞŝŐŚďŽƌŝŶŐũƵƌŝƐĚŝĐƟŽŶƐ X īŽƌĚĂďůĞŚŽƵƐŝŶŐĂŶĚ ŚŽŵĞůĞƐƐŶĞƐƐĐƌŝƐŝƐĂƚƚŚĞ ƌĞŐŝŽŶĂůůĞǀĞů SWOT AnalysisSTRENGTHS OPPORTUNITIES WEAKNESSES | THREATS (SWOT) 42 | CONTEXT | HEARING DRAFT OCTOBER 2018 WEST ANAHEIM CITY OF ANAHEIM /Eh^dZzΈΉEMPLOYMENT PERCENT EMPLOYMENT PERCENT ŐƌŝĐƵůƚƵƌĞ͕&ŽƌĞƐƚƌLJ͕&ŝƐŚŝŶŐĂŶĚ,ƵŶƟŶŐ ϯϮϳ Ϭ͘ϳй ϭ͕ϭϬϰ Ϭ͘ϲй DŝŶŝŶŐ͕YƵĂƌƌLJŝŶŐ͕ĂŶĚKŝůĂŶĚ'ĂƐdžƚƌĂĐƟŽŶ ϰϱ Ϭ͘ϭй ϭϱϰ Ϭ͘ϭй hƟůŝƟĞƐ ϮϬϭ Ϭ͘ϰй ϴϬϰ Ϭ͘ϱй ŽŶƐƚƌƵĐƟŽŶ Ϯ͕Ϯϵϯ ϱ͘ϭй ϵ͕ϴϱϰ ϱ͘ϳй DĂŶƵĨĂĐƚƵƌŝŶŐ ϰ͕ϴϳϭ ϭϬ͘ϴй ϭϴ͕ϭϳϬ ϭϬ͘ϰй tŚŽůĞƐĂůĞdƌĂĚĞ Ϯ͕ϰϳϰϱ ͘ϱй ϵ͕ϴϵϲ ϱ͘ϳй ZĞƚĂŝůdƌĂĚĞ ϰ͕ϳϵϱ ϭϬ͘ϲй ϭϳ͕ϳϬϱ ϭϬ͘Ϯй dƌĂŶƐƉŽƌƚĂƟŽŶĂŶĚtĂƌĞŚŽƵƐŝŶŐ ϭ͕ϮϮϭ Ϯ͘ϳй ϰ͕ϴϮϵ Ϯ͘ϴй /ŶĨŽƌŵĂƟŽŶ ϴϳϬ ϭ͘ϵй ϯ͕ϰϲϯ Ϯ͘Ϭй &ŝŶĂŶĐĞĂŶĚ/ŶƐƵƌĂŶĐĞ ϭ͕ϱϵϯ ϯ͘ϱй ϲ͕ϲϲϰ ϯ͘ϴй ZĞĂůƐƚĂƚĞĂŶĚZĞŶƚĂůĂŶĚ>ĞĂƐŝŶŐ ϴϰϭ ϭ͘ϵй ϯ͕ϮϮϴ ϭ͘ϵй WƌŽĨĞƐƐŝŽŶĂůĂŶĚdĞĐŚŶŝĐĂů^ĞƌǀŝĐĞƐ Ϯ͕ϲϰϵ ϱ͘ϵй ϭϬ͕ϲϵϯ ϲ͘ϭй DĂŶĂŐĞŵĞŶƚŽĨŽŵƉĂŶŝĞƐĂŶĚŶƚĞƌƉƌŝƐĞƐ ϳϵϭ ϭ͘ϴй ϯ͕ϭϮϯ ϭ͘ϴй ĚŵŝŶŝƐƚƌĂƟǀĞ͕^ƵƉƉŽƌƚĂŶĚtĂƐƚĞ DĂŶĂŐĞŵĞŶƚ ϯ͕ϲϱϳ ϴ͘ϭй ϭϰ͕ϳϴϲ ϴ͘ϱй ĚƵĐĂƟŽŶĂů^ĞƌǀŝĐĞƐ Ϯ͕ϳϳϳ ϲ͘Ϯй ϭϮ͕ϭϲϵ ϳ͘Ϭй ,ĞĂůƚŚĂƌĞĂŶĚ^ŽĐŝĂůƐƐŝƐƚĂŶĐĞ ϲ͕Ϯϳϱ ϭϯ͘ϵй Ϯϭ͕ϳϬϱ ϭϮ͘ϱй ƌƚƐ͕ŶƚĞƌƚĂŝŶŵĞŶƚ͕ĂŶĚZĞĐƌĞĂƟŽŶ ϭ͕ϲϮϭ ϯ͘ϲй ϲ͕ϲϰϵ ϯ͘ϴй ĐĐŽŵŵŽĚĂƟŽŶĂŶĚ&ŽŽĚ^ĞƌǀŝĐĞƐ ϱ͕ϮϲϬ ϭϭ͘ϳй ϭϴ͕ϵϰϱ ϭϬ͘ϵй KƚŚĞƌ^ĞƌǀŝĐĞƐ;ĞdžĐĞƉƚWƵďůŝĐĚŵŝŶŝƐƚƌĂƟŽŶͿ ϭ͕ϯϵϴ ϯ͘ϭй ϱ͕ϭϵϱ ϯ͘Ϭй 'ŽǀĞƌŶŵĞŶƚ ϭ͕ϭϲϯ Ϯ͘ϲй ϱ͕Ϭϴϲ Ϯ͘ϵй TOTAL ϰϱ͕ϭϮϮ ϭϬϬ͘Ϭй ϭϳϰ͕ϮϮϮ ϭϬϬ͘Ϭй d>ϯͳϮZ^/EdDW>KzDEdz/Eh^dZz͕ϮϬϭϱ ^ŽƵƌĐĞ͗ĞŶƚĞƌĨŽƌĐŽŶŽŵŝĐ^ƚƵĚŝĞƐĂƚh͘^͘ĞŶƐƵƐƵƌĞĂƵ͖>ŽŶŐŝƚƵĚŝŶĂůͲŵƉůŽLJĞƌ,ŽƵƐĞŚŽůĚLJŶĂŵŝĐƐ͕ϮϬϭϰ͖͕ϮϬϭϳ͘ EŽƚĞƐ͗'ŽǀĞƌŶŵĞŶƚĞŵƉůŽLJŵĞŶƚŶƵŵďĞƌƐĨŽƌďŽƚŚtĞƐƚŶĂŚĞŝŵĂŶĚŝƚLJŽĨŶĂŚĞŝŵƌĞƉƌĞƐĞŶƚΗWƵďůŝĐĚŵŝŶŝƐƚƌĂƟŽŶΗĞŵƉůŽLJŵĞŶƚĚĂƚĂ͘ (A) Includes the number of Residents who work various industry sectors, regardless of job site. HEARING DRAFT OCTOBER 2018 |CONTEXT | 43 3 ZĞƚĂŝůĂŶĚKĸĐĞ ZĞƚĂŝůĞƌƐ ƚLJƉŝĐĂůůLJ ĨŽĐƵƐ ŽŶ ƉŽƉƵůĂƟŽŶ ĚĞŶƐŝƚLJ͕ ŝŶĐŽŵĞůĞǀĞůƐ͕ĂŶĚĞĚƵĐĂƟŽŶůĞǀĞůƐǁŚĞŶĐŚŽŽƐŝŶŐ ǁŚĞƌĞƚŽůŽĐĂƚĞ͖ƚŚĞƌĞĨŽƌĞ͕ƚŚĞƐĞĚĞŵŽŐƌĂƉŚŝĐƐŚĂǀĞ ƉŽƐĞĚĐŚĂůůĞŶŐĞƐĨŽƌĐĞƌƚĂŝŶƌĞƚĂŝůƚLJƉĞƐƚŚĂƚŵŝŐŚƚ ŽƚŚĞƌǁŝƐĞůŽĐĂƚĞŽŶƚŚĞĐŽƌƌŝĚŽƌ͘ĞƐƉŝƚĞƐŝŐŶŝĮĐĂŶƚ ĞdžŝƐƟŶŐ ůĞĂŬĂŐĞ ŝŶ ƐĞǀĞƌĂů ƌĞƚĂŝů ƐĞĐƚŽƌƐ͕ ŝŶĐůƵĚŝŶŐ ďƵŝůĚŝŶŐŵĂƚĞƌŝĂůƐ͕ĨŽŽĚĂŶĚďĞǀĞƌĂŐĞ͕ĂƉƉĂƌĞů͕ĂŶĚ ƐƉŽƌƟŶŐͬŚŽďďLJͬŬͬŵƵƐŝĐ ƐƵƉƉůŝĞƐ͕ ƚŚĞ ŚŝŐŚ ĐŽƐƚ ŽĨ ůĂŶĚ ĂůŽŶŐ ƚŚĞ ĐŽƌƌŝĚŽƌ ĂŶĚ ůŽǁĞƌͲƚŚĂŶͲĂǀĞƌĂŐĞ ŝŶĐŽŵĞƐ ŝŶĚŝĐĂƚĞ ƐŝŐŶŝĮĐĂŶƚ ŚƵƌĚůĞƐ ƚŽ ĂƩƌĂĐƟŶŐ ŶĞǁ ƌĞƚĂŝů ĚĞǀĞůŽƉŵĞŶƚ ĂůŽŶŐ ƚŚĞ ĐŽƌƌŝĚŽƌ͘ dŽ ďĞ ĮŶĂŶĐŝĂůůLJ ĨĞĂƐŝďůĞ͕ <D ƌĞƉŽƌƚĞĚ ƚŚĂƚ ĂŶLJ ŶĞǁ ĐŽŵŵĞƌĐŝĂůĚĞǀĞůŽƉŵĞŶƚǁŽƵůĚůŝŬĞůLJƌĞƋƵŝƌĞŵƵůƟͲ ƐƚŽƌLJĐŽŶĮŐƵƌĂƟŽŶƐŽƌƌĞůĂdžĞĚƉĂƌŬŝŶŐƌĞƋƵŝƌĞŵĞŶƚƐ͘ /Ŷ ϮϬϭϳ͕ ĐŽŵŵĞƌĐŝĂů ƉĂƌŬŝŶŐ ƌĞƋƵŝƌĞŵĞŶƚƐ ǁĞƌĞ ƌĞĚƵĐĞĚĐŝƚLJǁŝĚĞ͘EĞǁĚĞǀĞůŽƉŵĞŶƚŝŶƚŚĞ^WĂƌĞĂ ĐŽƵůĚƚĂŬĞĂĚǀĂŶƚĂŐĞŽĨƚŚĞƌĞĚƵĐĞĚƌĞƋƵŝƌĞŵĞŶƚƐ͘ dŚĞ<DƌĞƉŽƌƚĂůƐŽŶŽƚĞĚƚŚĂƚƚŚĞĐŽƌƌŝĚŽƌŝƐŶŽƚ ĐƵƌƌĞŶƚůLJǁĞůůƐƵŝƚĞĚĨŽƌŶĞǁŽĸĐĞĚĞǀĞůŽƉŵĞŶƚ͘ŶLJ ŐƌŽǁƚŚŝŶŽĸĐĞĚĞŵĂŶĚĨƌŽŵƚŚĞŵĞĚŝĐĂůƐĞĐƚŽƌ͕ĨŽƌ ĞdžĂŵƉůĞ͕ ĐŽƵůĚ ďĞ ĂďƐŽƌďĞĚ ďLJ ĞdžŝƐƟŶŐ ŝŶǀĞŶƚŽƌLJ ŽĨŽĸĐĞƐƉĂĐĞŐŝǀĞŶƚŚĞϮϯ͘ϰƉĞƌĐĞŶƚǀĂĐĂŶĐLJƌĂƚĞ ǁŝƚŚŝŶĂŽŶĞͲŵŝůĞƌĂĚŝƵƐŽĨƚŚĞĐŽƌƌŝĚŽƌ͘dŚƵƐ͕ĨŽƌŶĞǁ ŽĸĐĞĚĞǀĞůŽƉŵĞŶƚƚŽŽĐĐƵƌ͕ŝƚŝƐůŝŬĞůLJƚŚĂƚĞdžŝƐƟŶŐ ǀĂĐĂŶĐŝĞƐ ǁŽƵůĚ ŶĞĞĚ ƚŽ ďĞ ĮůůĞĚ ĮƌƐƚ͘ ,ŽǁĞǀĞƌ͕ ŵĞĚŝĐĂů ŽĸĐĞ ƚƌĞŶĚƐ ƐƵŐŐĞƐƚ ƚŚĂƚ ƚŚĞ ŵĂƌŬĞƚ ŝƐ ďŝĨƵƌĐĂƚĞĚ͕ǁŝƚŚŽůĚĞƌƐƉĂĐĞƐƌĞŵĂŝŶŝŶŐǀĂĐĂŶƚĚƵĞƚŽ ƚŚĞŝƌŝŶĂďŝůŝƚLJƚŽŵĞĞƚƚŚĞŶĞĞĚƐŽĨƵƐĞƌƐ͕ǁŚŽƌĞƋƵŝƌĞ ƐŵĂůůĞƌ͕ŵŽƌĞͲĐŽůůĂďŽƌĂƟǀĞƐƉĂĐĞ͘ ZĞƐŝĚĞŶƟĂů <DƉƌŽũĞĐƚƐĂŚĞĂůƚŚLJĂŵŽƵŶƚŽĨƌĞƐŝĚĞŶƟĂůĚĞŵĂŶĚ ŝŶƚŚĞĞĂĐŚŽƵůĞǀĂƌĚŵĂƌŬĞƚĂƌĞĂŽǀĞƌƚŚĞŶĞdžƚϭϱ LJĞĂƌƐ͕ƉĂƌƟĐƵůĂƌůLJĨŽƌĂƩĂĐŚĞĚƉƌŽĚƵĐƚĂƚŵŝĚͲďůŽĐŬ ůŽĐĂƟŽŶƐ͘EŽŶĞŽĨƚŚĞƌĞƐŝĚĞŶƟĂůƉƌŽƚŽƚLJƉĞƐĞdžƉůŽƌĞĚ ďLJ <D ƵůƟŵĂƚĞůLJ ƉĂƐƐĞĚ ƚŚĞ ĮŶĂŶĐŝĂů ĨĞĂƐŝďŝůŝƚLJ ƚĞƐƚŝĨƚŚĞLJŚĂĚƚŽĚŝƐƉůĂĐĞĞdžŝƐƟŶŐƌĞƐŝĚĞŶƟĂůƵƐĞƐ͘ ,ŽǁĞǀĞƌ͕ŶĞǁƌĞƐŝĚĞŶƟĂůŵŝŐŚƚďĞĨĞĂƐŝďůĞŝĨŝƚĐŽƵůĚ ďĞďƵŝůƚŽŶĐŽŵŵĞƌĐŝĂůůLJnjŽŶĞĚůĂŶĚ͕ǁŚŝĐŚĂƚƚŚĞ ƟŵĞŽĨƚŚĞƐƚƵĚLJƚƌĂĚĞĚĂƚΨϰϮͬƐĨǀĞƌƐƵƐƌĞƐŝĚĞŶƟĂů ůĂŶĚĂƚΨϴϳͬƐĨ͘ Opportunity Sites dǁŽ ŽƉƉŽƌƚƵŶŝƚLJ ĂƌĞĂƐ ŽŶ ƚŚĞ ŶŽƌƚŚĞĂƐƚ ĂŶĚ ƐŽƵƚŚĞĂƐƚĐŽƌŶĞƌƐŽĨĞĂĐŚŽƵůĞǀĂƌĚĂŶĚ>ŝŶĐŽůŶ ǀĞŶƵĞ ƉƌŽǀŝĚĞ ŶĞĂƌͲƚĞƌŵ ŽƉƉŽƌƚƵŶŝƟĞƐ ĨŽƌ ŶĞǁ ĚĞǀĞůŽƉŵĞŶƚ ĂůŽŶŐ ƚŚĞ ĐŽƌƌŝĚŽƌ͘ dŚĞ ŵĂũŽƌŝƚLJ ŽĨ ƚŚĞƐĞ ƉƌŽƉĞƌƟĞƐ ĂƌĞ ŝƚLJͲŽǁŶĞĚ ƉĂƌĐĞůƐ ƚŚĂƚ ǁŝůů ǁŽƌŬĞƌƐ ŵĂLJ ĮŶĚ tĞƐƚ ŶĂŚĞŝŵ ĂƩƌĂĐƟǀĞ ĚƵĞ ƚŽ ƌĞůĂƟǀĞ ŚŽƵƐŝŶŐ ĂīŽƌĚĂďŝůŝƚLJ ĂŶĚ ĂǀĂŝůĂďŝůŝƚLJ ĨŽƌ ĐĐŽŵŵŽĚĂƟŽŶĂŶĚ&ŽŽĚƐĞƌǀŝĐĞǁŽƌŬĞƌƐ͕ŽƌĚƵĞ ƚŽƉƌŽdžŝŵŝƚLJƚŽĞŵƉůŽLJŵĞŶƚĐĞŶƚĞƌƐĨŽƌ,ĞĂůƚŚĂƌĞ ǁŽƌŬĞƌƐ͘ /Ŷ ĂĚĚŝƟŽŶ͕ tĞƐƚ ŶĂŚĞŝŵ ǁŽƌŬĞƌƐ ĂƉƉĞĂƌ ƚŽ ďĞ ŽǀĞƌͲƌĞƉƌĞƐĞŶƚĞĚ ŝŶ ĚĞĐůŝŶŝŶŐ ŝŶĚƵƐƚƌŝĞƐ͘ tŚŝůĞ DĂŶƵĨĂĐƚƵƌŝŶŐŝƐŽŶĞŽĨƚŚĞůĂƌŐĞƐƚĞŵƉůŽLJĞƌƐŽĨtĞƐƚ ŶĂŚĞŝŵƌĞƐŝĚĞŶƚƐ͕ĨŽƌĞdžĂŵƉůĞ͕ŝƚǁĂƐŽŶĞŽĨƚŚĞĨĞǁ ŝŶĚƵƐƚƌŝĞƐŝŶŶĂŚĞŝŵƚŽƐĞĞĞŵƉůŽLJŵĞŶƚĚĞĐůŝŶĞƐ ďĞƚǁĞĞŶϮϬϭϭĂŶĚϮϬϭϲ͕ƐĞĞdĂďůĞϯͲϭ͕ŵƉůŽLJŵĞŶƚ ďLJ/ŶĚƵƐƚƌLJ͕ϮϬϭϭʹϮϬϭϲ͘dŚĞŝƚLJŵĂLJĐŽŶƐŝĚĞƌĞīŽƌƚƐ ŐĞĂƌĞĚĂƚĂůŝŐŶŝŶŐƚŚĞƐŬŝůůƐŽĨǁŽƌŬŝŶŐƌĞƐŝĚĞŶƚƐǁŝƚŚ ŐƌŽǁŝŶŐŝŶĚƵƐƚƌŝĞƐƚŚƌŽƵŐŚŽƵƚŶĂŚĞŝŵ͘ 'ŝǀĞŶƚŚĞŚŝŐŚůĞǀĞůŽĨŽƵƚͲĐŽŵŵƵƟŶŐƌĞƋƵŝƌĞĚĨŽƌ ŵŽƐƚǁŽƌŬŝŶŐtĞƐƚŶĂŚĞŝŵƌĞƐŝĚĞŶƚƐ͕ŝƚŵĂLJĂůƐŽďĞ ŝŵƉŽƌƚĂŶƚƚŽŝĚĞŶƟĨLJĂĐĐĞƐƐŝďůĞũŽďŽƉƉŽƌƚƵŶŝƟĞƐĂƚ ĞŵƉůŽLJŵĞŶƚŶŽĚĞƐŽƵƚƐŝĚĞƚŚĞĐŝƚLJ͘ 3.3.5 Real Estate and New Development dŚĞ ĐŽŵƉĂƌĂƟǀĞ ůĂĐŬ ŽĨ ŶĞǁ ĚĞǀĞůŽƉŵĞŶƚ ĂůŽŶŐ ĞĂĐŚŽƵůĞǀĂƌĚŚĂƐďĞĞŶĂƐŽƵƌĐĞŽĨĐŽŵŵƵŶŝƚLJ ĐŽŶĐĞƌŶĨŽƌƐŽŵĞƟŵĞ͘dŚĞĐŽƌƌŝĚŽƌǁĂƐŽŶĐĞŬŶŽǁŶ ĨŽƌĂīŽƌĚĂďůĞŵŽƚĞůƐĂŶĚƌŽĂĚƐŝĚĞĂƩƌĂĐƟŽŶƐŐĞĂƌĞĚ ƚŽǁĂƌĚ ƚƌĂǀĞůŝŶŐ ĨĂŵŝůŝĞƐ͘ ,ŽǁĞǀĞƌ͕ ŶĞǁ ĨƌĞĞǁĂLJƐ͕ ŝŶĐůƵĚŝŶŐ/ŶƚĞƌƐƚĂƚĞϱĂŶĚ^ƚĂƚĞZŽƵƚĞϵϭ͕ĞǀĞŶƚƵĂůůLJ ĚŝǀĞƌƚĞĚƚƌĂĸĐĂǁĂLJĨƌŽŵƐƚĂƚĞŚŝŐŚǁĂLJƐůŝŬĞĞĂĐŚ ŽƵůĞǀĂƌĚ͘ dŚŝƐ ůĂĐŬ ŽĨ ĨƌĞĞǁĂLJ ƉƌŽdžŝŵŝƚLJ ĂŶĚ ǀŝƐŝďŝůŝƚLJŚĂƐďĞĞŶĐŝƚĞĚďLJĚĞǀĞůŽƉĞƌƐĂƐĂƐŝnjĂďůĞ ŚƵƌĚůĞƚŽŶĞǁŽĸĐĞĂŶĚƌĞƚĂŝůĚĞǀĞůŽƉŵĞŶƚ͘dŚĞŝƚLJ ŽĨŶĂŚĞŝŵĐŽŵŵŝƐƐŝŽŶĞĚĂŵĂƌŬĞƚƐƚƵĚLJďLJ<ĞLJƐĞƌ DĂƌƐƚŽŶƐƐŽĐŝĂƚĞƐ;<DͿƚŽĞǀĂůƵĂƚĞĐƵƌƌĞŶƚŵĂƌŬĞƚ ĐŽŶĚŝƟŽŶƐĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ͕ŝĚĞŶƟĨLJůĂŶĚƵƐĞƐǁŝƚŚ ƚŚĞŐƌĞĂƚĞƐƚŵĂƌŬĞƚƐƵƉƉŽƌƚ͕ĂŶĚĂƐƐĞƐƐƚŚĞĮŶĂŶĐŝĂů ĨĞĂƐŝďŝůŝƚLJŽĨŶĞǁĚĞǀĞůŽƉŵĞŶƚ͘ ĞŵŽŐƌĂƉŚŝĐŽŶĚŝƟŽŶƐ dŚĞ<DƐƚƵĚLJŶŽƚĞĚƚŚĂƚŝŶϮϬϭϰ͕ƌĞƐŝĚĞŶƚƐŝŶƚŚĞŽŶĞͲ ŵŝůĞŵĂƌŬĞƚĂƌĞĂƐƵƌƌŽƵŶĚŝŶŐƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ ŽƌƌŝĚŽƌ ĞĂƌŶĞĚ Ă ŵĞĚŝĂŶ ŚŽƵƐĞŚŽůĚ ŝŶĐŽŵĞ ŽĨ Ψϰϵ͕ϱϴϬ͕ƐŝŐŶŝĮĐĂŶƚůLJůŽǁĞƌƚŚĂŶƚŚĞΨϱϵ͕ϵϯϬŵĞĚŝĂŶ ŝŶŶĂŚĞŝŵ͘DĞĂŶǁŚŝůĞ͕ϱϬ͘ϱƉĞƌĐĞŶƚŽĨŚŽƵƐĞŚŽůĚƐ ĞĂƌŶĞĚůĞƐƐƚŚĂŶΨϱϬ͕ϬϬϬƉĞƌLJĞĂƌ͕ĐŽŵƉĂƌĞĚƚŽϰϯ͘Ϯ ƉĞƌĐĞŶƚ ŝŶ ŶĂŚĞŝŵ͘ /Ŷ ĂĚĚŝƟŽŶ͕ ϭϵ͘ϭ ƉĞƌĐĞŶƚ ŽĨ tĞƐƚŶĂŚĞŝŵƌĞƐŝĚĞŶƚƐŽǀĞƌϮϱLJĞĂƌƐŚĂĚƌĞĐĞŝǀĞĚ Ă ďĂĐŚĞůŽƌ͛Ɛ ĚĞŐƌĞĞ Žƌ ŚŝŐŚĞƌ͕ ĐŽŵƉĂƌĞĚ ƚŽ Ϯϯ͘ϳ ƉĞƌĐĞŶƚŝŶŶĂŚĞŝŵ͘ 44 | CONTEXT | HEARING DRAFT OCTOBER 2018 ďƌŝŶŐĂŶĞǁĞƌĂŽĨĚĞǀĞůŽƉŵĞŶƚƚŽtĞƐƚŶĂŚĞŝŵ͘ tĞƐƚŐĂƚĞ dŚĞĚĞǀĞůŽƉŵĞŶƚŽƵƚĐŽŵĞŽĨƚŚĞϮϱͲĂĐƌĞtĞƐƚŐĂƚĞ ƐŝƚĞǁŝůůŚĂǀĞĂĚƌĂŵĂƟĐ ŝŵƉĂĐƚ ŽŶ ƚŚĞ ĐŽƌƌŝĚŽƌ͛Ɛ ƌĞǀŝƚĂůŝnjĂƟŽŶĞīŽƌƚƐ͘ƐĂĨŽƌŵĞƌůĂŶĚĮůů͕ƚŚĞĐƵƌƌĞŶƚůLJ ǀĂĐĂŶƚƐŝƚĞŝƐŽǁŶĞĚďLJƚŚĞŝƚLJΖƐ^ƵĐĐĞƐƐŽƌŐĞŶĐLJ ĂŶĚ ŝƚƐ ĚĞǀĞůŽƉŵĞŶƚ ƉŽƐĞƐ ƐĞǀĞƌĂů ĞŶǀŝƌŽŶŵĞŶƚĂů ĐŚĂůůĞŶŐĞƐ͘ EŽŶĞƚŚĞůĞƐƐ͕ ƚŚĞ tĞƐƚŐĂƚĞ ƉĂƌĐĞů ŝƐ Ă ŵĂũŽƌĂƐƐĞƚƚŚĂƚĐĂŶďĞůĞǀĞƌĂŐĞĚƚŽĐĂƚĂůLJnjĞŶĞǁ ĚĞǀĞůŽƉŵĞŶƚĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ͘tĞƐƚŐĂƚĞΖƐƐŝnjĞĂůŽŶĞ ĞůŝŵŝŶĂƚĞƐƚŚĞŶĞĞĚĨŽƌƉĂƌĐĞůĂƐƐĞŵďůLJ͕ĂĐŽŵƉůĞdž ƉƌŽĐĞƐƐƚŚĂƚŽŌĞŶƉƌĞƐĞŶƚƐĂƐŝŐŶŝĮĐĂŶƚŽďƐƚĂĐůĞĨŽƌ ŶĞǁ͕ĐĂƚĂůLJƟĐĚĞǀĞůŽƉŵĞŶƚ͘ ƐĂŝƚLJͲĐŽŶƚƌŽůůĞĚƉƌŽƉĞƌƚLJ͕ĂŶƵŵďĞƌŽĨ ĚĞǀĞůŽƉŵĞŶƚ ŽƉƉŽƌƚƵŶŝƟĞƐ ĐŽƵůĚ ďĞ ĞdžƉůŽƌĞĚ ƚŽ ĞdžƉĞĚŝƚĞ ƚŚĞ ƉƌŽĐĞƐƐ ŽĨ ďƌŝŶŐŝŶŐ ŝŶ ŵƵĐŚͲŶĞĞĚĞĚ ƌĞƚĂŝůĂŶĚΗĚĞƐƟŶĂƟŽŶΗƵƐĞƐƚŚĂƚĂƩƌĂĐƚǀŝƐŝƚŽƌƐĨƌŽŵ ŶĞĂƌďLJƚŽƵƌŝƐƚƐŝƚĞƐ͘hŶĚĞƌƚŚĞŵŽƐƚƌĞĐĞŶƚŝƐƉŽƐŝƟŽŶ ĂŶĚ ĞǀĞůŽƉŵĞŶƚ ŐƌĞĞŵĞŶƚ͕ ƚŚĞ ĚĞǀĞůŽƉĞƌ ƉůĂŶƐ ƚŽĐŽŶƐƚƌƵĐƚĂŶĂƉƉƌŽdžŝŵĂƚĞůLJϮϱϬ͕ϬϬϬƐƋƵĂƌĞĨŽŽƚ ƌĞƚĂŝůĐĞŶƚĞƌ͘ƉŽƌƟŽŶ ŽĨ ƚŚĞ ƐŝƚĞ ĐŽƵůĚ ĂůƐŽ ďĞ ĐŽŶƐŝĚĞƌĞĚ ĨŽƌ ŵŝdžĞĚͲƵƐĞ ĚĞǀĞůŽƉŵĞŶƚ͕ ĂĐƟǀĂƟŶŐ ƚŚĞ>ŝŶĐŽůŶǀĞŶƵĞƐƚƌĞĞƚĨƌŽŶƚĂŐĞǁŝƚŚƌĞƐŝĚĞŶƟĂů ƵƐĞƐ͘^ĞĞŚĂƉƚĞƌϰ͕dŚĞWůĂŶ͕ĨŽƌŵŽƌĞŝŶĨŽƌŵĂƟŽŶ ƌĞŐĂƌĚŝŶŐ ƚŚĞ ^W ĚĞǀĞůŽƉŵĞŶƚ ĂƌĞĂƐ ĂŶĚ ĂƌĞĂƐ ůŝŬĞůLJƚŽĐŚĂŶŐĞ͘ ^ŝůǀĞƌDŽŽŶĂŶĚĚũŽŝŶŝŶŐWĂƌĐĞůƐ >ŽĐĂƚĞĚĂƚƚŚĞƐŽƵƚŚĞĂƐƚĐŽƌŶĞƌŽĨĞĂĐŚŽƵůĞǀĂƌĚ ĂŶĚ >ŝŶĐŽůŶ ǀĞŶƵĞ͕ ƚŚƌĞĞ ƉĂƌĐĞůƐ ĞdžƚĞŶĚŝŶŐ ĨƌŽŵ ƚŚĞtĞƐƚŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌƚŽƚŚĞŝŶƚĞƌƐĞĐƟŽŶ ĂƌĞĂŶŽƚŚĞƌŽƉƉŽƌƚƵŶŝƚLJƚŽƐƉƵƌŶĞǁĚĞǀĞůŽƉŵĞŶƚŝŶ ƚŚĞĂƌĞĂ͘KǁŶĞĚďLJƚŚĞŶĂŚĞŝŵŚŽƵƐŝŶŐĂƵƚŚŽƌŝƚLJ͕ ƚŚĞ ǀĂĐĂŶƚ ƉĂƌĐĞů ĂĚũĂĐĞŶƚ ƚŽ ƚŚĞ zŽƵƚŚ ĞŶƚĞƌ ŝƐ ĂŶŽƉƉŽƌƚƵŶŝƚLJĨŽƌŶĞǁŵŝdžĞĚͲƵƐĞŽƌƌĞƐŝĚĞŶƟĂů ĚĞǀĞůŽƉŵĞŶƚ͘ sĂĐĂŶƚŝƚLJͲŽǁŶĞĚƉĂƌĐĞůƐƐƵĐŚĂƐƚŚĞtĞƐƚŐĂƚĞĂŶĚĨŽƌŵĞƌ^ŝůǀĞƌDŽŽŶ ƐŝƚĞƐĂƌĞŽƉƉŽƌƚƵŶŝƟĞƐƚŽƐƉƵƌŶĞĂƌͲƚĞƌŵĐŚĂŶŐĞĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ͘ DEVELOPMENT CONSIDERATIONS ZĞƚĂŝůĞƌƐƚLJƉŝĐĂůůLJĨŽĐƵƐŽŶƉŽƉƵůĂƟŽŶĚĞŶƐŝƚLJ͕ ŝŶĐŽŵĞ ůĞǀĞůƐ͕ ĂŶĚ ĞĚƵĐĂƟŽŶ ůĞǀĞůƐ ǁŚĞŶ ĐŚŽŽƐŝŶŐǁŚĞƌĞƚŽůŽĐĂƚĞ͘ ƐŝĚĞĨƌŽŵĚĞŵĂŶĚ͕ŶĞǁĚĞǀĞůŽƉŵĞŶƚƌĞƋƵŝƌĞƐ local rents and prices to cover development and ŽƉĞƌĂƟŶŐĐŽƐƚƐ͘ WĞƌĐĞƉƟŽŶƐĂďŽƵƚƚŚĞĨƵƚƵƌĞƐƚƌĞŶŐƚŚŽĨƚŚĞ ŵĂƌŬĞƚ ǁŝůů ĂůƐŽ ĨĂĐƚŽƌ ŝŶƚŽ ĚĞǀĞůŽƉŵĞŶƚ decisions.ĞĂĐŚŽƵůĞǀĂƌĚ&ŽƌŵĞƌ ^ŝůǀĞƌDŽŽŶ ^ŝƚĞ >ŝŶĐŽůŶǀĞŶƵĞ tĞƐƚŐĂƚĞ^ŝƚĞ HEARING DRAFT OCTOBER 2018 |CONTEXT | 45 3 3.4 EXISTING SUSTAINABILITY EFFORTS dŚŝƐ ƐĞĐƟŽŶ ƉƌŽǀŝĚĞƐ ĂŶ ŽǀĞƌǀŝĞǁ ŽĨ ƚŚĞ ĞdžŝƐƟŶŐ ĂŶĚ ŽŶŐŽŝŶŐ ĞīŽƌƚƐ ƚŽ ƉƌŽŵŽƚĞ ƐƵƐƚĂŝŶĂďůĞ ůŝǀŝŶŐ ĂŶĚ ĚĞǀĞůŽƉŵĞŶƚ ŝŶ ďŽƚŚ ƚŚĞ ^W ĂƌĞĂ ĂŶĚ ƚŚĞ ŝƚLJŽĨŶĂŚĞŝŵ͘/ƚĂůƐŽŚŝŐŚůŝŐŚƚƐƐƚĂƚĞĂŶĚƌĞŐŝŽŶĂů ƐƵƐƚĂŝŶĂďůĞ ƉůĂŶŶŝŶŐ ƉƌŝŽƌŝƟĞƐ ĂŶĚ ŐŽĂůƐ ƚŚĂƚ ƚŚĞ ^WŝƐŝŶƚĞŶĚĞĚƚŽĂĚĚƌĞƐƐ͘ 3.4.1 Existing Sustainability Programs Ŷ džŝƐƟŶŐ ŽŶĚŝƟŽŶƐ ZĞƉŽƌƚ ŽŶ ^ƵƐƚĂŝŶĂďŝůŝƚLJ ;ƉƉĞŶĚŝdžͿ ǁĂƐƉƌĞƉĂƌĞĚƚŽŝŶĨŽƌŵƚŚĞ^WŽĨƚŚĞ ŽƉƉŽƌƚƵŶŝƟĞƐƚŽƉƌŽŵŽƚĞƐƵƐƚĂŝŶĂďůĞĚĞǀĞůŽƉŵĞŶƚ ĂŶĚ ƉƌĂĐƟĐĞƐ ǁŝƚŚŝŶ ƚŚĞ ƐƚƵĚLJ ĂƌĞĂ͘ dŚĞ ŝƚLJ ŽĨ ŶĂŚĞŝŵ ŚĂƐ ďĞĞŶ ĂŶĚ ĐŽŶƟŶƵĞƐ ƚŽ ďĞ Ă ůĞĂĚĞƌ ŝŶ ƐƵƐƚĂŝŶĂďŝůŝƚLJ ĂŶĚ ƌĞƐŽƵƌĐĞ ĞĸĐŝĞŶĐLJ͘ ĞůŽǁ ŝƐ Ă ƐƵŵŵĂƌLJ ŽĨ ƚŚĞ ĞdžŝƐƟŶŐ ƉƌŽŐƌĂŵƐ ŽīĞƌĞĚ ďLJ ŶĂŚĞŝŵWƵďůŝĐhƟůŝƟĞƐ͘ /Ŷϭϵϳϵ͕ƚŚĞŝƚLJƚŽŽŬŽŶƚŚĞƌĞƐƉŽŶƐŝďŝůŝƚLJŽĨƉƌŽǀŝĚŝŶŐ ǁĂƚĞƌƚŽŝƚƐƌĞƐŝĚĞŶƚƐ͕ĂŶĚŝŶϭϵϴϰ͕ŶĂŚĞŝŵďƵŝůƚƚŚĞ ĮƌƐƚŵƵŶŝĐŝƉĂůĞůĞĐƚƌŝĐĂůƵƟůŝƚLJŝŶ^ŽƵƚŚĞƌŶĂůŝĨŽƌŶŝĂ͘ dŽĚĂLJ͕ǁĂƚĞƌĂŶĚĞůĞĐƚƌŝĐŝƚLJĐŽŶƟŶƵĞƚŽďĞƉƌŽǀŝĚĞĚ ďLJ ŶĂŚĞŝŵ WƵďůŝĐ hƟůŝƟĞƐ ;WhͿ͕ Ă ĚĞƉĂƌƚŵĞŶƚ ǁŝƚŚŝŶƚŚĞŝƚLJŽĨŶĂŚĞŝŵ͘WhƌĞĐĞŶƚůLJƵƉĚĂƚĞĚŝƚƐ ŝŶĐĞŶƟǀĞƐĂŶĚƌĞďĂƚĞƐĂŶĚŽƉĞƌĂƚĞƐĂƵƐĞƌͲĨƌŝĞŶĚůLJ ǁĞďƐŝƚĞƚŚĂƚĐŽŶŶĞĐƚƐƌĞƐŝĚĞŶƚƐĂŶĚďƵƐŝŶĞƐƐĞƐǁŝƚŚ ĂǀĂŝůĂďůĞŽīĞƌƐ͘ ŶĂŚĞŝŵ WƵďůŝĐ hƟůŝƟĞƐ /ŶĐĞŶƟǀĞ WƌŽŐƌĂŵƐ͘Wh ĐƵƌƌĞŶƚůLJŽīĞƌƐŵŽƌĞƚŚĂŶϰϱƌĞďĂƚĞƐĂŶĚŝŶĐĞŶƟǀĞ ƉƌŽŐƌĂŵƐ ƚŽ ŚĞůƉ ŶĂŚĞŝŵ ďƵƐŝŶĞƐƐĞƐ͕ ƌĞƐŝĚĞŶƚƐ͕ ĂŶĚŝŶĐŽŵĞͲƋƵĂůŝĮĞĚĐƵƐƚŽŵĞƌƐƐĂǀĞǁĂƚĞƌ͕ĞŶĞƌŐLJ͕ ĂŶĚŵŽŶĞLJ͘^ĞĞƉƉĞŶĚŝdž͕ŶĂŚĞŝŵWƵďůŝĐhƟůŝƚLJ /ŶĐĞŶƟǀĞƐĂŶĚZĞďĂƚĞƐ͕ĨŽƌĨƵƌƚŚĞƌĚĞƚĂŝůƐ͘ tĂƚĞƌŽŶƐĞƌǀĂƟŽŶ͘KŶDĂLJϭϵ͕ϮϬϭϱ͕ƚŚĞŶĂŚĞŝŵ ŝƚLJ ŽƵŶĐŝů ĂƉƉƌŽǀĞĚ ĂŶ ŽƌĚŝŶĂŶĐĞ ƚŽ ƌĞƐƚƌŝĐƚ ůĂŶĚƐĐĂƉĞǁĂƚĞƌŝŶŐƚŽƚǁŽĚĂLJƐƉĞƌǁĞĞŬŝŶĂŶĞīŽƌƚ ƚŽƌĞĚƵĐĞĚĂŝůLJǁĂƚĞƌƵƐĞĚƵƌŝŶŐƚŚĞĞdžŝƐƟŶŐĚƌŽƵŐŚƚ͘ dŚĞŽƌĚŝŶĂŶĐĞǁŝůůŚĞůƉŶĂŚĞŝŵĂĐŚŝĞǀĞŝƚƐƌĞƋƵŝƌĞĚ ǁĂƚĞƌƌĞĚƵĐƟŽŶƚĂƌŐĞƚŽĨϮϬƉĞƌĐĞŶƚƐĞƚďLJƚŚĞ^ƚĂƚĞ tĂƚĞƌZĞƐŽƵƌĐĞƐŽŶƚƌŽůŽĂƌĚ͘ ŶĂŚĞŝŵ͛Ɛ 'ƌĞĞŶŚŽƵƐĞ 'ĂƐ ZĞĚƵĐƟŽŶ WůĂŶ͗ ^ƵƐƚĂŝŶĂďůĞ ůĞĐƚƌŝĐŝƚLJ ĂŶĚ tĂƚĞƌ /ŶŝƟĂƟǀĞƐ͘Wh ĚĞǀĞůŽƉĞĚƚŚĞŝƚLJ͛Ɛ'ƌĞĞŶŚŽƵƐĞ'ĂƐ;','ͿZĞĚƵĐƟŽŶ WůĂŶ͕ǁŚŝĐŚǁĂƐĂƉƉƌŽǀĞĚďLJƚŚĞŝƚLJŽƵŶĐŝůŽŶ:ƵůLJ Ϯϭ͕ϮϬϭϱ͘dŚĞƉůĂŶŝĚĞŶƟĮĞƐƌĞĚƵĐƟŽŶŐŽĂůƐŽĨ',' ĞŵŝƐƐŝŽŶƐ ĨŽƌ ϮϬϮϬ ĂŶĚ ϮϬϯϬ ĂŶĚ ƉƌŽǀŝĚĞƐ Ă ƌŽĂĚ ^h^d/E>KDDhE/d/^ dŚĞ^WǁĂƐƉĂƌƟĂůůLJĨƵŶĚĞĚƚŚƌŽƵŐŚĂ ĂůŝĨŽƌŶŝĂ^ƚƌĂƚĞŐŝĐ'ƌŽǁƚŚŽƵŶĐŝů^ƵƐƚĂŝŶĂďůĞ ŽŵŵƵŶŝƟĞƐ WůĂŶŶŝŶŐ 'ƌĂŶƚ ĂŶĚ /ŶĐĞŶƟǀĞƐ Program. ^ddW>EE/E'WZ/KZ/d/^&KZ ^h^d/E/>/dz dŚĞ^ƉĞĐŝĮĐWůĂŶŝƐŝŶƚĞŶĚĞĚƚŽĂĐĐŽŵƉůŝƐŚƚŚĞ ^ƚĂƚĞ͛ƐWůĂŶŶŝŶŐWƌŝŽƌŝƟĞƐ͕ĂƐĨƵƌƚŚĞƌĚĞƐĐƌŝďĞĚ ŝŶ^ĞĐƟŽŶϲϱϬϰϭ͘ϭŽĨƚŚĞ'ŽǀĞƌŶŵĞŶƚŽĚĞ͕ƚŽ͗ X WƌŽŵŽƚĞŝŶĮůůĚĞǀĞůŽƉŵĞŶƚĂŶĚĞƋƵŝƚLJ ďLJƌĞŚĂďŝůŝƚĂƟŶŐ͕ŵĂŝŶƚĂŝŶŝŶŐ͕ĂŶĚ ŝŵƉƌŽǀŝŶŐĞdžŝƐƟŶŐŝŶĨƌĂƐƚƌƵĐƚƵƌĞ͖ X WƌŽƚĞĐƚ͕ƉƌĞƐĞƌǀĞĂŶĚĞŶŚĂŶĐĞ ĞŶǀŝƌŽŶŵĞŶƚĂůĂŶĚĂŐƌŝĐƵůƚƵƌĂůůĂŶĚƐ ĂŶĚŶĂƚƵƌĂůĂŶĚƌĞĐƌĞĂƟŽŶĂůƌĞƐŽƵƌĐĞƐ͖ ĂŶĚ͕ X ŶĐŽƵƌĂŐĞůŽĐĂƟŽŶĂŶĚƌĞƐŽƵƌĐĞ ĞĸĐŝĞŶƚĚĞǀĞůŽƉŵĞŶƚ͘ ^ddEZ'/KE>'K>^&KZ ^h^d/E/>/dz dŚĞ^WŝƐŵĞĂŶƚƚŽĨƵƌƚŚĞƌƚŚĞĨŽůůŽǁŝŶŐƐƚĂƚĞ ĂŶĚƌĞŐŝŽŶĂůŐŽĂůƐĨŽƌƉƌŽŵŽƟŶŐƐƵƐƚĂŝŶĂďŝůŝƚLJ͗ X ZĞĚƵĐĞŐƌĞĞŶŚŽƵƐĞŐĂƐĞŵŝƐƐŝŽŶƐƚŽ ĨƵƌƚŚĞƌƚŚĞŐŽĂůƐŽĨƐƐĞŵďůLJŝůů;Ϳ ϯϮ͖ĂŶĚ X /ŵƉůĞŵĞŶƚƚŚĞ^ŽƵƚŚĞƌŶĂůŝĨŽƌŶŝĂ ƐƐŽĐŝĂƟŽŶŽĨ'ŽǀĞƌŶŵĞŶƚƐ͛ZĞŐŝŽŶĂů dƌĂŶƐƉŽƌƚĂƟŽŶWůĂŶĂŶĚ^ƵƐƚĂŝŶĂďůĞ ŽŵŵƵŶŝƟĞƐ^ƚƌĂƚĞŐLJ;^'ZdWͬ^^Ϳ SUSTAINABLE PLANNING STATE/REGIONAL PRIORITIES AND GOALS 46 | CONTEXT | HEARING DRAFT OCTOBER 2018 CATEGORY hZZEd^ddh^ΈϮϬϭϱΉ ϮϬϮϬdZ'd^ ϮϬϯϬdZ'd^ Anaheim’s Power Supply EŽŶĞǁĐŽĂůŝŶǀĞƐƚŵĞŶƚƐ ϮϬй;ϰϴϬ͕ϬϬϬDdKϤĞͿ',' ĞŵŝƐƐŝŽŶƐƌĞĚƵĐƟŽŶĨƌŽŵϭϵϵϬ ďĂƐĞůŝŶĞůĞǀĞůƐĂŶŶƵĂůůLJ͘ ϰϬй;ϵϮϬ͕ϬϬϬDdKϤĞͿ',' ĞŵŝƐƐŝŽŶƐƌĞĚƵĐƟŽŶĨƌŽŵϭϵϵϬ ďĂƐĞůŝŶĞůĞǀĞůƐĂŶŶƵĂůůLJ͘ Department ZĞŶĞǁĂďůĞƐWŽƌƞŽůŝŽ Targets ĐŚŝĞǀĞĚϮϬйƌĞŶĞǁĂďůĞƐ ŵŝůĞƐƚŽŶĞ ϯϯйƌĞŶĞǁĂďůĞƐ ϰϬʹϱϬйƌĞŶĞǁĂďůĞƐ tĂƚĞƌŽŶƐĞƌǀĂƟŽŶ tĂƚĞƌĐŽŶƐĞƌǀĂƟŽŶŵĞĂƐƵƌĞƐ ŚĂǀĞĐŽŶƚƌŝďƵƚĞĚƚŽĂϭϳй ƌĞĚƵĐƟŽŶ ĞĐƌĞĂƐĞƉĞƌĐĂƉŝƚĂǁĂƚĞƌƵƐĞ ďLJϮϬй ĞĐƌĞĂƐĞƉĞƌĐĂƉŝƚĂǁĂƚĞƌƵƐĞ ďLJϮϱй Other Water Quality ĂŶĚŽŶƐĞƌǀĂƟŽŶ Targets ŽŶĚƵĐƚƐƚƵĚĞŶƚĞĚƵĐĂƟŽŶ ŽƵƚƌĞĂĐŚŽŶǁĂƚĞƌĐŽŶƐĞƌǀĂƟŽŶ ƚŽϭϯ͕ϬϬϬƐƚƵĚĞŶƚƐƉĞƌLJĞĂƌ ƵŵƵůĂƟǀĞǁĂƚĞƌƐĂǀŝŶŐƐŽĨϯϬ ŵŝůůŝŽŶŐĂůůŽŶƐ WƌĞǀĞŶƚǁĂƚĞƌƋƵĂůŝƚLJ ĚĞŐƌĂĚĂƟŽŶďLJĞīĞĐƟǀĞůLJ ŵŽŶŝƚŽƌŝŶŐĂŶĚŵŝƟŐĂƟŶŐ ƉŽƚĞŶƟĂůĐŽŶƚĂŵŝŶĂƟŽŶŝŶ ĚƌŝŶŬŝŶŐǁĂƚĞƌƐŽƵƌĐĞƐ /ŵƉůĞŵĞŶƚĞĚtĂƚĞƌZĞĐLJĐůŝŶŐ ĞŵŽŶƐƚƌĂƟŽŶ&ĂĐŝůŝƚLJ ŽŶĚƵĐƚƐƚƵĚĞŶƚĞĚƵĐĂƟŽŶ ŽƵƚƌĞĂĐŚŽŶǁĂƚĞƌĐŽŶƐĞƌǀĂƟŽŶ ƚŽϭϱ͕ϬϬϬƐƚƵĚĞŶƚƐƉĞƌLJĞĂƌ͘ ƵŵƵůĂƟǀĞǁĂƚĞƌƐĂǀŝŶŐƐŽĨϱϲ ŵŝůůŝŽŶŐĂůůŽŶƐ ^ĞĞŬĂĚĚŝƟŽŶĂůŽƉƉŽƌƚƵŶŝƟĞƐ ƚŽĞdžƚĞŶĚƌĞĐLJĐůĞĚǁĂƚĞƌŝŶ ŶĂŚĞŝŵ͖ĂƉƉůLJĨŽƌŐƌĂŶƚĨƵŶĚƐ ǁŚĞƌĞƉŽƐƐŝďůĞƚŽƌĞĚƵĐĞĐŽƐƚƐ ŽŶĚƵĐƚƐƚƵĚĞŶƚĞĚƵĐĂƟŽŶ ŽƵƚƌĞĂĐŚŽŶǁĂƚĞƌĐŽŶƐĞƌǀĂƟŽŶ ƚŽϮϬ͕ϬϬϬƐƚƵĚĞŶƚƐƉĞƌLJĞĂƌ͘ ƵŵƵůĂƟǀĞǁĂƚĞƌƐĂǀŝŶŐƐŽĨϭϮϬ ŵŝůůŝŽŶŐĂůůŽŶƐ ^ĞĞŬĂĚĚŝƟŽŶĂůŽƉƉŽƌƚƵŶŝƟĞƐ ƚŽĞdžƚĞŶĚƌĞĐLJĐůĞĚǁĂƚĞƌŝŶ ŶĂŚĞŝŵ͖ĂƉƉůLJĨŽƌŐƌĂŶƚĨƵŶĚƐ ǁŚĞƌĞƉŽƐƐŝďůĞƚŽƌĞĚƵĐĞĐŽƐƚƐ ŶĞƌŐLJĸĐŝĞŶĐLJ ϭϬйĞŶĞƌŐLJĞĸĐŝĞŶĐLJŽĨƌĞƚĂŝů ĐŽŶƐƵŵƉƟŽŶ ϭϱйĞŶĞƌŐLJĞĸĐŝĞŶĐLJŽĨƌĞƚĂŝů ĐŽŶƐƵŵƉƟŽŶ ϯϬйĞŶĞƌŐLJĞĸĐŝĞŶĐLJŽĨƌĞƚĂŝů ĐŽŶƐƵŵƉƟŽŶ School Energy ĸĐŝĞŶĐLJ ŽŶĚƵĐƚĞĚϯϬƐĐŚŽŽůĞŶĞƌŐLJ ĂƵĚŝƚƐĂŶĚƉƌŽǀŝĚĞĚƌĞďĂƚĞ ŽƉƉŽƌƚƵŶŝƟĞƐ ŽŶĚƵĐƚϱϬƐĐŚŽŽůĞŶĞƌŐLJĂƵĚŝƚƐ ĂŶĚƉƌŽǀŝĚĞƌĞďĂƚĞŽƉƉŽƌƚƵŶŝƟĞƐ ŽŶĚƵĐƚϴϬƐĐŚŽŽůĞŶĞƌŐLJĂƵĚŝƚƐ ĂŶĚƉƌŽǀŝĚĞƌĞďĂƚĞŽƉƉŽƌƚƵŶŝƟĞƐ Photovoltaic Systems, Homes and Businesses ϭϲ͕ϬϬϬ<tŽĨWsƐLJƐƚĞŵƐ ŝŶƐƚĂůůĞĚ Ϯϳ͕ϬϬϬ<tŽĨWsƐLJƐƚĞŵƐ ŝŶƐƚĂůůĞĚ ϯϳ͕ϬϬϬ<tŽĨWsƐLJƐƚĞŵƐ ŝŶƐƚĂůůĞĚ Photovoltaic Systems, Schools ϵƐLJƐƚĞŵƐŝŶƐƚĂůůĞĚ ϭϰƐLJƐƚĞŵƐŝŶƐƚĂůůĞĚ ϮϰƐLJƐƚĞŵƐŝŶƐƚĂůůĞĚ ůĞĐƚƌŝĐdƌĂŶƐƉŽƌƚĂƟŽŶ ϵϬϬůŽǁŽƌnjĞƌŽĞŵŝƐƐŝŽŶƐ ǀĞŚŝĐůĞƐ Ϯ͕ϬϬϬůŽǁŽƌnjĞƌŽĞŵŝƐƐŝŽŶ ǀĞŚŝĐůĞƐ ϱ͕ϬϬϬůŽǁŽƌnjĞƌŽĞŵŝƐƐŝŽŶ ǀĞŚŝĐůĞƐ hƟůŝƚLJ&ůĞĞƚsĞŚŝĐůĞƐ ϮйůŽǁŽƌnjĞƌŽĞŵŝƐƐŝŽŶǀĞŚŝĐůĞƐ ϭϬйůŽǁŽƌnjĞƌŽĞŵŝƐƐŝŽŶǀĞŚŝĐůĞƐ ϮϬйůŽǁŽƌnjĞƌŽĞŵŝƐƐŝŽŶǀĞŚŝĐůĞƐ d>ϯͳϯ'ZE,Kh^'^Zhd/KE͗hZZEd^ddh^EdZ'd^͕ϮϬϭϱͳϮϬϯϬ ^ŽƵƌĐĞ͗'ƌĞĞŶŚŽƵƐĞ'ĂƐZĞĚƵĐƟŽŶWůĂŶ͗^ƵƐƚĂŝŶĂďůĞůĞĐƚƌŝĐΘtĂƚĞƌ/ŶŝƟĂƟǀĞƐ͕:ƵůLJϮϬϭϱ͕ŶĂŚĞŝŵWƵďůŝĐhƟůŝƟĞƐ͘ Notes: MTCO2e = metric tons of carbon dioxide equivalence; PV = photovoltaic HEARING DRAFT OCTOBER 2018 |CONTEXT | 47 3 ŵĂƉĨŽƌĨƵƌƚŚĞƌƌĞĚƵĐƟŽŶŽĨ','ĞŵŝƐƐŝŽŶƐĂŶĚĨŽƌ ĨŽƐƚĞƌŝŶŐ ŽƚŚĞƌ ƐƵƐƚĂŝŶĂďůĞ ŝŶŝƟĂƟǀĞƐ͘ dŚĞ ƉůĂŶ ŝƐ ŝŶƚĞŶĚĞĚƚŽďĞƵƉĚĂƚĞĚƉĞƌŝŽĚŝĐĂůůLJƚŽƌĞŇĞĐƚĐŚĂŶŐĞƐ ŝŶůĞŐŝƐůĂƟŽŶ͕ĞŵŝƐƐŝŽŶƐƚĂƌŐĞƚƐ͕ĂŶĚƉĞƌĨŽƌŵĂŶĐĞĂƐ WhƐĞĞŬƐǁĂLJƐƚŽĨƵƌƚŚĞƌƌĞĚƵĐĞ','ĞŵŝƐƐŝŽŶƐ͘ dŚĞ ƉůĂŶ ŝŶĐůƵĚĞƐ ĂŶ ŝŶǀĞŶƚŽƌLJ ŽĨ ŶĂŚĞŝŵ͛Ɛ ',' ƐŽƵƌĐĞƐ͗ • ůĞĐƚƌŝĐŝƚLJ͕ϯϮƉĞƌĐĞŶƚ • dƌĂŶƐƉŽƌƚĂƟŽŶ͕ϮϴƉĞƌĐĞŶƚ • /ŶĚƵƐƚƌLJ͕ϮϬƉĞƌĐĞŶƚ • ŽŵŵĞƌĐŝĂůĂŶĚZĞƐŝĚĞŶƟĂů͕ϭϬƉĞƌĐĞŶƚ • ŐƌŝĐƵůƚƵƌĞ͕ϭϬƉĞƌĐĞŶƚ ','ƌĞĚƵĐƟŽŶƚĂƌŐĞƚƐĨŽƌϮϬϮϬĂŶĚϮϬϯϬĨŽĐƵƐŽŶ ƚŚĞĨŽůůŽǁŝŶŐĂƌĞĂƐ͗ • ŶĂŚĞŝŵ͛ƐƉŽǁĞƌĂŶĚǁĂƚĞƌƐƵƉƉůLJ • ĞƉĂƌƚŵĞŶƚƌĞŶĞǁĂďůĞƉŽƌƞŽůŝŽƚĂƌŐĞƚƐ • tĂƚĞƌĐŽŶƐĞƌǀĂƟŽŶ • ƵŝůĚŝŶŐĞŶĞƌŐLJĞĸĐŝĞŶĐLJ • ^ŽůĂƌĞŶĞƌŐLJĨŽƌƐĐŚŽŽůƐ͕ŚŽŵĞƐ͕ĂŶĚ ďƵƐŝŶĞƐƐĞƐ • dƌĂŶƐƉŽƌƚĂƟŽŶ ĐĐŽƌĚŝŶŐƚŽƚŚĞ','ZĞĚƵĐƟŽŶWůĂŶ͕ƚŚĞŐƌĞĂƚĞƐƚ ','ƌĞĚƵĐƟŽŶƐǁŝůůĐŽŵĞĨƌŽŵƌĞĚƵĐŝŶŐƚŚĞĐĂƌďŽŶ ŝŶƚĞŶƐŝƚLJŽĨƚŚĞŝƚLJ͛ƐƉŽǁĞƌƐƵƉƉůLJ͘ƐƵŵŵĂƌLJŽĨ ƌĞůĞǀĂŶƚƌĞĚƵĐƟŽŶƚĂƌŐĞƚƐĂŶĚƚŚĞŝƌϮϬϭϱƐƚĂƚƵƐĂƌĞ ƉƌŽǀŝĚĞĚŝŶdĂďůĞϯͲϯ͕'ƌĞĞŶ,ŽƵƐĞ'ĂƐZĞĚƵĐƟŽŶ͗ ƵƌƌĞŶƚ^ƚĂƚƵƐĂŶĚdĂƌŐĞƚƐ͕ϮϬϭϱͲϮϬϯϬ͘ Electric Vehicle Charging. dŚĞ ŝƚLJ ŚĂƐ ƵƉĚĂƚĞĚ ŝƚƐ ŝŶĨƌĂƐƚƌƵĐƚƵƌĞ ĂŶĚ ƐƚƌĞĂŵůŝŶĞĚ ƉƌŽĐĞƐƐĞƐ ƚŽ ŝŶĐĞŶƟǀŝnjĞƚŚĞƵƐĞŽĨĞůĞĐƚƌŝĐǀĞŚŝĐůĞƐ;sƐͿ͘/Ŷ ϮϬϭϲ͕ƚŚĞŝƚLJĂĚŽƉƚĞĚĂŶŽƌĚŝŶĂŶĐĞƚŽĞƐƚĂďůŝƐŚĂ ƉƌŽĐĞƐƐ ƚŽ ĂůůŽǁ ĞůĞĐƚƌŝĐ ǀĞŚŝĐůĞ ĐŚĂƌŐŝŶŐ ƐƚĂƟŽŶƐ ŝŶĐŽŵƉůŝĂŶĐĞǁŝƚŚ^ƚĂƚĞůĂǁ͘dŚĞŝƚLJŽĨŶĂŚĞŝŵ͛Ɛ ǁĞďƐŝƚĞƉƌŽǀŝĚĞƐĞdžƚĞŶƐŝǀĞŝŶĨŽƌŵĂƟŽŶŽŶsƐĂŶĚ ŽīĞƌƐ ŝŶĐĞŶƟǀĞƐ ĨŽƌ ŝŶƐƚĂůůĂƟŽŶ ŽĨ s ĐŚĂƌŐĞƌƐ͘ ZĞďĂƚĞŽīĞƌƐǀĂƌLJLJĞĂƌďLJLJĞĂƌĂŶĚƚLJƉŝĐĂůůLJŽīĞƌ ƐĂǀŝŶŐƐĂƌŽƵŶĚΨϱϬϬƚŽĐƵƐƚŽŵĞƌƐǁŚŽŝŶƐƚĂůůĂůĞǀĞů ƚǁŽ ;ϮϰϬͲǀŽůƚͿ ƉůƵŐͲŝŶ s ĐŚĂƌŐĞƌ ĨŽƌ ƉƌŝǀĂƚĞ ƵƐĞ ĂŶĚΨϱ͕ϬϬϬ;ĨŽƌŐĞŶĞƌĂůͿƚŽΨϭϬ͕ϬϬϬ;ĨŽƌƐĐŚŽŽůƐĂŶĚ ĂīŽƌĚĂďůĞŚŽƵƐŝŶŐͿĨŽƌƉƵďůŝĐĂĐĐĞƐƐsĐŚĂƌŐĞƌƐ͘dŚĞ ƉƵďůŝĐĂĐĐĞƐƐsĐŚĂƌŐĞƌƌĞďĂƚĞƐĂƐƐŝƐƚĚĞǀĞůŽƉŵĞŶƚƐ ŝŶ ĐŽŵƉůĞƟŶŐ ƚŚĞŝƌ ĂůŝĨŽƌŶŝĂ 'ƌĞĞŶ ƵŝůĚŝŶŐ ŽĚĞ ƌĞƋƵŝƌĞŵĞŶƚƐ ĨŽƌ s ƌĞĂĚŝŶĞƐƐ ƉĂƌŬŝŶŐ ƐƉĂĐĞƐ͘ ůŝŐŝďůĞĞdžƉĞŶƐĞƐŝŶĐůƵĚĞƚŚĞĐŚĂƌŐĞƌƉƵƌĐŚĂƐĞƉƌŝĐĞ ĂŶĚŝŶƐƚĂůůĂƟŽŶƐĐŽƐƚƐ͘dŚĞŝƚLJŵĂLJĂůƐŽǁĂŝǀĞƚŚĞ ƉĞƌŵŝƚĂƉƉůŝĐĂƟŽŶĨĞĞƐ͘ 'ƌĞĞŶ ƵŝůĚŝŶŐ WƌŽŐƌĂŵͬ/ŶĐĞŶƟǀĞƐ͘ /ŶĐĞŶƟǀĞƐ ŝŶĐůƵĚĞΨϭ͕ϬϬϬƚŽΨ1Ϭ͕ϬϬϬƵƉŽŶĐĞƌƟĮĐĂƟŽŶďLJƚŚĞ h^ 'ƌĞĞŶ ƵŝůĚŝŶŐ ŽƵŶĐŝů ;ŝ͘Ğ͕͘ >Ϳ͕ ĂůŝĨŽƌŶŝĂ 'ƌĞĞŶƵŝůĚ͕ƵŝůĚ/ƚ'ƌĞĞŶ͕ŽƌŽƚŚĞƌƌĂƟŶŐƉƌŽŐƌĂŵƐ͖ ĚĞƐŝŐŶƌĞǀŝĞǁĂƐƐŝƐƚĂŶĐĞƚŚƌŽƵŐŚŶĞǁĐŽŶƐƚƌƵĐƟŽŶ ƉƌŽŐƌĂŵ͖ĂŶĚƉŽƐƐŝďůĞƌĞŝŵďƵƌƐĞŵĞŶƚŽĨŝŶŝƟĂůŐƌĞĞŶ ďƵŝůĚŝŶŐĂŶĚĞdžƉĞĚŝƚĞĚƉůĂŶĐŚĞĐŬĨĞĞƐ͘ DƵůƟͲĨĂŵŝůLJĂŶĚīŽƌĚĂďůĞ,ŽƵƐŝŶŐ'ƌĞĞŶƵŝůĚŝŶŐ WƌŽŐƌĂŵ /ŶĐĞŶƟǀĞƐ͘ /ŶĐĞŶƟǀĞƐ ĂƌĞ ƉƌŽǀŝĚĞĚ ŽŶ Ă ƉĞƌƵŶŝƚďĂƐŝƐƚŚƌŽƵŐŚĂƉŝĐŬͲůŝƐƚŽĨĞŶĞƌŐLJĞĸĐŝĞŶĐLJ ŵĞĂƐƵƌĞƐ ƚŚĂƚ ŐŽ ĂďŽǀĞ ĂŶĚ ďĞLJŽŶĚ dŝƚůĞ Ϯϰ͘ /ŶĐĞŶƟǀĞƐŚĞůƉĐŽǀĞƌƚŚĞĐŽƐƚŽĨŝŵƉƌŽǀŝŶŐďĞLJŽŶĚ dŝƚůĞϮϰĂŶĚǀĂƌLJLJĞĂƌďLJLJĞĂƌ͘ Green Power Program. WhŽīĞƌƐĂƉƌŽŐƌĂŵĐĂůůĞĚ ͞ƉƵƚLJŽƵƌƚǁŽĐĞŶƚƐŝŶ͟ƚŚƌŽƵŐŚƚŚĞ'ƌĞĞŶWŽǁĞƌ WƌŽŐƌĂŵ͘ƵƐƚŽŵĞƌƐǁŚŽǁŝƐŚƚŽŽīƐĞƚƚŚĞŝƌĐĂƌďŽŶ ĨŽŽƚƉƌŝŶƚƐĞůĞĐƚĂĐŽŶƚƌŝďƵƟŽŶůĞǀĞů;Ϯϱ͕ϱϬ͕ŽƌϭϬϬ ƉĞƌĐĞŶƚŽĨĞůĞĐƚƌŝĐŝƚLJƵƐĞͿ͘ĂƐĞĚŽŶƚŚĞƉĞƌĐĞŶƚĂŐĞ ĐŚŽƐĞŶ͕ ĂŶ ĂĚĚŝƟŽŶĂů ƚǁŽ ĐĞŶƚƐ ƉĞƌ ŬŝůŽǁĂƩͲŚŽƵƌ ;ŬtŚͿ ƵƐĞĚ ǁŝůů ďĞ ďŝůůĞĚ ƚŽ ƚŚĞ ĂĐĐŽƵŶƚ͘ &ƵŶĚƐ ĐŽůůĞĐƚĞĚ ŐŽ ƚŽǁĂƌĚƐ ƉƵƌĐŚĂƐŝŶŐ ŐĞŽƚŚĞƌŵĂů͕ ŚLJĚƌŽĞůĞĐƚƌŝĐ͕ ƐŽůĂƌ͕ ǁŝŶĚ͕ ĂŶĚ ŽƚŚĞƌ ĨŽƌŵƐ ŽĨ ƌĞŶĞǁĂďůĞĞŶĞƌŐLJŐĞŶĞƌĂƟŽŶ͘ &ĞĞĚŝŶdĂƌŝīWƌŽŐƌĂŵ͘dŚŝƐƉƌŽŐƌĂŵĂƐƐŝƐƚƐŶĂŚĞŝŵ ƌĞƐŝĚĞŶƚƐ ĂŶĚ ƌĞŶĞǁĂďůĞ ƌĞƐŽƵƌĐĞ ĚĞǀĞůŽƉĞƌƐ ƚŽ ůŽĐĂƚĞƌĞŶĞǁĂďůĞŐĞŶĞƌĂƟŽŶĨĂĐŝůŝƟĞƐŝŶŶĂŚĞŝŵ͛Ɛ ƐĞƌǀŝĐĞ ƚĞƌƌŝƚŽƌLJ ĂŶĚ ƚŽ ƐĞůů ƚŚĞŝƌ ĞŶĞƌŐLJ ŽƵƚƉƵƚ ƚŽ Wh͕ƚŚƵƐŚĞůƉŝŶŐŶĂŚĞŝŵŵĞĞƚŝƚƐƌĞŶĞǁĂďůĞ ĞŶĞƌŐLJƉƵƌĐŚĂƐĞƚĂƌŐĞƚƐ͘dŚĞĂŵŽƵŶƚŽĨĞŶĞƌŐLJƚŽ ďĞ ƉƵƌĐŚĂƐĞĚ ĨƌŽŵ ĐƵƐƚŽŵĞƌƐ ĂŶĚ ĚĞǀĞůŽƉĞƌƐ ŝƐ ĐƵƌƌĞŶƚůLJĐĂƉƉĞĚĂƚĞŝŐŚƚŵĞŐĂǁĂƩƐ͘ 'ƌĞĞŶŽŶŶĞĐƟŽŶZĞƐŽůƵƟŽŶĂŶĚhƉĚĂƚĞƐ͘/ŶϮϬϬϲ ƚŚĞ ŝƚLJ ŽƵŶĐŝů ĂĚŽƉƚĞĚ Ă ƌĞƐŽůƵƟŽŶ ĞƐƚĂďůŝƐŚŝŶŐ ĂƐĞƌŝĞƐŽĨŐŽĂůƐƚŚĂƚĂƌĞŐƌŽƵŶĚĞĚŝŶƚŚĞƉƌŝŶĐŝƉůĞƐ ŽĨ ĞŶǀŝƌŽŶŵĞŶƚĂů ƐŽƵŶĚŶĞƐƐ ĂŶĚ ƐƵƐƚĂŝŶĂďůĞ ĚĞǀĞůŽƉŵĞŶƚ͘dŚƌŽƵŐŚƚŚŝƐƉƌŽŐƌĂŵ͕ŝƚLJƌĞƐŝĚĞŶƚƐ ĐĂŶƚƌĂĐŬŶĂŚĞŝŵ͛ƐƉƌŽŐƌĞƐƐĂŶĚƐĞĞƚŚĞŵŽƐƚƌĞĐĞŶƚ ŐƌĞĞŶĚĞǀĞůŽƉŵĞŶƚƐ͘ ZĞŶĞǁĂďůĞ WŽƌƞŽůŝŽ ^ƚĂŶĚĂƌĚ͘/ŶƉƌŝůϮϬϭϭ͕ŶĞǁ ƐƚĂƚĞ ůĞŐŝƐůĂƟŽŶ ƌĞƋƵŝƌĞĚ Ăůů ƵƟůŝƟĞƐ ƚŽ ŵĞĞƚ Ă ϯϯ ƉĞƌĐĞŶƚ ZĞŶĞǁĂďůĞ WŽƌƞŽůŝŽ ^ƚĂŶĚĂƌĚ ;ZW^Ϳ ŐŽĂů ďLJϮϬϮϬ͘dŚĞŶĞǁZW^ŐŽĂůƐǁĞƌĞĂŶĂǀĞƌĂŐĞŽĨϮϬ ƉĞƌĐĞŶƚ ŽĨ ƌĞƚĂŝů ƐĂůĞƐ ĨƌŽŵ ƌĞŶĞǁĂďůĞ ƌĞƐŽƵƌĐĞƐ 48 | CONTEXT | HEARING DRAFT OCTOBER 2018 ĨŽƌƚŚĞƉĞƌŝŽĚϮϬϭϭʹϮϬϭϯ͕ϮϱƉĞƌĐĞŶƚďLJƚŚĞĞŶĚŽĨ ϮϬϭϲ͕ĂŶĚϯϯƉĞƌĐĞŶƚďLJƚŚĞĞŶĚŽĨϮϬϮϬ͘ĂĐŚLJĞĂƌ͕ ŶĂŚĞŝŵƉƌŽǀŝĚĞƐĂŶƵƉĚĂƚĞƚŽƚŚĞƉƌĞǀŝŽƵƐLJĞĂƌ͛Ɛ ZW^ ƉŽůŝĐLJ͕ ǁŚŝĐŚ ŝŶĐůƵĚĞƐ ĂŶ ƵƉĚĂƚĞĚ ZĞƐŽƵƌĐĞƐ WƌŽĐƵƌĞŵĞŶƚWůĂŶĂŶĚŶĨŽƌĐĞŵĞŶƚWƌŽŐƌĂŵ͘ Power Supply Mix.ŶĂŚĞŝŵƵƟůŝnjĞƐŵĂŶLJƐŽƵƌĐĞƐĨŽƌ ƉŽǁĞƌ͕ŝŶĐůƵĚŝŶŐƌĞŶĞǁĂďůĞƐŽƵƌĐĞƐƐƵĐŚĂƐďŝŽŵĂƐƐ ĂŶĚǁĂƐƚĞ͕ŐĞŽƚŚĞƌŵĂů͕ƐŵĂůůŚLJĚƌŽĞůĞĐƚƌŝĐ͕ƐŽůĂƌ͕ ĂŶĚǁŝŶĚ͘ Renewable Energy in Anaheim.ƐŽĨKĐƚŽďĞƌϭ͕ ϮϬϭϱ͕ŶĂŚĞŝŵ͛Ɛ^ŽůĂƌ/ŶĐĞŶƟǀĞƐWƌŽŐƌĂŵǁĂƐĨƵůůLJ ƐƵďƐĐƌŝďĞĚ ĂŶĚ ŶŽ ůŽŶŐĞƌ ĂĐĐĞƉƟŶŐ ĂƉƉůŝĐĂƟŽŶƐ͘ ŶĂŚĞŝŵ ŚĂƐ ŵĞƚ ŝƚƐ ƐƚĂƚĞ ůĞŐŝƐůĂƟǀĞ ŐŽĂů ŝŶ ƐŽůĂƌ ŝŶĐĞŶƟǀĞƐ ƐŝŶĐĞ ^ĞŶĂƚĞ ŝůů ϭ ;^ ϭͿ͕ ƚŚĞ DŝůůŝŽŶ ^ŽůĂƌZŽŽĨƐ/ŶŝƟĂƟǀĞ͕ǁĂƐƐŝŐŶĞĚďLJƚŚĞŐŽǀĞƌŶŽƌŝŶ ϮϬϬϲ͘ &ƌŽŵ ƚŚŝƐ ƉƌŽŐƌĂŵ͕ ŽǀĞƌ Ϯ͕ϬϬϬ ƐŽůĂƌ ĞŶĞƌŐLJ ƐLJƐƚĞŵƐ ƚŽƚĂůŝŶŐ ĂďŽƵƚ ϮϬ ŵĞŐĂǁĂƩƐ ǁŝůů ďĞ ďƵŝůƚ ƚŚƌŽƵŐŚŽƵƚ ŶĂŚĞŝŵ ďLJ ƚŚĞ ĞŶĚ ŽĨ ϮϬϭϲ͘ dŚĞƐĞ ƐLJƐƚĞŵƐǁŝůůƉƌŽĚƵĐĞĞŶŽƵŐŚĞŶĞƌŐLJƚŽƉŽǁĞƌĂůŵŽƐƚ ϳ͕ϬϬϬŚŽŵĞƐŝŶŶĂŚĞŝŵĂŶĚƌĞĚƵĐĞĐĂƌďŽŶĚŝŽdžŝĚĞ ďLJ Ϯ͕ϴϬϬ ŵĞƚƌŝĐ ƚŽŶƐ ĂŶŶƵĂůůLJ͘ dŚŽƵŐŚ ƚŚĞ ^ŽůĂƌ /ŶĐĞŶƟǀĞWƌŽŐƌĂŵŝƐĐůŽƐĞĚ͕ĐƵƐƚŽŵĞƌƐŝŶƚĞƌĞƐƚĞĚŝŶ ŝŶƐƚĂůůŝŶŐƐŽůĂƌĂƌĞƐƟůůĞůŝŐŝďůĞƚŽƉĂƌƟĐŝƉĂƚĞŝŶƚŚĞ EĞƚͲDĞƚĞƌŝŶŐWƌŽŐƌĂŵ͘^ĞĞƉƉĞŶĚŝdž͕ZĞŶĞǁĂďůĞ ŶĞƌŐLJŝŶŶĂŚĞŝŵ͕ĨŽƌĨƵƌƚŚĞƌĚĞƚĂŝůƐŽŶƚŚĞŝƚLJ͛Ɛ ƌĞŶĞǁĂďůĞĞŶĞƌŐLJƉƌŽũĞĐƚƐ͘ dŚĞŝƚLJΖƐŶĞƌŐLJ&ŝĞůĚŝƐĂƚŚƌĞĞĂĐƌĞĨĂĐŝůŝƚLJƚŚĂƚĐŽŵďŝŶĞƐŽƉĞŶ ƐƉĂĐĞ ǁŝƚŚ ƐŽůĂƌͲƉŽǁĞƌĞĚ ŐĞŶĞƌĂƟŽŶ ŽĨ ĞůĞĐƚƌŝĐŝƚLJ ĂŶĚ ǁĂƚĞƌ ƐĂǀŝŶŐƚĞĐŚŶŽůŽŐŝĞƐ͘dŚĞŽŶͲƐŝƚĞďŝůŝŶŐƵĂůŝŶƚĞƌƉƌĞƟǀĞĐĞŶƚĞƌ ĞĚƵĐĂƚĞƐ ǀŝƐŝƚŽƌƐ ĂďŽƵƚ ƚŚĞ ďĞŶĞĮƚƐ ŽĨ ƚŚĞ ƐŽůĂƌ ĞŶĞƌŐLJ ƐLJƐƚĞŵ ĂŶĚ ǁĂƚĞƌ ĐŽŶƐĞƌǀĂƟŽŶ ŵĞĂƐƵƌĞƐ ƵƐĞĚ Ăƚ ƚŚĞ ŶĞƌŐLJ &ŝĞůĚ͘ CHAPTER 4:THE PLAN 50 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ51 4 4.1 INTRODUCTION dŚŝƐĐŚĂƉƚĞƌĞƐƚĂďůŝƐŚĞƐƚŚĞŝŶƚĞŶƚŽĨƚŚĞ^ƉĞĐŝĮĐ WůĂŶŝŶƚĞƌŵƐŽĨĨƵƚƵƌĞůĂŶĚƵƐĞĨŽƌƚŚĞĞǀĞůŽƉŵĞŶƚ ƌĞĂƐ͕ŵŽďŝůŝƚLJ͕ƐƚƌĞĞƚƐĐĂƉĞ͕ƌĞĐƌĞĂƟŽŶĂŶĚŽƉĞŶ ƐƉĂĐĞ͕ĂŶĚŝŶĨƌĂƐƚƌƵĐƚƵƌĞŝŵƉƌŽǀĞŵĞŶƚƐĨŽƌƚŚĞ ĞĂĐŚ ŽƵůĞǀĂƌĚ ĐŽƌƌŝĚŽƌ͘ dŚĞ ƉƵƌƉŽƐĞ ŽĨ ƚŚŝƐ ĐŚĂƉƚĞƌŝƐƚŽůĂLJƚŚĞĨŽƵŶĚĂƟŽŶĨŽƌƚŚĞĚĞǀĞůŽƉŵĞŶƚ ƌĞŐƵůĂƟŽŶƐƉƌŽǀŝĚĞĚŝŶƚŚĞŶĂŚĞŝŵDƵŶŝĐŝƉĂůŽĚĞ ;DͿ͕^ĞĐƟŽŶϭϴ͘ϭϮϮ͘^ŽŵĞŵĂƚĞƌŝĂůŝƐŝŶƚĞŶĚĞĚƚŽ ďĞĚŝƌĞĐƟǀĞĂŶĚǁŝůůďĞŝŵƉůĞŵĞŶƚĞĚĂĐĐŽƌĚŝŶŐƚŽ ůĂŶŐƵĂŐĞĐŽŶƚĂŝŶĞĚŝŶƚŚŝƐĚŽĐƵŵĞŶƚ͘KƚŚĞƌŵĂƚĞƌŝĂů ŝƐĐŽŶĐĞƉƚƵĂůĂŶĚŝƐŝŶƚĞŶĚĞĚƚŽŐƵŝĚĞĂŶĚŶŽƚƌĞƐƚƌŝĐƚ ĐƌĞĂƟǀĞƐŽůƵƟŽŶƐ͘ dŚĞŬĞLJĐŽŵŵƵŶŝƚLJƚŚĞŵĞƐƚŚĂƚĞŵĞƌŐĞĚƚŚƌŽƵŐŚŽƵƚ ƚŚĞŽƵƚƌĞĂĐŚƉŚĂƐĞŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶƉƌŽĐĞƐƐĂƌĞ ĚĞŶŽƚĞĚďLJƚŚĞŝĐŽŶƐĨŽƵŶĚŽŶƚŚĞƌŝŐŚƚͲŚĂŶĚƐŝĚĞŽĨ ƚŚŝƐƉĂŐĞ͘ƐŶŽƚĞĚŝŶŚĂƉƚĞƌϮ͕<ĞLJdŚĞŵĞƐ͕sŝƐŝŽŶ͕ ĂŶĚWƌŝŶĐŝƉůĞƐ͕ƚŚĞƐĞƚŚĞŵĞƐ͕ŝŶĂĚĚŝƟŽŶƚŽƚŚĞǀŝƐŝŽŶ ĂŶĚ ŐƵŝĚŝŶŐ ƉƌŝŶĐŝƉůĞƐ͕ ƐŚĂƉĞĚ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ͘ dŚŝƐŚĂƉƚĞƌůĂLJƐŽƵƚƚŚĞĨƌĂŵĞǁŽƌŬƚŚĂƚǁŝůůŐƵŝĚĞ ĚĞǀĞůŽƉŵĞŶƚĂŶĚƐƉƵƌĐŚĂŶŐĞĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌͶ ďƌŝŶŐŝŶŐƚŚĞĐŽŵŵƵŶŝƚLJΖƐǀŝƐŝŽŶĨŽƌƚŚĞĨƵƚƵƌĞƚŽůŝĨĞ͘ 4.2 LAND USE >ĂŶĚ ƵƐĞ ĐŚĂŶŐĞ ŝƐ ƚŚĞ ƉƌŝŵĂƌLJ ĐĂƚĂůLJƐƚ ĨŽƌ ŶĞǁ ĚĞǀĞůŽƉŵĞŶƚ ŝŶ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ ĂƌĞĂ͘ EŝŶĞ ĞǀĞůŽƉŵĞŶƚƌĞĂƐĞƐƚĂďůŝƐŚůĂŶĚƵƐĞĨŽƌƚŚĞĐŽƌƌŝĚŽƌ͘ ĂĐŚĞǀĞůŽƉŵĞŶƚƌĞĂŝƐĞƐƐĞŶƟĂůůLJĂŶŝŶĚŝǀŝĚƵĂů njŽŶŝŶŐ ĚŝƐƚƌŝĐƚ͘ dŚĞ ůĂŶĚ ƵƐĞƐ ĞƐƚĂďůŝƐŚĞĚ ĨŽƌ ƚŚĞ ĞĂĐŚ ŽƵůĞǀĂƌĚ ĞǀĞůŽƉŵĞŶƚ ƌĞĂƐ ƌĂŶŐĞ ĨƌŽŵ ƌĞƐŝĚĞŶƟĂůƚŽĐŽŵŵĞƌĐŝĂůĂŶĚŝŶĐůƵĚĞŽƉƉŽƌƚƵŶŝƟĞƐ ĨŽƌǀĞƌƟĐĂůĂŶĚŚŽƌŝnjŽŶƚĂůŵŝdžĞĚͲƵƐĞ͕ƚŚƵƐƉƌŽǀŝĚŝŶŐ Ă ŇĞdžŝďůĞ ƉůĂŶ ƚŚĂƚ ĐĂŶ ĂĚĂƉƚ ƚŽ ĐŚĂŶŐŝŶŐ ŵĂƌŬĞƚ ĚĞŵĂŶĚƐ͘ 4.2.1 Development Areas dŚĞĨŽůůŽǁŝŶŐŝƐĂďƌŝĞĨĚĞƐĐƌŝƉƟŽŶŽĨĞĂĐŚ ĞǀĞůŽƉŵĞŶƚ ƌĞĂ͘ dŚĞ ůŽĐĂƟŽŶ ĂŶĚ ĞdžƚĞŶƚ ŽĨ ĞĂĐŚĞǀĞůŽƉŵĞŶƚƌĞĂŝƐƐŚŽǁŶŽŶ&ŝŐƵƌĞϰͲϭ͕ ĞǀĞůŽƉŵĞŶƚ ƌĞĂƐ͘ ^ĞĞ ƉƉĞŶĚŝdž ͗ŽŶŝŶŐ ĂŶĚ ĞǀĞůŽƉŵĞŶƚ ^ƚĂŶĚĂƌĚƐ͕ ĨŽƌ njŽŶŝŶŐ ƐƚĂŶĚĂƌĚƐ ĂŶĚ ďƵŝůĚŝŶŐƌĞƋƵŝƌĞŵĞŶƚƐ͘ 4 THE PLAN Health & Safety:&ŽĐƵƐŽŶŝŵƉƌŽǀŝŶŐ ƚŚĞŚĞĂůƚŚĂŶĚǁĞůĨĂƌĞŽĨŽƵƌ ƌĞƐŝĚĞŶƚƐ͘ Character & Place:ƌĞĂƚĞĂƐƚƌŽŶŐĞƌ ĐŽŵŵƵŶŝƚLJŝĚĞŶƟƚLJƚŚƌŽƵŐŚĚŝǀĞƌƐĞ ƉůĂĐĞŵĂŬŝŶŐƐƚƌĂƚĞŐŝĞƐ͘ Economy & Vitality:/ŶǀĞƐƚƌĞƐŽƵƌĐĞƐ ƚŽĂƩƌĂĐƚŶĞǁ͕ĐŽŵŵƵŶŝƚLJͲďĂĐŬĞĚ ďƵƐŝŶĞƐƐĞƐ͘ DŽďŝůŝƚLJKƉƟŽŶƐ͗WƌŽǀŝĚĞǀŝĂďůĞ ŵŽďŝůŝƚLJŽƉƟŽŶƐĨŽƌĂůů͘ <zKDDhE/dzd,D^ dŚƌŽƵŐŚŽƵƚƚŚŝƐĐŚĂƉƚĞƌƚŚĞĨŽůůŽǁŝŶŐŝĐŽŶƐĂƌĞ ƵƐĞĚƚŽŝŶĚŝĐĂƚĞǁŚĞŶĂƚŽƉŝĐĂĚĚƌĞƐƐĞƐĂŬĞLJ community theme. ŽŶĐĞƉƚƵĂů/ůůƵƐƚƌĂƟǀĞŽĨŶĞǁƌĞƐŝĚĞŶƟĂůŵĞĚŝƵŵĚĞǀĞůŽƉŵĞŶƚĂůŽŶŐ ĞĂĐŚŽƵůĞǀĂƌĚ͘ 52 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ ZĞƐŝĚĞŶƟĂů>ŽǁͲDĞĚŝƵŵ;ZͲ>DͿ ZĞƐŝĚĞŶƟĂů >ŽǁͲDĞĚŝƵŵ ĚĞǀĞůŽƉŵĞŶƚ ĂƌĞĂƐ ĂƌĞ ŝŶƚĞŶĚĞĚƚŽƉƌŽǀŝĚĞĂŶĂƩƌĂĐƟǀĞ͕ŚĞĂůƚŚLJ͕ĂŶĚƐĂĨĞ ĞŶǀŝƌŽŶŵĞŶƚĨŽƌĂƩĂĐŚĞĚƐŝŶŐůĞͲĨĂŵŝůLJĂŶĚŵƵůƟƉůĞ ĨĂŵŝůLJƵŶŝƚƐĂƐĞŝƚŚĞƌĐŽŶĚŽŵŝŶŝƵŵƐŽƌĂƉĂƌƚŵĞŶƚƐ͘ /ƚ ĂůůŽǁƐ ĨŽƌ Ă ƌĂŶŐĞ ŽĨ ŚŽƵƐŝŶŐ ƚLJƉĞƐ͕ ŝŶĐůƵĚŝŶŐ ĂƩĂĐŚĞĚƐŝŶŐůĞͲĨĂŵŝůLJƚŽǁŶŚŽƵƐĞƐ͕ĚƵƉůĞdžŽƌƚƌŝƉůĞdž ďƵŝůĚŝŶŐƐ͕ĐŽƵƌƚLJĂƌĚŚŽƵƐŝŶŐ͕ĂŶĚŵŽďŝůĞŚŽŵĞƉĂƌŬƐ͘ ZĞƐŝĚĞŶƟĂů ĚĞǀĞůŽƉŵĞŶƚ ŝƐ ƉĞƌŵŝƩĞĚ Ăƚ Ă ĚĞŶƐŝƚLJ ŽĨƵƉƚŽϭϴĚǁĞůůŝŶŐƵŶŝƚƐƉĞƌĂĐƌĞ͘dŚĞƵŶĚĞƌůLJŝŶŐ ŶĂŚĞŝŵ DƵŶŝĐŝƉĂů ŽĚĞ ďĂƐĞ njŽŶĞ ŝƐ ƚŚĞ ͞ZDͲϯ͟ DƵůƟƉůĞ&ĂŵŝůLJZĞƐŝĚĞŶƟĂůŽŶĞ͘/ĨƚŚĞƐƚĂŶĚĂƌĚƐŝŶ ƚŚŝƐ^ƉĞĐŝĮĐWůĂŶĂƌĞƐŝůĞŶƚŽŶĂƉĂƌƟĐƵůĂƌƚŽƉŝĐ͕ƚŚĞ ZDͲϯŽŶĞƐŚĂůůĂƉƉůLJ͘ ZĞƐŝĚĞŶƟĂůDĞĚŝƵŵ;ZͲDͿ ZĞƐŝĚĞŶƟĂůDĞĚŝƵŵĚĞǀĞůŽƉŵĞŶƚĂƌĞĂƐĂƌĞŝŶƚĞŶĚĞĚ ƚŽ ƉƌŽǀŝĚĞ ĨŽƌ ƋƵĂůŝƚLJ͕ ǁĞůůͲĚĞƐŝŐŶĞĚ ŵƵůƟĨĂŵŝůLJ ůŝǀŝŶŐ ĞŶǀŝƌŽŶŵĞŶƚƐ͕ ĂƐ ĞŝƚŚĞƌ ĐŽŶĚŽŵŝŶŝƵŵƐ Žƌ ĂƉĂƌƚŵĞŶƚƐ͕ŶĞĂƌƚƌĂŶƐŝƚĂŶĚŽƚŚĞƌƐĞƌǀŝĐĞƐ͘dŚĞƐĞ ĚĞǀĞůŽƉŵĞŶƚ ĂƌĞĂƐ ĂůůŽǁ ĨŽƌ Ă ǀĂƌŝĞƚLJ ŽĨ ŚŽƵƐŝŶŐ ƚLJƉĞƐ͕ŝŶĐůƵĚŝŶŐƚŽǁŶŚŽŵĞƐ͕ĐŽƵƌƚLJĂƌĚŚŽƵƐŝŶŐ͕ĂŶĚ ƐƚĂĐŬĞĚŇĂƚƐ͘ZĞƐŝĚĞŶƟĂůĚĞǀĞůŽƉŵĞŶƚŝƐƉĞƌŵŝƩĞĚ ĂƚĂĚĞŶƐŝƚLJŽĨƵƉƚŽϯϲĚǁĞůůŝŶŐƵŶŝƚƐƉĞƌĂĐƌĞ͘dŚĞ ƵŶĚĞƌůLJŝŶŐ ŶĂŚĞŝŵ DƵŶŝĐŝƉĂů ŽĚĞ ďĂƐĞ njŽŶĞ ŝƐ ƚŚĞ͞ZDͲϰ͟DƵůƟƉůĞ&ĂŵŝůLJZĞƐŝĚĞŶƟĂůŽŶĞ͘/ĨƚŚĞ ƐƚĂŶĚĂƌĚƐŝŶƚŚŝƐ^ƉĞĐŝĮĐWůĂŶĂƌĞƐŝůĞŶƚŽŶĂƉĂƌƟĐƵůĂƌ ƚŽƉŝĐ͕ƚŚĞZDͲϰŽŶĞƐŚĂůůĂƉƉůLJ͘ DŝdžĞĚͲhƐĞDĞĚŝƵŵ;DhͲDͿ DŝdžĞĚͲhƐĞDĞĚŝƵŵĚĞǀĞůŽƉŵĞŶƚĂƌĞĂƐĂƌĞŝŶƚĞŶĚĞĚ ƚŽ ĂůůŽǁ ŇĞdžŝďŝůŝƚLJ ŝŶ njŽŶŝŶŐ ĨŽƌ ƉĂƌĐĞůƐ ƚŚĂƚ ĐŽƵůĚ ƚƌĂŶƐŝƟŽŶĨƌŽŵƐƚƌŝƉĐŽŵŵĞƌĐŝĂůƵƐĞƐƚŽƌĞƐŝĚĞŶƟĂů Žƌ Ă ŵŝdž ŽĨ ƌĞƐŝĚĞŶƟĂů͕ ĐŽŵŵĞƌĐŝĂů͕ ĂŶĚ ŽĸĐĞ ĚĞǀĞůŽƉŵĞŶƚ͘dŚĞĚĞƐŝŐŶĂƟŽŶǁŽƵůĚĂůůŽǁƌĞƐŝĚĞŶƟĂů ŝŶĞŝƚŚĞƌĂƐƚĂŶĚĂůŽŶĞŽƌŵŝdžĞĚͲƵƐĞĐŽŶĮŐƵƌĂƟŽŶĂƚ ĂĚĞŶƐŝƚLJŽĨƵƉƚŽϯϲĚǁĞůůŝŶŐƵŶŝƚƐƉĞƌĂĐƌĞ͘ŵŝdž ŽĨ ĐŽŵŵĞƌĐŝĂů ƵƐĞƐ ǁŽƵůĚ ĐŽŶƟŶƵĞ ƚŽ ĂůůŽǁ ĨŽƌ Ă ƌĂŶŐĞŽĨĐŽŵŵƵŶŝƚLJͲƐĞƌǀŝŶŐƌĞƚĂŝů͕ŽĸĐĞ͕ĂŶĚƐĞƌǀŝĐĞ ĐŽŵŵĞƌĐŝĂůƵƐĞƐ͘dŚĞŶŽŶͲƌĞƐŝĚĞŶƟĂůĐŽŵƉŽŶĞŶƚŽĨ ŵŝdžĞĚͲƵƐĞĚĞǀĞůŽƉŵĞŶƚŝƐƉĞƌŵŝƩĞĚĂƚĂŵĂdžŝŵƵŵ ŇŽŽƌ ĂƌĞĂ ƌĂƟŽ ŽĨ Ϭ͘ϯϱ͘ dŚĞ ƵŶĚĞƌůLJŝŶŐ ŶĂŚĞŝŵ DƵŶŝĐŝƉĂůŽĚĞďĂƐĞnjŽŶĞŝƐƚŚĞ͞Dh͟DŝdžĞĚhƐĞ KǀĞƌůĂLJŽŶĞ͘/ĨƚŚĞƐƚĂŶĚĂƌĚƐŝŶƚŚŝƐ^ƉĞĐŝĮĐWůĂŶĂƌĞ ƐŝůĞŶƚŽŶĂƉĂƌƟĐƵůĂƌƚŽƉŝĐ͕ƚŚĞDhKǀĞƌůĂLJŽŶĞƐŚĂůů ĂƉƉůLJ͘ DŝdžĞĚͲhƐĞ,ŝŐŚ;DhͲ,Ϳ DŝdžĞĚͲhƐĞ,ŝŐŚĚĞǀĞůŽƉŵĞŶƚĂƌĞĂƐĂƌĞŝŶƚĞŶĚĞĚƚŽ ĂůůŽǁĂŵŝdžŽĨƵƐĞƐŝŶĐůƵĚŝŶŐƌĞƐŝĚĞŶƟĂů͕ĐŽŵŵĞƌĐŝĂů͕ ƐĞƌǀŝĐĞƐ͕ŚŽƚĞů͕ĂŶĚƉƌŽĨĞƐƐŝŽŶĂůŽĸĐĞƵƐĞƐŝŶĂŚŝŐŚͲ ƋƵĂůŝƚLJ ĞŶǀŝƌŽŶŵĞŶƚ͘ dŚĞ ĨŽĐƵƐ ŽĨ ƚŚŝƐ ĚĞƐŝŐŶĂƟŽŶ ŝƐ ŽŶ ĐƌĞĂƟŶŐ Ă ƉĞĚĞƐƚƌŝĂŶͲĨƌŝĞŶĚůLJ ĞŶǀŝƌŽŶŵĞŶƚ͕ ŝŶĐůƵĚŝŶŐ ŝŶĐƌĞĂƐĞĚ ĐŽŶŶĞĐƟǀŝƚLJ ĂŶĚ ĐŽŵŵƵŶŝƚLJ ŐĂƚŚĞƌŝŶŐ ƐƉĂĐĞƐ͘ hƐĞƐ ĂŶĚ ĂĐƟǀŝƟĞƐ ĂƌĞ ĚĞƐŝŐŶĞĚ ƚŽŐĞƚŚĞƌŝŶĂŶŝŶƚĞŐƌĂƚĞĚĨĂƐŚŝŽŶƚŽĐƌĞĂƚĞĂĚLJŶĂŵŝĐ ƵƌďĂŶ ĞŶǀŝƌŽŶŵĞŶƚ͘ ŽŶƟŶƵŽƵƐ ĐŽŵŵĞƌĐŝĂů ƐƚƌĞĞƚ ĨƌŽŶƚĂŐĞ ŽŶ ƚŚĞ ĮƌƐƚ ĂŶĚ͕ ƉĞƌŚĂƉƐ͕ ƐĞĐŽŶĚ ŇŽŽƌƐ͕ ƐƵƉƉŽƌƚĞĚ ďLJ ƌĞƐŝĚĞŶƟĂů ĂŶĚͬŽƌ ŽĸĐĞ ƵƐĞƐ ĂďŽǀĞ͕ ŝƐ ƚŚĞ ƚLJƉŝĐĂů ƉĂƩĞƌŶ ŽĨ ǀĞƌƟĐĂůůLJ ŵŝdžĞĚ ůĂŶĚ ƵƐĞ͘ hƐĞƐŵĂLJĂůƐŽďĞŵŝdžĞĚŝŶĂŚŽƌŝnjŽŶƚĂůŽƌŵƵůƟͲƵƐĞ ƉĂƩĞƌŶ͘^ƚĂŶĚͲĂůŽŶĞƵƐĞƐǁŝƚŚŝŶĂŵƵůƟͲƵƐĞƉƌŽũĞĐƚ ŶĞĞĚƚŽďĞŝŶƚĞŐƌĂƚĞĚŝŶƚŽĂŶŽǀĞƌĂůůƉƌŽũĞĐƚĚĞƐŝŐŶ ĂŶĚ ĐŽŶŶĞĐƚĞĚ ƚŽ ŽƚŚĞƌ ĂĚũŽŝŶŝŶŐ ƵƐĞƐ ďLJ ƉůĂnjĂƐ͕ ƉƌŽŵĞŶĂĚĞƐ͕ĂŶĚůĂŶĚƐĐĂƉĞĚĐŽƌƌŝĚŽƌƐ͕ĂŶĚƐŚŽƵůĚ ŝŶĐůƵĚĞĐŽŵŵŽŶĂƌĐŚŝƚĞĐƚƵƌĂůƚŚĞŵĞƐĂŶĚƐŝŐŶĂŐĞ͘ dLJƉŝĐĂůƌĞƐŝĚĞŶƟĂůƵƐĞƐĐŽƵůĚŝŶĐůƵĚĞƐƚĂĐŬĞĚŇĂƚƐ͕ ůŝǀĞͲǁŽƌŬ ƵŶŝƚƐ͕ ƚŽǁŶŚŽƵƐĞƐ͕ ĂŶĚ ĂƌƟƐƚͲƐƚLJůĞ ůŽŌƐ͘ ZĞƐŝĚĞŶƟĂůĚĞǀĞůŽƉŵĞŶƚŝŶƚŚĞƐĞĂƌĞĂƐĞŵƉŚĂƐŝnjĞƐ ƋƵĂůŝƚLJ ĂŶĚ ŽīĞƌƐ Ă ǀĂƌŝĞƚLJ ŽĨ ĂŵĞŶŝƟĞƐ͘ dŚĞ ƌĞƐŝĚĞŶƟĂů ĐŽŵƉŽŶĞŶƚ ŽĨ ŵŝdžĞĚͲƵƐĞ ĚĞǀĞůŽƉŵĞŶƚ ŝƐƉĞƌŵŝƩĞĚĂƚĂĚĞŶƐŝƚLJŽĨƵƉƚŽϲϬĚǁĞůůŝŶŐƵŶŝƚƐ ƉĞƌĂĐƌĞ͘dŚĞŶŽŶͲƌĞƐŝĚĞŶƟĂůĐŽŵƉŽŶĞŶƚŽĨŵŝdžĞĚͲ ƵƐĞĚĞǀĞůŽƉŵĞŶƚŝƐƉĞƌŵŝƩĞĚĂƚĂŵĂdžŝŵƵŵŇŽŽƌ ĂƌĞĂƌĂƟŽŽĨϬ͘ϯϱ͘dŚĞƵŶĚĞƌůLJŝŶŐŶĂŚĞŝŵDƵŶŝĐŝƉĂů ŽĚĞďĂƐĞnjŽŶĞŝƐƚŚĞ͞Dh͟DŝdžĞĚhƐĞKǀĞƌůĂLJŽŶĞ͘ /ĨƚŚĞƐƚĂŶĚĂƌĚƐŝŶƚŚŝƐ^ƉĞĐŝĮĐWůĂŶĂƌĞƐŝůĞŶƚŽŶĂ ƉĂƌƟĐƵůĂƌƚŽƉŝĐ͕ƚŚĞDhKǀĞƌůĂLJŽŶĞƐŚĂůůĂƉƉůLJ͘ EĞŝŐŚďŽƌŚŽŽĚŽŵŵĞƌĐŝĂů;EͲͿ EĞŝŐŚďŽƌŚŽŽĚ ŽŵŵĞƌĐŝĂů ĚĞǀĞůŽƉŵĞŶƚ ĂƌĞĂƐ ĂƌĞ ŝŶƚĞŶĚĞĚƚŽƉƌŽǀŝĚĞĨŽƌƚŚĞĚĂŝůLJƐŚŽƉƉŝŶŐ͕ĚŝŶŝŶŐ͕ ĂŶĚ ƐĞƌǀŝĐĞ ĐŽŵŵĞƌĐŝĂů ŶĞĞĚƐ ŽĨ ƚŚĞ ƐƵƌƌŽƵŶĚŝŶŐ ŶĞŝŐŚďŽƌŚŽŽĚƐ͘ ůůŽǁĞĚ ƵƐĞƐ ŝŶĐůƵĚĞ ƌĞƚĂŝů ĂŶĚ ƐĞƌǀŝĐĞƐƐƵĐŚĂƐŐƌŽĐĞƌLJƐƚŽƌĞƐ͕ƐƉĞĐŝĂůƚLJƐŚŽƉƐ͕ƐŵĂůů ƌĞƚĂŝůƐƚŽƌĞƐ͕ŚĂŝƌƐĂůŽŶƐ͕ĚƌLJĐůĞĂŶĞƌƐ͕ƌĞƐƚĂƵƌĂŶƚƐ͕ ĂŶĚ ĐŽīĞĞ ŚŽƵƐĞƐ͘ WƌŽũĞĐƚƐ ƐŚŽƵůĚ ďĞ ĚĞƐŝŐŶĞĚ ƚŽ ĞŶĐŽƵƌĂŐĞ ƉĞĚĞƐƚƌŝĂŶ ƵƐĞ ďLJ ƉƌŽǀŝĚŝŶŐ ŐŽŽĚ ĐŽŶŶĞĐƟǀŝƚLJ ǁŝƚŚŝŶ ĂŶĚ ƚŽ ƚŚĞ ƐŝƚĞ͕ ǁŝƚŚ ďƵŝůĚŝŶŐƐ ĐůƵƐƚĞƌĞĚ ĂŶĚ ĐůŽƐĞ ƚŽ ƚŚĞ ƐƚƌĞĞƚ͘ ĚĚŝƟŽŶĂůůLJ͕ ƉƌŽũĞĐƚƐ ƐŚŽƵůĚ ďĞ ĐŽŵƉĂƟďůĞ ŝŶ ƐĐĂůĞ ĂŶĚ ĚĞƐŝŐŶ ǁŝƚŚ ĂĚũĂĐĞŶƚ ƌĞƐŝĚĞŶƟĂů ĂƌĞĂƐ͘ ĞǀĞůŽƉŵĞŶƚ ŝƐ ƉĞƌŵŝƩĞĚĂƚĂŵĂdžŝŵƵŵŇŽŽƌĂƌĞĂƌĂƟŽŽĨϬ͘ϯϱ͘dŚĞ ƵŶĚĞƌůLJŝŶŐŶĂŚĞŝŵDƵŶŝĐŝƉĂůŽĚĞďĂƐĞnjŽŶĞĨŽƌŝƐ ƚŚĞ͞ͲE͟EĞŝŐŚďŽƌŚŽŽĚĞŶƚĞƌŽŵŵĞƌĐŝĂůŽŶĞ͘ /ĨƚŚĞƐƚĂŶĚĂƌĚƐŝŶƚŚŝƐ^ƉĞĐŝĮĐWůĂŶĂƌĞƐŝůĞŶƚŽŶĂ ƉĂƌƟĐƵůĂƌƚŽƉŝĐ͕ƚŚĞͲEŽŶĞƐŚĂůůĂƉƉůLJ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ53 4 ZĞŐŝŽŶĂůŽŵŵĞƌĐŝĂů;ZͲͿ dŚĞZĞŐŝŽŶĂůŽŵŵĞƌĐŝĂůŝƐŝŶƚĞŶĚĞĚƚŽƐĞƌǀĞĂůĂƌŐĞƌ ŵĂƌŬĞƚĂƌĞĂƚŚĂŶEĞŝŐŚďŽƌŚŽŽĚŽŵŵĞƌĐŝĂůĂƌĞĂƐ͘ 'ŝǀĞŶ ƚŚĞ ƌĞŐŝŽŶĂů ŶĂƚƵƌĞ ŽĨ ƚŚĞ ĞĂĐŚ ŽƵůĞǀĂƌĚ ĐŽƌƌŝĚŽƌĂŶĚƚŚĞƚŽƵƌŝƐŵŵĂƌŬĞƚƚŽƚŚĞŶŽƌƚŚŝŶƵĞŶĂ WĂƌŬ͕ ƚŚŝƐ ĚĞǀĞůŽƉŵĞŶƚ ĂƌĞĂ ĂůůŽǁƐ ĨŽƌ ůĂƌŐĞͲƐĐĂůĞ ĐŽŵŵĞƌĐŝĂů ƵƐĞƐ͕ ƐƉĞĐŝĂůƚLJ ƐƚŽƌĞƐ ĂŶĚ ƌĞƐƚĂƵƌĂŶƚƐ͕ Ă ƚŚĞĂƚĞƌ͕ ŚŽŵĞ ŐŽŽĚƐ ƐƚŽƌĞƐ͕ ĞŶƚĞƌƚĂŝŶŵĞŶƚ͕ ĐŽŵŵĞƌĐŝĂů ƌĞĐƌĞĂƟŽŶ͕ ĂŶĚ ŚŽƐƉŝƚĂůŝƚLJ ƵƐĞƐ ƚŚĂƚ ƐĞƌǀĞ Ă ďƌŽĂĚ ĂƌĞĂ͘ WƌŽũĞĐƚƐ ƐŚŽƵůĚ ďĞ ĚĞƐŝŐŶĞĚ ƚŽ ĞŶĐŽƵƌĂŐĞ ƉĞĚĞƐƚƌŝĂŶ ƵƐĞ ďLJ ƉƌŽǀŝĚŝŶŐ ŐŽŽĚ ĐŽŶŶĞĐƟǀŝƚLJ ǁŝƚŚŝŶ ĂŶĚ ƚŽ ƚŚĞ ƐŝƚĞ͕ ǁŝƚŚ ďƵŝůĚŝŶŐƐ ĐůƵƐƚĞƌĞĚ ĂŶĚ ĐůŽƐĞ ƚŽ ƚŚĞ ƐƚƌĞĞƚ͘ ĞǀĞůŽƉŵĞŶƚ ŝƐ ƉĞƌŵŝƩĞĚĂƚĂŵĂdžŝŵƵŵŇŽŽƌĂƌĞĂƌĂƟŽŽĨϬ͘ϯϱ͘dŚĞ ƵŶĚĞƌůLJŝŶŐŶĂŚĞŝŵDƵŶŝĐŝƉĂůŽĚĞďĂƐĞnjŽŶĞŝƐƚŚĞ ͞ͲZ͟ZĞŐŝŽŶĂůŽŵŵĞƌĐŝĂů͘/ĨƚŚĞƐƚĂŶĚĂƌĚƐŝŶƚŚŝƐ ^ƉĞĐŝĮĐWůĂŶĂƌĞƐŝůĞŶƚŽŶĂƉĂƌƟĐƵůĂƌƚŽƉŝĐ͕ƚŚĞͲZ ŽŶĞƐŚĂůůĂƉƉůLJ͘ KĸĐĞ;KͿ dŚĞ KĸĐĞ ĚĞǀĞůŽƉŵĞŶƚ ĂƌĞĂ ŝƐ ŝŶƚĞŶĚĞĚ ƚŽ ĂůůŽǁ Ă ǀĂƌŝĞƚLJ ŽĨ ƐŵĂůůͲƐĐĂůĞ ŽĸĐĞ ƵƐĞƐ͕ ŝŶĐůƵĚŝŶŐ ůĞŐĂů ƐĞƌǀŝĐĞƐ͕ŝŶƐƵƌĂŶĐĞƐĞƌǀŝĐĞƐ͕ƌĞĂůĞƐƚĂƚĞ͕ĂŶĚŵĞĚŝĐĂů Žƌ ĚĞŶƚĂů ŽĸĐĞƐ ĂŶĚ ŽƚŚĞƌ ƐƵƉƉŽƌƚ ƐĞƌǀŝĐĞƐ͘ dŚĞ ƵŶĚĞƌůLJŝŶŐŶĂŚĞŝŵDƵŶŝĐŝƉĂůŽĚĞďĂƐĞnjŽŶĞŝƐƚŚĞ ͞KͲ>͟KĸĐĞ>ŽǁŽŶĞ͘/ĨƚŚĞƐƚĂŶĚĂƌĚƐŝŶƚŚŝƐ^ƉĞĐŝĮĐ WůĂŶĂƌĞƐŝůĞŶƚŽŶĂƉĂƌƟĐƵůĂƌƚŽƉŝĐ͕ƚŚĞKͲ>ŽŶĞƐŚĂůů ĂƉƉůLJ͘ ^ĞŵŝͲWƵďůŝĐ;WͿ dŚĞ ^ĞŵŝͲWƵďůŝĐ ĚĞǀĞůŽƉŵĞŶƚ ĂƌĞĂ ŝƐ ŝŶƚĞŶĚĞĚ ƚŽ ĂĐĐŽŵŵŽĚĂƚĞ ŚŽƐƉŝƚĂů͕ ŶƵƌƐŝŶŐ ŚŽŵĞ͕ ĂƐƐŝƐƚĞĚ ůŝǀŝŶŐĨĂĐŝůŝƟĞƐ͕ĂƐǁĞůůĂƐŵĞĚŝĐĂůƌĞůĂƚĞĚƵƐĞƐŝŶĂ ĐůƵƐƚĞƌĞĚĂĐƟǀŝƚLJĐĞŶƚĞƌƚŽƐƵƉƉŽƌƚƚŚĞŚĞĂůƚŚĐĂƌĞ ŶĞĞĚƐŽĨtĞƐƚŶĂŚĞŝŵĂŶĚƚŚĞƐƵƌƌŽƵŶĚŝŶŐĂƌĞĂ͘ dŚĞƵŶĚĞƌůLJŝŶŐŶĂŚĞŝŵDƵŶŝĐŝƉĂůŽĚĞďĂƐĞnjŽŶĞ ŝƐƚŚĞ͞^W͟^ĞŵŝͲWƵďůŝĐŽŶĞ͘/ĨƚŚĞƐƚĂŶĚĂƌĚƐŝŶƚŚŝƐ ^ƉĞĐŝĮĐWůĂŶĂƌĞƐŝůĞŶƚŽŶĂƉĂƌƟĐƵůĂƌƚŽƉŝĐ͕ƚŚĞ^W ŽŶĞƐŚĂůůĂƉƉůLJ͘ WƵďůŝĐZĞĐƌĞĂƟŽŶĂů;WͲZͿ dŚĞWƵďůŝĐZĞĐƌĞĂƟŽŶĂůĚĞǀĞůŽƉŵĞŶƚĂƌĞĂŝƐŝŶƚĞŶĚĞĚ ƚŽƉƌŽǀŝĚĞĂĐƟǀĞĂŶĚƉĂƐƐŝǀĞƉƵďůŝĐƉĂƌŬĂŶĚŽƉĞŶ ƐƉĂĐĞ͕ ĂƌĞĂƐ ŝŶĐůƵĚŝŶŐ dǁŝůĂ ZĞŝĚ ĂŶĚ ^ĐŚǁĞŝƚnjĞƌ WĂƌŬƐ͕ĂƐǁĞůůĂƐƉƵďůŝĐĨĂĐŝůŝƟĞƐƐƵĐŚĂƐƚŚĞtĞƐƚ ŶĂŚĞŝŵ zŽƵƚŚ ĞŶƚĞƌ͘ dŚĞƐĞ ĂƌĞĂƐ ĂůƐŽ ŝŶĐůƵĚĞ ĂŶĐŝůůĂƌLJƉƵďůŝĐďƵŝůĚŝŶŐƐĂŶĚĨĂĐŝůŝƟĞƐ͕ƐƵĐŚĂƐĂĮƌĞ ƐƚĂƟŽŶĂŶĚƐŵĂůůƌĞĐƌĞĂƟŽŶďƵŝůĚŝŶŐƐ͘dŚĞƵŶĚĞƌůLJŝŶŐ ŶĂŚĞŝŵDƵŶŝĐŝƉĂůŽĚĞďĂƐĞnjŽŶĞŝƐƚŚĞ͞WZ͟WƵďůŝĐ ZĞĐƌĞĂƟŽŶĂůŽŶĞ͘/ĨƚŚĞƐƚĂŶĚĂƌĚƐŝŶƚŚŝƐ^ƉĞĐŝĮĐ WůĂŶĂƌĞƐŝůĞŶƚŽŶĂƉĂƌƟĐƵůĂƌƚŽƉŝĐ͕ƚŚĞWZŽŶĞƐŚĂůů ĂƉƉůLJ͘ ,ŽŵĞƐŝŶƚŚĞŶĂĐĂƉĂŶĞŝŐŚďŽƌŚŽŽĚǁĞƌĞďƵŝůƚĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ ĂĐƌŽƐƐĨƌŽŵƚŚĞtĞƐƚŐĂƚĞƐŝƚĞŝŶϮϬϬϲ͘dŚŝƐŶĞŝŐŚďŽƌŚŽŽĚŝƐůŽĐĂƚĞĚŝŶ ƚŚĞZĞƐŝĚĞŶƟĂů>ŽǁͲDĞĚŝƵŵĞǀĞůŽƉŵĞŶƚƌĞĂ͘ dŚĞtĞƐƚŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌƉƌŽǀŝĚĞƐLJŽƵƚŚŽƌŝĞŶƚĞĚƉƌŽŐƌĂŵƐ ŝŶĐůƵĚŝŶŐƐƉŽƌƚƐ͕ĂŌĞƌƐĐŚŽŽůĐĂƌĞ͕ĂŶĚƐĞĂƐŽŶĂůĂĐƟǀŝƟĞƐ͘dŚĞLJŽƵƚŚ ĐĞŶƚĞƌŝƐůŽĐĂƚĞĚŝŶƚŚĞWƵďůŝĐͲZĞĐƌĞĂƟŽŶĂůĞǀĞůŽƉŵĞŶƚƌĞĂ͘ dŚĞtĞƐƚŶĂŚĞŝŵ,ŽƐƉŝƚĂůŝƐϮϭϵďĞĚͲĂĐƵƚĞĐĂƌĞĨĂĐŝůŝƚLJůŽĐĂƚĞĚĂƚ ƚŚĞĐŽƌŶĞƌŽĨĞĂĐŚŽƵůĞǀĂƌĚĂŶĚKƌĂŶŐĞǀĞŶƵĞŝŶƚŚĞ^ĞŵŝͲWƵďůŝĐ ĞǀĞůŽƉŵĞŶƚƌĞĂ͘ 54 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ DEVELOPMENT AREAS ACRES t>>/E'hE/d^ EKEͳZ^/Ed/>^Y͘&d͘ 1 ZĞƐŝĚĞŶƟĂů>ŽǁͲDĞĚŝƵŵ ϰϰ͘ϴ ϴϬϲ Ͳ ZĞƐŝĚĞŶƟĂůDĞĚŝƵŵ ϰϵ͘ϰ ϭ͕ϳϳϴ Ͳ DŝdžĞĚͲhƐĞDĞĚŝƵŵ ϭϲ͘ϴ ϲϬϱ ϮϭϬ͕ϱϳϱ DŝdžĞĚͲhƐĞ,ŝŐŚ ϯϮ͘ϯ ϭ͕ϵϯϴ ϰϵϮ͕ϰϰϲ EĞŝŐŚďŽƌŚŽŽĚŽŵŵĞƌĐŝĂů ϮϮ͘ϲ Ͳ ϯϰϰ͕ϱϲϬ ZĞŐŝŽŶĂůŽŵŵĞƌĐŝĂů Ϯϳ͘ϰ Ͳ ϯϴϬ͕ϬϬϬ KĸĐĞ Ϯ͘Ϯ Ͳ ϰϳ͕ϵϭϲ WƵďůŝĐͲZĞĐƌĞĂƟŽŶĂů Ϯϳ͘ϵ Ͳ ϭϮϭ͕ϱϯϮ ^ĞŵŝͲWƵďůŝĐ ϭϯ͘ϲ Ͳ ϱϵϮ͕ϰϭϲ tĂƚĞƌͲ&ůŽŽĚŽŶƚƌŽůϮ ϰ͘Ϯ Ͳ Ͳ ZKtϮ ϰϭ͘ϲ Ͳ Ͳ TOTAL3 ϮϴϮ͘ϴ ϱ͕ϭϮϴ Ϯ͕ϭϴϵ͕ϰϰϱ d>ϰͳϭs>KWDEdZ^dd/^d/>^hDDZz Sources: City of Anaheim and PlaceWorks, 2018. Notes: ϭ͘dŚŝƐƐƚĂƟƐƟĐĂůƐƵŵŵĂƌLJŝŶĐůƵĚĞƐƚŚĞƐƋƵĂƌĞĨŽŽƚĂŐĞĨŽƌŵŽƚĞůƐ͘ Ϯ͘dŚĞƐĞůĂŶĚƵƐĞƐĂƌĞŶŽƚĐŽŶƐŝĚĞƌĞĚĞǀĞůŽƉŵĞŶƚƌĞĂƐďƵƚŚĂǀĞďĞĞŶŝŶĐůƵĚĞĚŝŶƚŚĞƐƚĂƟƐƟĐĂůƐƵŵŵĂƌLJƚŽĂĐĐŽƵŶƚĨŽƌĂůůĂĐƌĞĂŐĞǁŝƚŚŝŶƚŚĞ ^ƉĞĐŝĮĐWůĂŶďŽƵŶĚĂƌLJ͘ ϯ͘dŚĞƐƵŵŵĂƌLJƉƌŽǀŝĚĞĚĂďŽǀĞŝƐďĂƐĞĚŽŶƌĞĂƐŽŶĂďůĞĂƐƐƵŵƉƟŽŶŽĨĨƵƚƵƌĞĚĞǀĞůŽƉŵĞŶƚ͘/ŶĚŝǀŝĚƵĂůƉƌŽũĞĐƚƐǁŝůůďĞƌĞǀŝĞǁĞĚŽŶĂĐĂƐĞͲďLJͲĐĂƐĞ basis during the Site Plan Review process. 4.2.2 Maximum Allowable Development dĂďůĞ ϰͲϭ͕ĞǀĞůŽƉŵĞŶƚ ƌĞĂ ^ƚĂƟƐƟĐĂů ^ƵŵŵĂƌLJ͕ ƐƵŵŵĂƌŝnjĞƐ ƚŚĞ ŵĂdžŝŵƵŵ ĚŝƐƚƌŝďƵƟŽŶ ŽĨ ĚĞǀĞůŽƉŵĞŶƚ ƉŽƚĞŶƟĂůďLJĚĞǀĞůŽƉŵĞŶƚĂƌĞĂ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ55 4 Figure 4-1 Development Areas BROADWAY ORANGE AVE LINCOL N AVE BEACHBLVDWESTERN AVEBALL RD DALE AVE05001,000 Feet City of Buena Park City of Stanton Development Areas Residential Low-Medium Residential Medium Mixed-Use Medium Mixed-Use High Neighborhood Commercial Regional Commercial Office Public-Recreational Semi-Public Water Right of Way Specific Plan Area City Boundary ^ŽƵƌĐĞ͗WůĂĐĞtŽƌŬƐĂŶĚŝƚLJŽĨŶĂŚĞŝŵ͕ϮϬϭϳ 56 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ57 4 Figure 4-2 Areas Likely to Change LINCOLN AVE ORANGE AVE BALL RD 4.2.3 Areas of Change dŚĞ ŵĂũŽƌŝƚLJ ŽĨ ĐŚĂŶŐĞƐ ĂůŽŶŐ ĞĂĐŚ ŽƵůĞǀĂƌĚ ĂƌĞĞdžƉĞĐƚĞĚƚŽŽĐĐƵƌŝŶƚŚĞZĞŐŝŽŶĂůŽŵŵĞƌĐŝĂů͕ EĞŝŐŚďŽƌŚŽŽĚ ŽŵŵĞƌĐŝĂů͕ DŝdžĞĚͲhƐĞ͕ ĂŶĚ ZĞƐŝĚĞŶƟĂů DĞĚŝƵŵ ĞǀĞůŽƉŵĞŶƚ ƌĞĂƐ ĂĚũĂĐĞŶƚ ƚŽĞĂĐŚŽƵůĞǀĂƌĚ͘WƌŽƉĞƌ ƟĞƐŝĚĞŶƟĮĞĚŽŶ&ŝŐƵƌĞ ϰͲϮ͕ƌĞĂƐ >ŝŬĞůLJ ƚŽ ŚĂŶŐĞ͕ ŚĂǀĞ ďĞĞŶ ŝĚĞŶƟĮĞĚ ĚƵĞ ƚŽ ƐĞǀĞƌĂů ĨĂĐƚŽƌƐ ŝŶĐůƵĚŝŶŐ ŝĚĞŶƟĮĐĂƟŽŶ ŽĨ ƵŶĚĞƌƉĞƌĨŽŵŝŶŐƵƐĞƐ͕ŽƉƉŽƌƚƵŶŝƟĞƐĨŽƌĚĞǀĞůŽƉŵĞŶƚ ŽŶǀĂĐĂŶƚůĂŶĚ͕ĂŶĚŇĞdžŝďŝůŝƚLJƵŶĚĞƌŶĞǁnjŽŶŝŶŐĂƐ ƉƌŽǀŝĚĞĚ ďLJ ƚŚŝƐ ^ƉĞĐŝĮĐ WůĂŶ͘ dŚĞ tĞƐƚŐĂƚĞ ĂŶĚ ^ŝůǀĞƌDŽŽŶƐŝƚĞƐĂƐƉƌĞǀŝŽƵƐůLJĚŝƐĐƵƐƐĞĚŝŶŚĂƉƚĞƌ ϯ͕ŽŶƚĞdžƚ͕ĂŶĚďĞůŽǁŚĂǀĞƚŚĞŐƌĞĂƚĞƐƚƉŽƚĞŶƟĂůĨŽƌ ŶĞĂƌͲƚĞƌŵĚĞǀĞůŽƉŵĞŶƚ͘ Motel Sites DĂŶLJ ŽĨ ƚŚĞ ĞdžŝƐƟŶŐ ŵŽƚĞů ƉƌŽƉĞƌƟĞƐ ĂƌĞ ĂůƐŽ ŽƉƉŽƌƚƵŶŝƟĞƐĨŽƌƌĞĚĞǀĞůŽƉŵĞŶƚ͘ϮϬϭϲƐƚƵĚLJŽĨƚŚĞ ĂƌĞĂŵŽƚĞůƐǁĂƐĐŽŶĚƵĐƚĞĚďLJĂLJƌĞĂĐŽŶŽŵŝĐƐ ;Ϳ͘dŚĞƐƚƵĚLJĨŽƵŶĚƚŚĂƚƚŚĞĂƌĞĂŚĂƐĚĞŵĂŶĚĨŽƌ ϰϱϴŚŽƚĞůƌŽŽŵƐ͕ĂƉƉƌŽdžŝŵĂƚĞůLJŚĂůĨƚŚĞŶƵŵďĞƌŽĨ ƌŽŽŵƐĐƵƌƌĞŶƚůLJĂǀĂŝůĂďůĞĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ͘ĂƐĞĚ ŽŶƚŚĞĮŶĚŝŶŐƐŽĨƚŚĂƚƐƚƵĚLJƐĞǀĞƌĂůŽĨƚŚĞƐĞƉĂƌĐĞůƐ ŚĂǀĞďĞĞŶ ĚĞƐŝŐŶĂƚĞĚ ĂƐDŝdžĞĚͲhƐĞŽƌZĞƐŝĚĞŶƟĂů DĞĚŝƵŵĞǀĞůŽƉŵĞŶƚƌĞĂƐ͘ DŝdžĞĚͲhƐĞƌĞĂƐ dŚĞDŝdžĞĚͲhƐĞĞǀĞůŽƉŵĞŶƚƌĞĂƐĂƚƚŚĞĐŽƌŶĞƌƐ of ĞĂĐŚŽƵůĞǀĂƌĚĂŶĚ>ŝŶĐŽůŶǀĞŶƵĞĂƌĞĞdžƉĞĐƚĞĚƚŽ ƌĞǀŝƚĂůŝnjĞƚŚĞĐŽƌƌŝĚŽƌ͘EĞǁƉƌŽũĞĐƚƐŝŶƚŚĞƐĞĂƌĞĂƐ ĂƌĞĞdžƉĞĐƚĞĚƚŽďĞŽĨŚŝŐŚƋƵĂůŝƚLJĂŶĚĚĞƐŝŐŶĞĚƚŽ ŝŶƚĞŐƌĂƚĞ ǁĞůů ǁŝƚŚ ĞdžŝƐƟŶŐ ƐƵƌƌŽƵŶĚŝŶŐ ƵƐĞƐ ĂŶĚ ĚĞǀĞůŽƉŵĞŶƚ͘&ŝŐƵƌĞϰͲϯ͕/ůůƵƐƚƌĂƟǀĞĨŽƌƚŚĞŽƌŶĞƌŽĨ Beach ŽƵůĞǀĂƌĚĂŶĚ>ŝŶĐŽůŶǀĞŶƵĞ͕ĚĞƉŝĐƚƐĂǀŝĞǁ ŽĨƚŚĞĞĂƐƚĐŽƌŶĞƌƐŽĨƚŚŝƐŝŶƚĞƌƐĞĐƟŽŶŝĨƚŚĞƐĞƐŝƚĞƐ ǁĞƌĞƚŽƌĞĚĞǀĞůŽƉƵŶĚĞƌƚŚĞĚĞǀĞůŽƉŵĞŶƚƐƚĂŶĚĂƌĚƐ ŽĨƉƉĞŶĚŝdžŽĨƚŚŝƐ^ƉĞĐŝĮĐWůĂŶĂŶĚD^ĞĐƟŽŶ ϭϴ͘ϭϮϮ͘DŽƌĞĐŽŶĐĞƉƚƐĨŽƌƉŽƐƐŝďůĞƌĞĚĞǀĞůŽƉŵĞŶƚ ŽƉƉŽƌƚƵŶŝƟĞƐĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚĂƌĞĚŝƐĐƵƐƐĞĚŝŶ ^ĞĐƟŽŶϰ͘ϯ͕ŽƌƌŝĚŽƌĞƐŝŐŶŽŶĐĞƉƚƐ͕ďĞůŽǁ͘ Westgate ^ŝŶĐĞƚŚĞƐŝƚĞŝƐǀĂĐĂŶƚĂŶĚŝƚLJͲŽǁŶĞĚ͘tĞƐƚŐĂƚĞŝƐ ůŝŬĞůLJƚŽďĞďƵŝůƚĚƵƌŝŶŐŝŵƉůĞŵĞŶƚĂƟŽŶŽĨƚŚŝƐ^ƉĞĐŝĮĐ WůĂŶ͘ƐĚŝƐĐƵƐƐĞĚŝŶŚĂƉƚĞƌϯ͕ŽŶƚĞdžƚ͕ƚĞŶƚĂƟǀĞ ƉůĂŶƐĨŽƌƚŚĞĂƌĞĂŝŶĐůƵĚĞĂŶĂƉƉƌŽdžŝŵĂƚĞůLJϮϱϬ͕ϬϬϬ ƐƋƵĂƌĞ ĨŽŽƚ ƌĞƚĂŝů ĐĞŶƚĞƌ ĚĞƐŝŐŶĞĚ ĂƌŽƵŶĚ Ă ŵĂŝŶ ƐƚƌĞĞƚƉĂƐĞŽĐŽŶĐĞƉƚ͘ƉŽƌƟŽŶŽĨƚŚĞƐŝƚĞĐŽƵůĚĂůƐŽ ^ŽƵƌĐĞ͗ŝƚLJŽĨŶĂŚĞŝŵ͕ϮϬϭϳ 58 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ &ŝŐƵƌĞϰͲϯ/ůůƵƐƚƌĂƟǀĞWĞƌƐƉĞĐƟǀĞĨŽƌƚŚĞŽŶĐĞƉƚƵĂůĞǀĞůŽƉŵĞŶƚŽĨƚŚĞĂƐƚŽƌŶĞƌƐŽĨĞĂĐŚŽƵůĞǀĂƌĚ and Lincoln Avenue dŚŝƐĚƌĂǁŝŶŐŝůůƵƐƚƌĂƚĞƐĐŽŶĐĞƉƚƵĂůĚĞǀĞůŽƉŵĞŶƚŽƉƉŽƌƚƵŶŝƟĞƐĨŽƌ ƚŚĞtĞƐƚŐĂƚĞƐŝƚĞĂŶĚƉĂƌĐĞůƐĂĚũĂĐĞŶƚƚŽƚŚĞĨŽƌŵĞƌ^ŝůǀĞƌDŽŽŶƐŝƚĞ Ăƚ ƚŚĞ ĐŽƌŶĞƌ ŽĨ >ŝŶĐŽůŶ ǀĞŶƵĞ ĂŶĚ ĞĂĐŚ ŽƵůĞǀĂƌĚ͘ ŽŵŵĞƌĐŝĂů ĂŶĚƌĞƐŝĚĞŶƟĂůƵƐĞƐĂƌĞůŽĐĂƚĞĚĐůŽƐĞƚŽĞĂĐŚŽƵůĞǀĂƌĚǁŝƚŚƐƚƌŽŶŐ ƉĞĚĞƐƚƌŝĂŶĐŽŶŶĞĐƟŽŶƐ͕ŶĞǁŽƉĞŶƐƉĂĐĞ͕ĂŵƉůĞƐŝĚĞǁĂůŬƐĨŽƌŽƵƚĚŽŽƌ ĚŝŶŝŶŐ͕ŶĞǁƐƚƌĞĞƚƚƌĞĞƐĂŶĚůĂŶĚƐĐĂƉŝŶŐ͕ĂŶĚĐĂƌĞĨƵůĂƩĞŶƟŽŶƚŽďƵŝůĚŝŶŐ ĚĞƐŝŐŶǁŝůůĐƌĞĂƚĞĂŶŝŵƉƌŽǀĞĚĞdžƉĞƌŝĞŶĐĞĨŽƌƌĞƐŝĚĞŶƚƐ͕ĞŵƉůŽLJĞĞƐ͕ĂŶĚ ǀŝƐŝƚŽƌƐǁŚŽĨƌĞƋƵĞŶƚĞĂĐŚŽƵůĞǀĂƌĚ͘ ,ŽƵƐŝŶŐKƉƉŽƌƚƵŶŝƚLJ &ŽƌŵĞƌŝƐŶĞLJ^ƵŶƐŚŝŶĞ WůĂnjĂ&ĞĂƚƵƌĞ ǀĞŶƚWůĂnjĂ ŶŚĂŶĐĞĚWĞĚĞƐƚƌŝĂŶdžƉĞƌŝĞŶĐĞ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ59 4 WĞĚĞƐƚƌŝĂŶƌŽƐƐŝŶŐǁŝƚŚdƌĂĸĐĂůŵŝŶŐĞƐŝŐŶ ŽŶŶĞĐƟŽŶƚŽĞĂĐŚŽƵůĞǀĂƌĚ DĂŝŶ^ƚƌĞĞWĂƐĞŽ 60 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ ďĞĐŽŶƐŝĚĞƌĞĚĨŽƌŵŝdžĞĚͲƵƐĞĚĞǀĞůŽƉŵĞŶƚ͕ĂĐƟǀĂƟŶŐ ƚŚĞ>ŝŶĐŽůŶǀĞŶƵĞƐƚƌĞĞƚĨƌŽŶƚĂŐĞǁŝƚŚƌĞƐŝĚĞŶƟĂů ƵƐĞƐ͘ ƚĂƉƉƌŽdžŝŵĂƚĞůLJϮϱͲĂĐƌĞƐƚŚŝƐĂƌĞĂŝƐĞdžƉĞĐƚĞĚ ƚŽƐĞƌǀĞƚŚĞůŽĐĂůŶĞŝŐŚďŽƌŚŽŽĚƐ͕ĚƌĂǁƚŽƵƌŝƐƚƐĨƌŽŵ ƚŚĞƵĞŶĂWĂƌŬŶƚĞƌƚĂŝŶŵĞŶƚŽŶĞ͕ĂŶĚǁŽƵůĚĂůƐŽ ďĞůĂƌŐĞĞŶŽƵŐŚƚŽĚƌĂǁƌĞŐŝŽŶĂůƌĞƚĂŝůƐŚŽƉƉĞƌƐ͘ ZĞǀŝƚĂůŝnjĂƟŽŶŽĨZĞƐŝĚĞŶƟĂůĞǀĞůŽƉŵĞŶƚƌĞĂƐ tŚŝůĞƚŚĞĞdžŝƐƟŶŐƐŝŶŐůĞĨĂŵŝůLJ͕ŵŽďŝůĞŚŽŵĞ͕ĂŶĚ ĨŽƵƌƉůĞdž ŶĞŝŐŚďŽƌŚŽŽĚƐ ǁŝƚŚŝŶ ƚŚĞ ^W ĂƌĞĂ ĂƌĞ ŶŽƚĞdžƉĞĐƚĞĚƚŽĐŚĂŶŐĞůĂŶĚƵƐĞ͕ƐŽŵĞŽĨƚŚĞŽůĚĞƌ ŶĞŝŐŚďŽƌŚŽŽĚƐĐŽƵůĚŐƌĞĂƚůLJďĞŶĞĮƚĨƌŽŵƌĞůĂƟǀĞůLJ ůŽǁ ĐŽƐƚ ƉƵďůŝĐ ƌĞĂůŵ ŝŵƉƌŽǀĞŵĞŶƚƐ ĂƐ ǁĞůů ĂƐ ĂƩĞŶƟŽŶƚŽŚŽǁĨƵƚƵƌĞĚĞǀĞůŽƉŵĞŶƚŶĞdžƚƚŽƚŚĞƐĞ ŶĞŝŐŚďŽƌŚŽŽĚƐŝƐĚĞƐŝŐŶĞĚ͘dŚĞƌĞĂƌĞŽƉƉŽƌƚƵŶŝƟĞƐ ĨŽƌƚŚĞƐĞĂƌĞĂƐƚŽĞŶŚĂŶĐĞůĂŶĚƐĐĂƉŝŶŐ͕ŵĂŬĞĨĂĕĂĚĞ ŝŵƉƌŽǀĞŵĞŶƚƐ͕ĂŶĚŝŶŐĞŶĞƌĂůĂĚĚĐŚĂƌĂĐƚĞƌƚŽƚŚĞ ĞdžŝƐƟŶŐŚŽŵĞƐĂŶĚŶĞŝŐŚďŽƌŚŽŽĚƐŽĨƚŚĞĐŽƌƌŝĚŽƌ͘ &ŝŐƵƌĞϰͲϰ͕/ůůƵƐƚƌĂƟǀĞZĞǀŝƚĂůŝnjĂƟŽŶŽŶĐĞƉƚƐĨŽƌƚŚĞ ĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶƌĞĂ͕ĚĞƉŝĐƚƉŽƐƐŝďůĞ ŝŵƉƌŽǀĞŵĞŶƚƐƚŽƚŚĞ>ĂdžŽƌĞEĞŝŐŚďŽƌŚŽŽĚůŽĐĂƚĞĚ ĞĂƐƚŽĨƚŚĞtĞƐƚŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌ͘ ZĞǀŝƚĂůŝnjĂƟŽŶ ŽĨ EĞŝŐŚďŽƌŚŽŽĚ ŽŵŵĞƌĐŝĂů Development Areas dŚĞƌĞ ĂƌĞ ĂůƐŽ ƐĞǀĞƌĂů ŶĞŝŐŚďŽƌŚŽŽĚ ĐŽŵŵĞƌĐŝĂů ƐŚŽƉƉŝŶŐ ĐĞŶƚĞƌƐ Ăƚ ƚŚĞ ŝŶƚĞƌƐĞĐƟŽŶ ŽĨ ĞĂĐŚ ŽƵůĞǀĂƌĚĂŶĚĂůůZŽĂĚƚŚĂƚǁŝůůƌĞŵĂŝŶnjŽŶĞĚĨŽƌ ĐŽŵŵĞƌĐŝĂůƵƐĞƐ͘KŶĞƉĂƌĐĞůŚĂƐƌĞĐĞŶƚůLJďĞĞŶ ƌĞĚĞǀĞůŽƉĞĚʹƚŚĞĨŽƌŵĞƌ>ŝŶĚLJDŽƚĞůŝƐŶŽǁĂĐĂƌ ǁĂƐŚ͘'ŝǀĞŶƚŚĞĂŐĞ͕ĐŽŶĚŝƟŽŶ͕ĂŶĚĐƵƌƌĞŶƚǀĂĐĂŶĐŝĞƐ ĂƚƚŚĞƌĞŵĂŝŶŝŶŐĐŽŵŵĞƌĐŝĂůĐĞŶƚĞƌƐ͕ƚŚĞ^W ŝŶĐůƵĚĞƐĚĞǀĞůŽƉŵĞŶƚĂŶĚĚĞƐŝŐŶƐƚĂŶĚĂƌĚƐƚŚĂƚŐƵŝĚĞ ĞŝƚŚĞƌĨƵƚƵƌĞƌĞǀŝƚĂůŝnjĂƟŽŶŽƌŶĞǁĚĞǀĞůŽƉŵĞŶƚĂƚ ƚŚĞƐĞůŽĐĂƟŽŶƐ͘ZĞƋƵŝƌĞŵĞŶƚƐŝŶĐůƵĚĞ͗ŝŶĐŽƌƉŽƌĂƟŶŐ ŽƵƚĚŽŽƌƐƉĂĐĞƐĂŶĚĂŵĞŶŝƟĞƐ͕ƐƵĐŚĂƐƉůĂnjĂƐ͕ƐŚĂĚĞ ĂŶĚĞĂƟŶŐĂƌĞĂƐ͖ŶĞǁďƵŝůĚŝŶŐƐĂůŽŶŐƚŚĞĨƌŽŶƚŽĨƚŚĞ ƉƌŽƉĞƌƚLJ͖ŝŵƉƌŽǀĞĚƉĞĚĞƐƚƌŝĂŶƉĂƚŚǁĂLJƐ͖ĂŶĚŽƚŚĞƌ ĚĞƐŝŐŶƌĞƋƵŝƌĞŵĞŶƚƐ͘ĐŽŶĐĞƉƚŽĨĂƌĞǀŝƚĂůŝnjĞĚĐĞŶƚĞƌ ĂƚƚŚĞƐŽƵƚŚĞĂƐƚĐŽƌŶĞƌŽĨĞĂĐŚŽƵůĞǀĂƌĚĂŶĚĂůů ZŽĂĚŝƐƐŚŽǁŶŝŶ&ŝŐƵƌĞϰͲϱ͕/ůůƵƐƚƌĂƟǀĞWĞƌƐƉĞĐƟǀĞ ĨŽƌƚŚĞŽƌŶĞƌŽĨĞĂĐŚŽƵůĞǀĂƌĚĂŶĚĂůůZŽĂĚ͘ &ŝŐƵƌĞϰͲϰ/ůůƵƐƚƌĂƟǀĞZĞǀŝƚĂůŝnjĂƟŽŶŽŶĐĞƉƚƐĨŽƌƚŚĞĞĂĐŚ Commercial & Mixed-Use Community Inspired Mural Playful Elements to Build Community Character HEARING DRAFT OCTOBER 2018 | d,W>Eͮ61 4 ŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶƌĞĂ New Landscaping Enhanced Pedestrian Crossing Residential Alley Improvements Ideas for Adding Shade Private Property Investment Seating and Gathering Places 62 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ &ŝŐƵƌĞϰͲϱ/ůůƵƐƚƌĂƟǀĞWĞƌƐƉĞĐƟǀĞĨŽƌŽŶĐĞƉƚƵĂůĞǀĞůŽƉŵĞŶƚŽĨƚŚĞ^ŽƵƚŚĞĂƐƚ Corner of Beach Boulevard and Ball Road dŚŝƐĐŽŶĐĞƉƚƵĂůĚĞǀĞůŽƉŵĞŶƚĚƌĂǁŝŶŐŝůůƵƐƚƌĂƚĞƐŽƉƉŽƌƚƵŶŝƟĞƐĨŽƌƚŚĞ EĞŝŐŚďŽƌŚŽŽĚŽŵŵĞƌĐŝĂůĞǀĞůŽƉŵĞŶƚƌĞĂĂƚƚŚĞƐŽƵƚŚĞĂƐƚĐŽƌŶĞƌŽĨ ĂůůZŽĂĚĂŶĚĞĂĐŚŽƵůĞǀĂƌĚ͘EĞŝŐŚďŽƌŚŽŽĚƐĞƌǀŝŶŐĐŽŵŵĞƌĐŝĂůƵƐĞƐ ĐŽƵůĚďĞƌĞǀŝƚĂůŝnjĞĚǁŝƚŚĂŶĞǁƐŝƚĞĚĞƐŝŐŶƚŚĂƚŝŶĐŽƌƉŽƌĂƚĞƐŽƉĞŶƐƉĂĐĞ͕ ŽƵƚĚŽŽƌĚŝŶŝŶŐ͕ŶĞǁůĂŶĚƐĐĂƉŝŶŐ͕ĂŶĚďĞƩĞƌƉĞĚĞƐƚƌŝĂŶĐŽŶŶĞĐƟŽŶƐ͘ dŚŝƐƚLJƉĞŽĨƐŚŽƉƉŝŶŐĞdžƉĞƌŝĞŶĐĞǁĂƐŽŌĞŶĚĞƐĐƌŝďĞĚďLJƚŚĞĐŽŵŵƵŶŝƚLJ ƚŚƌŽƵŐŚŽƵƚƚŚĞŽƵƚƌĞĂĐŚƉŚĂƐĞŽĨƚŚĞƉƌŽĐĞƐƐͶĞƐƉĞĐŝĂůůLJĞŵƉŚĂƐŝnjĞĚďLJ ŚŝŐŚƐĐŚŽŽůƐƚƵĚĞŶƚƐǁŚŽǁĂŶƚƐƉĂĐĞƐƚŽŵĞĞƚƵƉǁŝƚŚĨƌŝĞŶĚƐ͘ EĞǁZĞƚĂŝůƵŝůĚŝŶŐĞƐŝŐŶĞĚƚŽƌĞĂƚĞ ŽŵŵƵŶŝƚLJ'ĂƚŚĞƌŝŶŐ^ƉĂĐĞ ŽǀĞƌĞĚWĞĚĞƐƚƌŝĂŶ^ŚĂĚĞ^ƚƌƵĐƚƵƌĞ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ63 4 &ĂĐĂĚĞZĞŶŽǀĂƟŽŶŽĨdžŝƐƟŶŐƵŝůĚŝŶŐƐ ĞĂĐŚŽƵůĞǀĂƌĚƌĂŶĚŝŶŐ ŶŚĂŶĐĞĚ^ƚƌĞĞƚ&ƵƌŶŝƚƵƌĞ ůŽĐŬdŽǁĞƌƚŽĂĚĚƌĐŚŝƚĞĐƚƵƌĂů&ŽĐĂůWŽŝŶƚ 64 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚĞƐŽƵƚŚǁĞƐƚĐŽƌŶĞƌŽĨĞĂĐŚŽƵůĞǀĂƌĚĂŶĚKƌĂŶŐĞǀĞŶƵĞƉƌĞƐĞŶƚƐĂŶŽƉƉŽƌƚƵŶŝƚLJĨŽƌŵŝdžĞĚͲƵƐĞ ĚĞǀĞůŽƉŵĞŶƚǁŝƚŚŝŶƚŚĞDŝdžĞĚͲhƐĞ,ŝŐŚĞǀĞůŽƉŵĞŶƚƌĞĂ͘dŚĞĞdžŝƐƟŶŐƉĂƌŬŝŶŐƐƚƌƵĐƚƵƌĞĂƚƚŚŝƐ ůŽĐĂƟŽŶĐŽƵůĚďĞƌĞͲƉƵƌƉŽƐĞĚǁŝƚŚŐƌŽƵŶĚŇŽŽƌƌĞƚĂŝůƵƐĞƚŽƐƵƉƉŽƌƚĂŶĂĚũĂĐĞŶƚŵŝdžĞĚͲƵƐĞďƵŝůĚŝŶŐ ƉŽƐƐŝďůLJƉƌŽǀŝĚŝŶŐŚŽƵƐŝŶŐŽǀĞƌŽƚŚĞƌƌĞƚĂŝůĂŶĚƐĞƌǀŝĐĞŽƌŝĞŶƚĞĚƵƐĞƐ͘ &ŝŐƵƌĞϰͲϳ/ůůƵƐƚƌĂƟǀĞWĞƌƐƉĞĐƟǀĞĨŽƌŽŶĐĞƉƚƵĂů Development of the Southwest Corner of Beach Boulevard and Orange Avenue 4.3 CORRIDOR DESIGN CONCEPTS dŚĞ ƵƌďĂŶ ĚĞƐŝŐŶ ĐŽŶĐĞƉƚƐ ĨŽƌ ƚŚĞ ^W ĂƌĞ Ă ƌĞŇĞĐƟŽŶŽĨǁŚĂƚŝƐŝŵƉŽƌƚĂŶƚƚŽƚŚĞĐŽŵŵƵŶŝƚLJ ŝŶƚĞƌŵƐŽĨŶĞǁƚLJƉĞƐŽĨĚĞǀĞůŽƉŵĞŶƚ͕ƚŚĞĚĞƐŝŐŶ ŽĨďƵŝůĚŝŶŐƐĂŶĚŚŽǁƚŚĞLJŝŶƚĞƌĂĐƚǁŝƚŚƚŚĞƐƚƌĞĞƚ ĂŶĚ ĂĚũĂĐĞŶƚ ƵƐĞƐ͕ ƚŚĞ ĚĞƐŝŐŶ ŽĨ ŽƵƚĚŽŽƌ ƐƉĂĐĞƐ ĨŽƌƉĞŽƉůĞ͕ĂƐǁĞůůĂƐƐƚƌĞĞƚƐĐĂƉĞĞŶŚĂŶĐĞŵĞŶƚƐƚŽ ŝŵƉƌŽǀĞƚŚĞŽǀĞƌĂůůŝŵĂŐĞŽĨƚŚĞĂƌĞĂ͘/ůůƵƐƚƌĂƟǀĞƐ ĂƌĞ ƵƐĞĚ ƚŚƌŽƵŐŚŽƵƚ ƚŚŝƐ ƐĞĐƟŽŶĂƐĂǀŝƐƵĂůĂŝĚĞ͕ ƚŚĞĚƌĂǁŝŶŐƐĂƌĞĐŽŶĐĞƉƚƵĂůĂŶĚĂŶŝŶƚĞƌƉƌĞƚĂƟŽŶ ŽĨƉŽƐƐŝďůĞĚĞǀĞůŽƉŵĞŶƚǁŝƚŚŝŶƚŚĞƌĞƋƵŝƌĞŵĞŶƚƐŽĨ ƚŚŝƐWůĂŶ͕ƚŚĞLJĚŽŶŽƚƌĞƉƌĞƐĞŶƚĂƐƉĞĐŝĮĐƉƌŽũĞĐƚŽƌ ĚĞǀĞůŽƉŵĞŶƚƉƌŽƉŽƐĂů͘ 4.3.1 Mixed-Use Nodes ŬĞLJƚĞŶĂŶƚŽĨƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶ ŝƐ ƚŚĞ ƉƌŽǀŝƐŝŽŶ ŽĨ ŶĞǁ ŵŝdžĞĚͲƵƐĞ ĚŝƐƚƌŝĐƚƐ ǁŚŝĐŚ ƐƵƉƉŽƌƚĂŶĚĞŶĐŽƵƌĂŐĞƚŚĞŝŶƚĞŐƌĂƟŽŶŽĨƌĞƐŝĚĞŶƟĂů ĂŶĚĐŽŵŵĞƌĐŝĂůƵƐĞƐǁŝƚŚŝŶĂƐŝŶŐůĞƉƌŽũĞĐƚŽƌƐŝƚĞ͘ dŚĞƐĞ ŶĞǁ ŵŝdžĞĚͲƵƐĞ ĚĞǀĞůŽƉŵĞŶƚ ĂƌĞĂƐ ŚĂǀĞ ƌĞĂĚLJĂĐĐĞƐƐƚŽŵĂũŽƌƌŽĂĚǁĂLJƐĂŶĚƉƵďůŝĐƚƌĂŶƐŝƚ͕ ĂŶĚ ǁŝůů ŝŶĐƌĞĂƐĞ ƚŚĞ ŽƉƉŽƌƚƵŶŝƚLJ ĨŽƌ ďŽƚŚ ŽŶͲƐŝƚĞ ƌĞƐŝĚĞŶƚƐĂŶĚƌĞƐŝĚĞŶƚƐŝŶƚŚĞĂƌĞĂƚŽůŝǀĞ͕ƐŚŽƉ͕ĂŶĚ ƌĞĐƌĞĂƚĞǁŝƚŚŽƵƚŚĂǀŝŶŐƚŽƵƐĞƚŚĞŝƌǀĞŚŝĐůĞƐ͘ŽƚŚ ƚŚĞ DŝdžĞĚͲhƐĞ ,ŝŐŚ ĂŶĚ ƚŚĞ DŝdžĞĚͲhƐĞ DĞĚŝƵŵ ŽīĞƌŇĞdžŝďŝůŝƚLJŝŶƚĞƌŵƐŽĨƚŚĞƵůƟŵĂƚĞĐŽŶĮŐƵƌĂƟŽŶ ŽĨ ƌĞƐŝĚĞŶƟĂů͕ ĐŽŵŵĞƌĐŝĂů͕ ŽĸĐĞ͕ ĂŶĚ ŽƚŚĞƌ ƵƐĞƐ ŽŶ Ă ƐŝƚĞ͕ ǁŝƚŚ ƚŚĞ ŝŶƚĞŶƟŽŶ ŽĨ ĐƌĞĂƟŶŐ Ă ŵŽƌĞ ĚLJŶĂŵŝĐƵƌďĂŶĞŶǀŝƌŽŶŵĞŶƚĂƚŬĞLJŶŽĚĞƐĂůŽŶŐƚŚĞ ďŽƵůĞǀĂƌĚ͘EĞǁƉƌŽũĞĐƚƐŝŶƚŚĞƐĞĂƌĞĂƐĂƌĞĞdžƉĞĐƚĞĚ ƚŽďĞŽĨŚŝŐŚƋƵĂůŝƚLJĂŶĚĚĞƐŝŐŶĞĚƚŽŝŶƚĞŐƌĂƚĞǁĞůů ǁŝƚŚ ĞdžŝƐƟŶŐ ƐƵƌƌŽƵŶĚŝŶŐ ƵƐĞƐ ĂŶĚ ĚĞǀĞůŽƉŵĞŶƚ͘ dŚĞ ĚĞǀĞůŽƉŵĞŶƚ ĂŶĚ ĚĞƐŝŐŶ ƐƚĂŶĚĂƌĚƐ ;ƉƉĞŶĚŝdž  ŽĨ ƚŚŝƐ ĚŽĐƵŵĞŶƚ ĂŶĚ D ϭϴ͘ϭϮϮͿ ĂĚĚƌĞƐƐ ƚŚĞ ĞƐƐĞŶƟĂůĞůĞŵĞŶƚƐĨŽƌĐƌĞĂƟŶŐǀŝďƌĂŶƚƉůĂĐĞƐǁŝƚŚŝŶ ƚŚĞƐĞ ĚĞǀĞůŽƉŵĞŶƚ ƐŝƚĞƐ͕ ŝŶĐůƵĚŝŶŐ ŽƌŝĞŶƚĂƟŽŶ ƚŽǁĂƌĚƐƚŚĞƐƚƌĞĞƚ͕ŽƵƚĚŽŽƌĚŝŶŝŶŐĂŶĚƉůĂnjĂƐ͕ĐŽƌŶĞƌ ŐĂƚĞǁĂLJƐĂŶĚƉƌŽŵĞŶĂĚĞƐ͕ƚŚĞƐŝƟŶŐŽĨďƵŝůĚŝŶŐƐĂŶĚ ƉĂƌŬŝŶŐĂƌĞĂƐ͕ĂŶĚŝŶƚĞƌŶĂůƉĞĚĞƐƚƌŝĂŶĐŽŶŶĞĐƟǀŝƚLJ͘ /ŶĂĚĚŝƟŽŶ͕ƚŚĞĚĞƐŝŐŶƐƚĂŶĚĂƌĚƐĂĚĚƌĞƐƐŚĞŝŐŚƚƐĂŶĚ ƐĞƚďĂĐŬƐŽĨďƵŝůĚŝŶŐƐǁŚĞŶĂĚũĂĐĞŶƚƚŽƐŝŶŐůĞͲĨĂŵŝůLJ ŶĞŝŐŚďŽƌŚŽŽĚƐ͕ĂŶĚƚŚĞĚĞƐŝŐŶŽĨďƵŝůĚŝŶŐĨĂĐĂĚĞƐƚŽ ƉƌŽƉĞƌƚLJĚŝƐƟŶŐƵŝƐŚƌĞƐŝĚĞŶƟĂůĨƌŽŵŶŽŶͲƌĞƐŝĚĞŶƟĂů ƵƐĞƐ͘ EĞǁ'ƌŽƵŶĚ&ůŽŽƌZĞƚĂŝů ^ƚƌĞĞƚƐĐĂƉĞ/ŵƉƌŽǀĞŵĞŶƚƐ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ65 4 ŽƌŶĞƌŶŚĂŶĐĞŵĞŶƚǁŝƚŚKƵƚĚŽŽƌWůĂnjĂ WƌŝǀĂƚĞKƉĞŶ^ƉĂĐĞ ZĞƵƐĞŽĨWĂƌŬŝŶŐ^ƚƌƵĐƚƵƌĞ 66 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ 4.3.2 Relationship of Buildings to the Street ƵŝůĚŝŶŐƉůĂĐĞŵĞŶƚĂŶĚŽƌŝĞŶƚĂƟŽŶŚĂǀĞĂŶŝŵƉĂĐƚ ŽŶƚŚĞǁĂLJƉĞŽƉůĞĞdžƉĞƌŝĞŶĐĞĂƉůĂĐĞʹďŽƚŚŽŶ ĨŽŽƚĂŶĚŝŶĂĐĂƌ͘sŝƐƵĂůůLJŝŶƚĞƌĞƐƟŶŐďƵŝůĚŝŶŐƐƚŚĂƚ ĂƌĞ ŽƌŝĞŶƚĞĚ ƚŽ ƚŚĞ ƐƚƌĞĞƚ ĂĐƟǀĂƚĞ Ă ĐŽƌƌŝĚŽƌ ĂŶĚ ĐŽŶƚƌŝďƵƚĞ ƚŽ ƚŚĞ ǀŝďƌĂŶĐLJ ŽĨ ƚŚĞ ĂƌĞĂ͘ >ŽĐĂƟŶŐ ƉĂƌŬŝŶŐďĞŚŝŶĚďƵŝůĚŝŶŐƐ͕ƉůĂĐŝŶŐďƵŝůĚŝŶŐƐĐůŽƐĞƌƚŽ ƚŚĞƉƵďůŝĐƐƚƌĞĞƚĞĚŐĞ͕ĂŶĚŝŶƚĞŐƌĂƟŶŐŽƵƚĚŽŽƌƐƉĂĐĞƐ ƚŚĂƚĂƌĞƐĂĨĞĂŶĚǁĞůĐŽŵŝŶŐĂƌĞŬĞLJĚĞƐŝŐŶĞůĞŵĞŶƚƐ ƚŚĂƚĂƌĞĂĚĚƌĞƐƐĞĚŝŶƚŚĞĚĞǀĞůŽƉŵĞŶƚĂŶĚĚĞƐŝŐŶ ƐƚĂŶĚĂƌĚƐ;ƉƉĞŶĚŝdžŽĨƚŚŝƐĚŽĐƵŵĞŶƚĂŶĚD ϭϴ͘ϭϮϮͿ͘/ŶĂĚĚŝƟŽŶ͕ƚŚĞĚĞƐŝŐŶŽĨĂďƵŝůĚŝŶŐ͛ƐŐƌŽƵŶĚ ŇŽŽƌ ĞŶƚƌĂŶĐĞ Žƌ ĨĂĕĂĚĞ͕ ƉůƵƐ ƚŚĞ ůĂŶĚƐĐĂƉĞ ĂŶĚ ŚĂƌĚƐĐĂƉĞƐĞƚďĂĐŬĂƌĞĂƐĚĞƚĞƌŵŝŶĞŝĨŝƚŝƐƉĞĚĞƐƚƌŝĂŶͲ ĨƌŝĞŶĚůLJ͕ŽīĞƌƐƉƌŝǀĂĐLJĂŶĚƐĞĐƵƌŝƚLJǁŚĞƌĞŶĞĞĚĞĚ͕ ĂŶĚƐĞƚƐĂƋƵĂůŝƚLJŝŵĂŐĞĨŽƌƚŚĞĐŽƌƌŝĚŽƌ͘dŚĞŝŶƚĞŶƚŽĨ ĞƐƚĂďůŝƐŚŝŶŐĚĞƐŝŐŶƐƚĂŶĚĂƌĚƐĨŽƌŐƌŽƵŶĚŇŽŽƌƐĨĂĐŝŶŐ ƚŚĞƐƚƌĞĞƚŝƐƚŽĞŶƐƵƌĞƚŚĂƚƚŚĞƚƌĂŶƐŝƟŽŶďĞƚǁĞĞŶ ƚŚĞƉƌŽƉŽƐĞĚĚĞǀĞůŽƉŵĞŶƚĂŶĚƚŚĞƉƵďůŝĐƌĞĂůŵŝƐ ĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞ^ƉĞĐŝĮĐWůĂŶ͛ƐǀŝƐŝŽŶĨŽƌĐƌĞĂƟŶŐ ĂƐĂĨĞƌ͕ƉĞĚĞƐƚƌŝĂŶͲĨƌŝĞŶĚůLJĞŶǀŝƌŽŶŵĞŶƚ͘ EĞǁ ŵŝĚͲďůŽĐŬ ŚŽƵƐŝŶŐ ĐŽƵůĚ ďĞ ĚĞǀĞůŽƉĞĚ ǁŝƚŚŝŶ ƚŚĞ ZĞƐŝĚĞŶƟĂů DĞĚŝƵŵĞǀĞůŽƉŵĞŶƚƌĞĂ͘ƵŝůĚŝŶŐƐǁŝƚŚŝŶƚŚŝƐĚĞƐŝŐŶĂƟŽŶƐŚŽƵůĚ ĨƌŽŶƚƚŚĞƐƚƌĞĞƚĂŶĚƉƌŽǀŝĚĞǀŝƐƵĂůƌĞůŝĞĨƚŚƌŽƵŐŚĂǀĂƌŝĞƚLJŽĨĨƌŽŶƚĂŐĞ ƚLJƉĞƐĂŶĚƵƐĞŽĨĐŽůŽƌ͘ &ŝŐƵƌĞϰͲϴ/ůůƵƐƚƌĂƟǀĞWĞƌƐƉĞĐƟǀĞĨŽƌŽŶĐĞƉƚƵĂů Development of the West Side of Beach Boulevard between Orange Avenue and Ball Road Η^ƚŽŽƉΗĞƐŝŐŶĞĚĨŽƌWƌŝǀĂĐLJǁŚŝůĞ^Ɵůů WƌŽǀŝĚŝŶŐŝƌĞĐƚĐĐĞƐƐƚŽƚŚĞ^ƚƌĞĞƚ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ67 4 sĂƌŝĞƚLJŽĨƌĐŚŝƚĞĐƚƵƌĂů&ĞĂƚƵƌĞƐ͕ŽůŽƌƐĂŶĚDĂƚĞƌŝĂůƐ /ŶĚŝǀŝĚƵĂůZŽǁŚŽƵƐĞhŶŝƚƐ&ƌŽŶƟŶŐ^ƚƌĞĞƚ /ŵƉƌŽǀĞĚ^ƚƌĞĞƚƐĐĂƉĞǁŝƚŚ>ĂŶĚƐĐĂƉŝŶŐĂŶĚƌĂŶĚŝŶŐůĞŵĞŶƚƐ sĂƌŝĞƚLJŽĨĞŶƐŝƟĞƐƚŽĚĚ /ŶƚĞƌĞƐƚůŽŶŐ^ƚƌĞĞƚƐĐĂƉĞ 68 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ DESCRIPTION ƐŚŽƉĨƌŽŶƚŝƐĂĨƌŽŶƚĂŐĞǁŚĞƌĞŝŶƚŚĞďƵŝůĚŝŶŐĨĂĕĂĚĞĂŶĚ ĞŶƚƌĂŶĐĞĂƌĞĂƚƐŝĚĞǁĂůŬŐƌĂĚĞĂŶĚĐůŽƐĞƚŽƚŚĞƉĞĚĞƐƚƌŝĂŶ njŽŶĞ͘^ŚŽƉĨƌŽŶƚƐŝŶĐůƵĚĞůĂƌŐĞĂƌĞĂƐŽĨƚƌĂŶƐƉĂƌĞŶƚŽƉĞŶŝŶŐƐ ĂŶĚĚŽŽƌƐĂŶĚĂƌĞĐŽŵŵŽŶůLJĞƋƵŝƉƉĞĚǁŝƚŚĐĂŶƟůĞǀĞƌĞĚƌŽŽĨƐ ŽƌĂǁŶŝŶŐƐ͘^ŚŽƉĨƌŽŶƚƐƚLJƉŝĐĂůůLJƉƌŽǀŝĚĞĂĐĐĞƐƐĚŝƌĞĐƚůLJĨƌŽŵ ƐŝĚĞǁĂůŬƐĂŶĚĂƌĞŽƌŝĞŶƚĞĚƚŽĚŝƐƉůĂLJŐƌŽƵŶĚͲůĞǀĞůĐŽŵŵĞƌĐŝĂů ƵƐĞƐ͘ dŚŝƐĨƌŽŶƚĂŐĞƚLJƉĞŝƐƚLJƉŝĐĂůůLJƵƐĞĚĨŽƌĐŽŵŵĞƌĐŝĂůƵƐĞ͘dŚŝƐ ĨƌŽŶƚĂŐĞƚLJƉĞĐĂŶďĞƵƐĞĚŝŶĐŽŶũƵŶĐƟŽŶǁŝƚŚƚĞƌƌĂĐĞ͕ĂŶĚŽƌ ĨŽƌĞĐŽƵƌƚƚŽĐƌĞĂƚĞĂŵŽƌĞĞŶŐĂŐŝŶŐƐƚƌĞĞƚ͘ A. SHOPFRONT FRONTAGE Building Frontages ƵŝůĚŝŶŐĨƌŽŶƚĂŐĞƐͶƚŚĞƉŽƌƟŽŶŽĨƚŚĞďƵŝůĚŝŶŐĨĂĐŝŶŐ ƚŚĞƉƌŝŵĂƌLJƐƚƌĞĞƚͶŚĂǀĞďĞĞŶĐĂƚĞŐŽƌŝnjĞĚďLJƚLJƉĞŝŶ ƚŚŝƐWůĂŶƚŽĂĚĚƌĞƐƐƚŚĞĚĞƐŝŐŶĞůĞŵĞŶƚƐƚŚĂƚĂƌĞĂ ĂƌĞ ĂƉƉƌŽƉƌŝĂƚĞ ĨŽƌ Ă ďƵŝůĚŝŶŐΖƐ ŐƌŽƵŶĚ ŇŽŽƌ ĨƌŽŶƚ ĨĂĐĂĚĞ͘ dŚĞ ƐƚƌĞĞƚ ĨƌŽŶƚĂŐĞ ĞŶǀŝƌŽŶŵĞŶƚ ŝŶĐůƵĚĞƐ ĂŶLJLJĂƌĚŽƌƐĞƚďĂĐŬĂƌĞĂƚŚĂƚĞdžƚĞŶĚƐƚŽƚŚĞƐƚƌĞĞƚ͘ /ƚŝƐĂŶŝŵƉŽƌƚĂŶƚĞůĞŵĞŶƚŽĨƵƌďĂŶĚĞƐŝŐŶďĞĐĂƵƐĞ ŝƚ ŝƐ ƚŚĞ ǁĂLJ Ă ďƵŝůĚŝŶŐ ĞŶŐĂŐĞƐ ƚŚĞ ƉƵďůŝĐ ƌĞĂůŵ͘ dŚĞ ĂƌƌĂŶŐĞŵĞŶƚ ĂŶĚ ĚĞƐŝŐŶ ŽĨ ďƵŝůĚŝŶŐ ĨƌŽŶƚĂŐĞƐ ůĂƌŐĞůLJ ĚĞƚĞƌŵŝŶĞƐ ƚŚĞ ĐŚĂƌĂĐƚĞƌ ŽĨ ƚŚĞ ĂƌĞĂ ĂŶĚ ƚŚĞ ƋƵĂůŝƚLJ ŽĨ ƚŚĞ ƉĞĚĞƐƚƌŝĂŶ ĞŶǀŝƌŽŶŵĞŶƚ͘ ƚ ƚŚĞ ŐƌŽƵŶĚ ŇŽŽƌ͕ ƚŚĞ ĨƌŽŶƚĂŐĞ ŝƐ ƚLJƉŝĐĂůůLJ ƚŚĞ ƉƌŝŵĂƌLJ ĂĐĐĞƐƐƉŽŝŶƚŝŶƚŽĂďƵŝůĚŝŶŐĂŶĚĐŽŶƐĞƋƵĞŶƚůLJǀŝƐƵĂůůLJ ƌĞŝŶĨŽƌĐĞƐĂďƵŝůĚŝŶŐΖƐΗŚƵŵĂŶƐĐĂůĞΗ͘dŚĞĨƌŽŶƚĂŐĞ ƚLJƉĞƐĚĞƐĐƌŝďĞĚĂŶĚĚĞƉŝĐƚĞĚŽŶƚŚĞĨŽůůŽǁŝŶŐƉĂŐĞƐ ĂƌĞĂƉƉƌŽƉƌŝĂƚĞĨŽƌĞĂĐŚŽƵůĞǀĂƌĚ͕>ŝŶĐŽůŶǀĞŶƵĞ͕ KƌĂŶŐĞǀĞŶƵĞ͕ĂŶĚĂůůZŽĂĚ͘ dŚŝƐƐĞĐƟŽŶŝƐƚĞĐŚŶŝĐĂůďĞĐĂƵƐĞŝƚŝƐŝŶƚĞŶĚĞĚƚŽďĞ ƵƐĞĚďLJƉƌŽƉĞƌƚLJŽǁŶĞƌƐĂŶĚĚĞǀĞůŽƉĞƌƐƚŽŐƵŝĚĞ ĚŝƐĐƵƐƐŝŽŶƐ ǁŝƚŚ ƚŚĞŝƌ ĂƌĐŚŝƚĞĐƚƐ ĂŶĚ ĚĞƐŝŐŶ ƚĞĂŵ ǁŚĞŶƉůĂŶŶŝŶŐĂŶĞǁƉƌŽũĞĐƚŽƌƵƉĚĂƟŶŐĂŶĞdžŝƐƟŶŐ ĨĂĕĂĚĞ͘ WŚŽƚŽƐ ĂŶĚ ĐŽŶĐĞƉƚƵĂů ƌĞŶĚĞƌŝŶŐƐ ĂƌĞ ƉƌŽǀŝĚĞĚĨŽƌĂĚĚŝƟŽŶĂůĐŽŶƚĞdžƚ͘ BUILDING FRONTAGE dŚĞƉŽƌƟŽŶŽĨƚŚĞďƵŝůĚŝŶŐĨĂĐŝŶŐƚŚĞƉƌŝŵĂƌLJ street. HEARING DRAFT OCTOBER 2018 | d,W>Eͮ69 4 DESCRIPTION ĨŽƌĞĐŽƵƌƚŝƐĂĨƌŽŶƚĂŐĞǁŚĞƌĞŝŶĂƉŽƌƟŽŶŽĨƚŚĞďƵŝůĚŝŶŐ ĨĂĕĂĚĞ ŝƐ ƌĞĐĞƐƐĞĚ ĨƌŽŵ ƚŚĞ ƉƌŝŵĂƌLJ ďƵŝůĚŝŶŐ ĨĂĕĂĚĞ͘ dŚĞ ĨŽƌĞĐŽƵƌƚŵĂLJďĞƵƐĞĚĂƐĂŶĞŶƚƌLJĐŽƵƌƚĂŶĚŽƉĞŶƐƉĂĐĞĨŽƌ ƌĞƐŝĚĞŶƟĂůƵƐĞƐ͕ŽƌĂƐĂĚĚŝƟŽŶĂůƐŚŽƉƉŝŶŐŽƌƐĞĂƟŶŐĂƌĞĂƐ ĨŽƌĐŽŵŵĞƌĐŝĂůƵƐĞƐ͘&ŽƌĞĐŽƵƌƚƐǁŝƚŚůĂƌŐĞƚƌĞĞƐĂŶĚůƵƐŚ ůĂŶĚƐĐĂƉŝŶŐ ŽīĞƌ ǀŝƐƵĂů ĂŶĚ ĞŶǀŝƌŽŶŵĞŶƚĂů ǀĂƌŝĞƚLJ ƚŽ ƚŚĞ ƵƌďĂŶƐƚƌĞĞƚƐĐĂƉĞ͘ dŚŝƐĨƌŽŶƚĂŐĞƚLJƉĞŝƐĂƉƉƌŽƉƌŝĂƚĞĨŽƌĞŝƚŚĞƌƌĞƐŝĚĞŶƟĂůĂŶĚͬ Žƌ ĐŽŵŵĞƌĐŝĂů ƵƐĞƐ͘  ĐŽŵďŝŶĂƟŽŶ ŽĨ ďŽƚŚ ƵƐĞƐ ĐĂŶ ďĞ ĂĐŚŝĞǀĞĚďLJƵƐŝŶŐƚŚĞĨŽƌĞĐŽƵƌƚĂƐĂƌĞƐŝĚĞŶƟĂůĞŶƚƌĂŶĐĞǁŚŝůĞ ĐŽŵŵĞƌĐŝĂůƵƐĞƐŽĐĐƵƉLJƐƚƌĞĞƚĂĚũĂĐĞŶƚďƵŝůĚŝŶŐƐƉĂĐĞ͘dŚŝƐ ƚLJƉĞĐĂŶďĞƵƐĞĚŝŶĐŽŶũƵŶĐƟŽŶǁŝƚŚƐŚŽƉĨƌŽŶƚƐĂŶĚƐƚŽŽƉƐĂƐ ĂƚƌĂŶƐŝƟŽŶŝŶƚŽƌĞƐŝĚĞŶƟĂůĨƌŽŶƚĂŐĞ͘ ͘&KZKhZd&ZKEd'C. STOOP FRONTAGE DESCRIPTION ƐƚŽŽƉŝƐĂĨƌŽŶƚĂŐĞǁŚĞƌĞŝŶƚŚĞďƵŝůĚŝŶŐĨĂĕĂĚĞŝƐƐĞƉĂƌĂƚĞĚ ĨƌŽŵƚŚĞƐƚƌĞĞƚ͕ƉĂƐĞŽ͕ŽƌŽƉĞŶƐƉĂĐĞ͕ďLJĂŶĞŶƚƌĂŶĐĞƚŽƚŚĞ ĞůĞǀĂƚĞĚŐƌŽƵŶĚŇŽŽƌŽĨƚŚĞďƵŝůĚŝŶŐ͘dŚĞĞŶƚƌĂŶĐĞŝƐƵƐƵĂůůLJ ĂŶĞdžƚĞƌŝŽƌƐƚĂŝƌĂŶĚůĂŶĚŝŶŐĂŶĚŵĂLJďĞĐŽǀĞƌĞĚ͘ dŚŝƐĨƌŽŶƚĂŐĞƚLJƉĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌŐƌŽƵŶĚͲŇŽŽƌƌĞƐŝĚĞŶƟĂů ƵƐĞƐƚŽĨĂĐŝůŝƚĂƚĞĂƚƌĂŶƐŝƟŽŶĂŶĚƚŽƉƌŽǀŝĚĞƐĞƉĂƌĂƟŽŶ ďĞƚǁĞĞŶĂŶĂĐƟǀĞƉƵďůŝĐƐƚƌĞĞƚĂŶĚĂƉƌŝǀĂƚĞƌĞƐŝĚĞŶĐĞ͘ 70 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ DESCRIPTION ƚĞƌƌĂĐĞŝƐĂĨƌŽŶƚĂŐĞǁŚĞƌĞƚŚĞďƵŝůĚŝŶŐĨĂĕĂĚĞŝƐƐĞƚďĂĐŬ ĨƌŽŵƚŚĞƐƚƌĞĞƚ͕ƉĂƐĞŽ͕ŽƌŽƉĞŶƐƉĂĐĞ͕ďLJĂŶĞůĞǀĂƚĞĚŽƉĞŶ ĂƌĞĂƚŚĂƚŝƐƉĂǀĞĚŽƌƉůĂŶƚĞĚ͘dŚŝƐĨƌŽŶƚĂŐĞƚLJƉĞĐĂŶĞīĞĐƟǀĞůLJ ďƵīĞƌďƵŝůĚŝŶŐƵƐĞƐĨƌŽŵƚŚĞƐŝĚĞǁĂůŬ͘ dŚŝƐƚLJƉĞŝƐƌĞĐŽŵŵĞŶĚĞĚĨŽƌƌĞƐŝĚĞŶƟĂůĂŶĚĐŽŵŵĞƌĐŝĂůƵƐĞ ĂƐŝƚĂůůŽǁƐĨŽƌƐĞŵŝͲƉƌŝǀĂƚĞƵƐĞŽĨĨƌŽŶƚĂŐĞĂƌĞĂƐ͘ E. TERRACE FRONTAGE DESCRIPTION WŽƌĐŚĨƌŽŶƚĂŐĞŝƐĂĐŽŵŵŽŶĨƌŽŶƚĂŐĞǁŚĞƌĞƚŚĞĨĂĐĂĚĞŝƐƐĞƚ ďĂĐŬĨƌŽŵƚŚĞƌŝŐŚƚŽĨǁĂLJĂŶĚĂƉŽƌĐŚŝƐĂƉƉĞŶĚĞĚƚŽƚŚĞ ĨĂĕĂĚĞ͕ĞŶĐƌŽĂĐŚŝŶŐŝŶƚŽƚŚĞĨƌŽŶƚLJĂƌĚ͘dŚŝƐĨƌŽŶƚĂŐĞƚLJƉĞŝƐ ƉƌŝŵĂƌŝůLJĂƐƐŽĐŝĂƚĞĚǁŝƚŚƐŝŶŐůĞĨĂŵŝůLJŚŽƵƐĞƐ͕ďƵƚƵƐĞĚǁŝƚŚ ŽƚŚĞƌďƵŝůĚŝŶŐƚLJƉĞƐĚĞƉĞŶĚŝŶŐŽŶƚŚĞĐŽŶƚĞdžƚŝŶĂůůĐĂƐĞƐ͘ WŽƌĐŚĞƐƚLJƉŝĐĂůůLJŚĂǀĞĂĨĞŶĐĞĚĞĮŶŝŶŐƚŚĞĂƌĞĂŽĨƚŚĞƉŽƌĐŚ ĂƐǁĞůůĂƐĂŶŽǀĞƌŚĂŶŐŽƌŽǀĞƌŚĞĂĚĐŽǀĞƌĂŐĞ͘ ĨĞŶĐĞŽƌǁĂůůĂƚƚŚĞƉƌŽƉĞƌƚLJůŝŶĞǁŽƵůĚŶŽƚďĞƵƐĞĚƚŽ ĚĞĮŶĞƚŚĞƉƌŝǀĂƚĞƐƉĂĐĞǁŚĞƌĞƉŽƌĐŚĞƐĂƌĞƉƌŽǀŝĚĞĚ͘ F. PORCH FRONTAGE HEARING DRAFT OCTOBER 2018 | d,W>Eͮ71 4 4.3.3 Beach Boulevard Re-Design ĞĂĐŚ ŽƵůĞǀĂƌĚ ŝƐ Ă ƐƚƌĞĞƚ ŽĨ ƌĞŐŝŽŶĂů ĂŶĚ ůŽĐĂů ŝŵƉŽƌƚĂŶĐĞ͘ƐĂ^ƚĂƚĞ,ŝŐŚǁĂLJĂŶĚĂŶĞŝŐŚƚͲůĂŶĞ͕ ŚŝŐŚͲĐĂƉĂĐŝƚLJĨĂĐŝůŝƚLJ͕ŝƚƉƌŽǀŝĚĞƐĂĚŝƌĞĐƚĐŽŶŶĞĐƟŽŶ ƚŽŵƵůƟƉůĞĨƌĞĞǁĂLJƐ͕ĂƐǁĞůůĂƐƚŚĞďĞĂĐŚ͘/ƚŝƐĂůƐŽƚŚĞ ŶŽƌƚŚͲƐŽƵƚŚƐƉŝŶĞĨŽƌůŽĐĂůƚƌĂĸĐƚƌĂǀĞůŝŶŐƚŽŶĞĂƌďLJ ĐŝƟĞƐ ĨŽƌ ǁŽƌŬ͕ ƐĐŚŽŽů Žƌ ƐŚŽƉƉŝŶŐ͘ dŚŝƐ ƐĞĐƟŽŶ ĞdžƉůŽƌĞƐǁĂLJƐƚŽŝŵƉƌŽǀĞƚŚĞďŽƵůĞǀĂƌĚƐŽƚŚĂƚŝƚŝƐ ŵŽƌĞĂƩƌĂĐƟǀĞ͕ĚƌĂǁƐŶĞǁĚĞǀĞůŽƉŵĞŶƚ͕ĂƐǁĞůůĂƐ ƉƌŽǀŝĚĞĂƐĂĨĞƌĂŶĚŵŽƌĞƉůĞĂƐĂŶƚĞŶǀŝƌŽŶŵĞŶƚƚŽ ǁĂůŬĂŶĚďŝŬĞ͘ dŚĞŝƚLJŝƐĐŽŶƐŝĚĞƌŝŶŐƌĞůŝŶƋƵŝƐŚŵĞŶƚŽĨƚŚĞĞĂĐŚ ŽƵůĞǀĂƌĚƌŝŐŚƚͲŽĨͲǁĂLJĨƌŽŵĂůƚƌĂŶƐƐŽƚŚĂƚƚŚĞŝƚLJ ǁŽƵůĚ ŚĂǀĞ ĐŽŶƚƌŽů ŽǀĞƌ Ăůů ŝŵƉƌŽǀĞŵĞŶƚƐ ǁŝƚŚŝŶ ƚŚĞ ƌŝŐŚƚͲŽĨͲǁĂLJ͕ ŝŶĐůƵĚŝŶŐ ƐŝĚĞǁĂůŬƐ͕ ůĂŶĚƐĐĂƉŝŶŐ͕ ŵĞĚŝĂŶƐ͕ĚƌŝǀĞǁĂLJĂĐĐĞƐƐ͕ƉĞĚĞƐƚƌŝĂŶĐƌŽƐƐŝŶŐƐ͕ĂŶĚ ĂŶLJŶĞĐĞƐƐĂƌLJůĂŶĞŝŵƉƌŽǀĞŵĞŶƚƐƚŽĂĐĐŽŵŵŽĚĂƚĞ ƚƌĂĸĐ͘dŚŝƐƚƌĂŶƐĨĞƌƉƌŽĐĞƐƐŚĂƐĂůƌĞĂĚLJŽĐĐƵƌƌĞĚĨŽƌ ƚŚĞƐĞŐŵĞŶƚŽĨĞĂĐŚŽƵůĞǀĂƌĚŝŶƚŚĞŝƚLJŽĨƵĞŶĂ WĂƌŬ͘dŚĞƌĞůŝŶƋƵŝƐŚŵĞŶƚƉƌŽĐĞƐƐĐĂŶƚĂŬĞĂŶLJǁŚĞƌĞ ďĞƚǁĞĞŶϮϰĂŶĚϯϲͲŵŽŶƚŚƐ͘ ZĞŐĂƌĚůĞƐƐ ŽĨ ƚŚĞ ŽƵƚĐŽŵĞ ŽĨ ƚŚĞ ƌĞůŝŶƋƵŝƐŚŵĞŶƚ ĚĞĐŝƐŝŽŶ͕ ůĂŶĚƐĐĂƉĞ ŝŵƉƌŽǀĞŵĞŶƚƐ ǁŝůů ďĞ ŝŶĐŽƌƉŽƌĂƚĞĚĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚƚŽĐƌĞĂƚĞĂ ƵŶŝƋƵĞŝĚĞŶƟƚLJʹĚŝīĞƌĞŶƚĨƌŽŵŽƚŚĞƌĂƌƚĞƌŝĂůƐŝŶƚŚĞ ŝƚLJĂŶĚŽƚŚĞƌƐĞŐŵĞŶƚƐŽĨƚŚŝƐƌŽĂĚƚŽƚŚĞŶŽƌƚŚ ĂŶĚ ƐŽƵƚŚ͘ ,ŽǁĞǀĞƌ͕ ƚŚĞ ŝƚLJ ǁŽƵůĚ ŚĂǀĞ ŐƌĞĂƚĞƌ ĐŽŶƚƌŽů ŽǀĞƌ ƚŚĞ ƟŵŝŶŐ ĂŶĚ ĐŚŽŝĐĞ ŽĨ ƐƚƌĞĞƚƐĐĂƉĞ ĞŶŚĂŶĐĞŵĞŶƚƐŝĨƚŚĞŝƚLJĂƐƐƵŵĞƐŽǁŶĞƌƐŚŝƉŽĨƚŚĞ ƌŽĂĚǁĂLJ͘dŚĞĐŽŵŵƵŶŝƚLJĞdžƉƌĞƐƐĞĚĂĚĞƐŝƌĞĨŽƌĂ ƚƌĞĞƉĂůĞƩĞƚŚĂƚƉƌŽǀŝĚĞĚĐŽůŽƌ͕ƐŚĂĚĞ͕ĂŶĚƐĞĂƐŽŶĂů ĐŚĂŶŐĞƐ͘dŚĞLJĂůƐŽǁĂŶƚĞĚĂƉĂůĞƩĞƚŚĂƚĐŽƵůĚĞĂƐŝůLJ ďĞŝŶƚĞŐƌĂƚĞĚǁŝƚŚƚŚĞůĂŶĚƐĐĂƉŝŶŐŽĨĐŽŵŵĞƌĐŝĂů͕ ŽĸĐĞĂŶĚƌĞƐŝĚĞŶƟĂůƵƐĞƐĂůŽŶŐƚŚĞďŽƵůĞǀĂƌĚ͘ dŚĞĞdžŝƐƟŶŐƐŝĚĞǁĂůŬƌĂŶŐĞƐĨƌŽŵϱƚŽϭϬĨĞĞƚ͕ǁŝƚŚ ĂŶŽĐĐĂƐŝŽŶĂůƐƚƌĞĞƚƚƌĞĞĂĚũĂĐĞŶƚƚŽƚŚĞĐƵƌď͘dŚĞ ƌĞĚĞƐŝŐŶŽĨƚŚŝƐƉĞĚĞƐƚƌŝĂŶnjŽŶĞǁŝůůŝŶĐůƵĚĞĂƉůĂŶƚĞĚ ůĂŶĚƐĐĂƉĞďƵīĞƌďĞŚŝŶĚƚŚĞĐƵƌďƚŽƐĞƉĂƌĂƚĞĐĂƌƐ ĂŶĚƉĞĚĞƐƚƌŝĂŶƐĂŶĚĐƌĞĂƚĞĂĐŽŶƟŶƵŽƵƐůĂŶĚƐĐĂƉĞ ĞĚŐĞ ĂĚũĂĐĞŶƚ ƚŽ ƚŚĞ ƚƌĂǀĞů ůĂŶĞƐ͘ ƚ ƚŚĞ ďĂĐŬ ŽĨ ƚŚĞ ƐŝĚĞǁĂůŬ͕ ƐƚƌĞĞƚ ƚƌĞĞƐ ǁŝůů ďĞ ƉůĂŶƚĞĚ͕ ǁŚŝĐŚ ǁŝůů ƉƌŽǀŝĚĞ ĐŽůŽƌ ĂŶĚ ƐŚĂĚĞ ĨŽƌ ƉĞĚĞƐƚƌŝĂŶƐ͘ dŚĞ ĞdžŝƐƟŶŐŵĞĚŝĂŶĂŶĚƚƵƌŶůĂŶĞ͕ǁŚŝĐŚƌĂŶŐĞƐŝŶǁŝĚƚŚ ĨƌŽŵϯ͘ϱƚŽϭϴĨĞĞƚǁŝůůƌĞŵĂŝŶ͕ĂŶĚǁŝůůĂůƐŽŝŶĐůƵĚĞ ůĂŶĚƐĐĂƉŝŶŐ͘ &ŝŐƵƌĞ ϰͲϵ ďĞůŽǁ͕ ŝůůƵƐƚƌĂƚĞƐ ƚŚŝƐ ŶĞǁ ƚLJƉŝĐĂůĐƌŽƐƐͲƐĞĐƟŽŶĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ͘ &ŝŐƵƌĞϰͲϵWƌŽƉŽƐĞĚ^ƚƌĞĞƚƌŽƐƐ^ĞĐƟŽŶͲĞĂĐŚŽƵůĞǀĂƌĚ ϱΖϯΖϯΖ ϭϯΖ ϭϭΖ ϭϭΖ ϭϭΖ ϯ͘ϱΖʹϭϴΖ ϭϭΖ ϭϭΖ ϭϭΖ ϭϯΖϯΖ ϯΖ ϱΖ ϯΖϯΖ WƵďůŝĐĂƐĞŵĞŶƚŽƌ ĞĚŝĐĂƟŽŶĨŽƌ^ƚƌĞĞƚ dƌĞĞƐ ZKt WƵďůŝĐĂƐĞŵĞŶƚŽƌ ĞĚŝĐĂƟŽŶĨŽƌ^ƚƌĞĞƚ dƌĞĞƐ ^ŝĚĞǁĂůŬ ^ŝĚĞǁĂůŬdƌĂǀĞů>ĂŶĞƐ dƌĂǀĞů>ĂŶĞƐǀŐ͘DĞĚŝĂŶĂŶĚ dƵƌŶ>ĂŶĞϰϲΖ ϰϲΖϭϭΖ ϭϭΖ ϭϯϮΖͲϭϰϰΖ ZKt ZŝŐŚƚͲŽĨͲtĂLJ 72 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ 4.3.4 Planting Palette dŚĞƐĞůĞĐƟŽŶŽĨĨƵƚƵƌĞƐƚƌĞĞƚƚƌĞĞƐĨŽƌĞĂĐŚŽƵůĞǀĂƌĚ ŝƐĂŶĞƐƐĞŶƟĂůĞůĞŵĞŶƚŝŶĞƐƚĂďůŝƐŚŝŶŐĂƌĞǀŝƚĂůŝnjĞĚĂŶĚ ƵŶŝƋƵĞŝĚĞŶƟƚLJĨŽƌtĞƐƚŶĂŚĞŝŵ͘ƚƌĞĞƉĂůĞƩĞǁĂƐ ĚĞǀĞůŽƉĞĚǁŝƚŚƚŚĞŽŵŵƵŶŝƚLJĚǀŝƐŽƌLJŽŵŵŝƩĞĞ ƚŚƌŽƵŐŚƚŚĞĐĂƌĞĨƵůƐĞůĞĐƟŽŶŽĨƚƌĞĞƐǁŚŝĐŚƌĞƐƉŽŶĚ ƚŽƚŚĞĂǀĂŝůĂďůĞƉůĂŶƟŶŐĂƌĞĂĂŶĚĂƌĞĐŽŶƐŝƐƚĞŶƚǁŝƚŚ ƚŚĞŝƚLJ͛ƐĂƉƉƌŽǀĞĚƉůĂŶƚĂŶĚƚƌĞĞƉĂůĞƩĞ͘dŚĞĚLJŶĂŵŝĐ ŶĂƚƵƌĞŽĨƚŚĞƐƚƌĞĞƚĨƌŽŶƚĂŐĞĂůůŽǁƐĨŽƌĂŶĂůƚĞƌŶĂƟŶŐ ƐƉĞĐŝĞƐƉĂƩĞƌŶĂŶĚƉůĂŶƟŶŐƐĞƋƵĞŶĐĞ͘ dŚĞĚĞƐŝŐŶĐŽŶĐĞƉƚĨŽƌƚŚĞƚƌĞĞƉůĂŶƟŶŐƉůĂŶŝƐƚŽ ƉƌŽǀŝĚĞĂƐĞŶƐĞŽĨƌŚLJƚŚŵƚŚƌŽƵŐŚƚŚĞƌĞƉĞƟƟŽŶĂŶĚ ĂůƚĞƌŶĂƟŽŶŽĨƚǁŽƉƌŝŵĂƌLJǀŝƐƵĂůĐƵĞƐͲĐŽůŽƌĂŶĚƐŝnjĞ͘ dŚĞƵƐĞŽĨƚƌĞĞƐǁŝƚŚƐŵĂůůŐƌŽǁƚŚŚĂďŝƚƐƌĞƐƉŽŶĚƐƚŽ ƚŚĞƉĞĚĞƐƚƌŝĂŶƐĐĂůĞŽĨƚŚĞĞŶǀŝƌŽŶŵĞŶƚŝŶĐŽŶƚƌĂƐƚƚŽ ƚŚĞůĂƌŐĞƌĐĂŶŽƉLJƚƌĞĞƐ͘ZŚLJƚŚŵŝƐĂůƐŽƌĞƉƌĞƐĞŶƚĞĚŝŶ ƚŚĞƉĂƐƐŝŶŐŽĨƟŵĞ͕ĂƐǁŝƚŶĞƐƐĞĚƚŚƌŽƵŐŚƚŚĞĐŚĂŶŐŝŶŐ ŽĨƐĞĂƐŽŶƐ͘^ĞĂƐŽŶĂůǀĂƌŝĂƟŽŶŝƐǀŝƐŝďůĞƚŚƌŽƵŐŚĨĂůůŝŶŐŽĨ ůĞĂǀĞƐ͕ŶĞǁŐƌŽǁƚŚ͕ĐŚĂŶŐŝŶŐĨŽůŝĂŐĞĐŽůŽƌƐ͕ĂŶĚďƌŝŐŚƚ ďůŽŽŵŝŶŐŇŽǁĞƌƐ͘ƚLJƉŝĐĂůƉůĂŶƟŶŐƉůĂŶŝƐƐŚŽǁŶŝŶ &ŝŐƵƌĞϰͲϭϬ͕WůĂŶƟŶŐWůĂŶWĂƩĞƌŶ͘dŚĞĚĞƉŝĐƚĞĚƚLJƉŝĐĂů ƉůĂŶƟŶŐ ƉůĂŶ ŝƐ ĐŽŶƐŝĚĞƌĞĚ ĐŽŶĐĞƉƚƵĂů͘ ůů ĂƐͲďƵŝůƚ ƉůĂŶƟŶŐƉůĂŶƐĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚǁŝůůďĞƌĞǀŝĞǁĞĚ ĨŽƌůŝŶĞͲŽĨͲƐŝŐŚƚĐŽŶĐĞƌŶƐĂŶĚĂƌĞƐƵďũĞĐƚƚŽĂƉƉƌŽǀĂůďLJ ƚŚĞWƵďůŝĐtŽƌŬƐĞƉĂƌƚŵĞŶƚ͘ dŚĞŵĂŐĞŶƚĂͲƌĞĚƉĂƩĞƌŶŽĨƚŚĞƚƌĞĞƉĂůĞƩĞŵĂƌŬƐƚŚĞ ƉĂƐƐŝŶŐŽĨƟŵĞƚŚƌŽƵŐŚŝƚƐƐĞĂƐŽŶĂůĚŝƐƉůĂLJƐŽĨĐŽůŽƌ͘ dŚĞtĞƐƚĞƌŶZĞĚďƵĚĂŶŶŽƵŶĐĞƐƚŚĞĂƌƌŝǀĂůŽĨƐƉƌŝŶŐ ǁŝƚŚŝƚƐĞdžŚŝďŝƟŽŶŽĨůŝŐŚƚƚŽĚĞĞƉŵĂŐĞŶƚĂ͕ǁŚŝůĞƚŚĞ EĞǁĞĂůĂŶĚŚƌŝƐƚŵĂƐdƌĞĞĞdžŚŝďŝƚĂďƌŝůůŝĂŶƚƌĞĚĐŽůŽƌ ĚƵƌŝŶŐ ƚŚĞ ůĂƚĞ ƐƉƌŝŶŐ ĂŶĚ ƐƵŵŵĞƌ ŵŽŶƚŚƐ͘ sŝƐƵĂů ŝŶƚĞƌĞƐƚŝƐĐƌĞĂƚĞĚŶŽƚŽŶůLJǁŝƚŚĚƌĂŵĂƟĐĐŽůŽƌƐďƵƚĂůƐŽ ŝŶƚĞƌĞƐƟŶŐďƌĂŶĐŚŝŶŐƉĂƩĞƌŶƐ͘dŚĞĚĞĐŝĚƵŽƵƐtĞƐƚĞƌŶ ZĞĚďƵĚǁŝůůƉƌŽǀŝĚĞĂĚŝƐƉůĂLJŽĨĨĂůůĐŽůŽƌĚƵƌŝŶŐƚŚĞ ĂƵƚƵŵŶŵŽŶƚŚƐďĞĨŽƌĞůŽƐŝŶŐŝƚƐůĞĂǀĞƐ͘tŝƚŚƉƌŽƉĞƌ ƉƌƵŶŝŶŐ͕ƚŚĞďƌĂŶĐŚƐƚƌƵĐƚƵƌĞƐŽĨƚŚĞƐĞƐƉĞĐŝŵĞŶƐǁŝůů ĐƌĞĂƚĞĂƐƚƌŝŬŝŶŐǀŝĞǁĂůŽŶŐƚŚĞŽƌƌŝĚŽƌ͘ Western RedbudĂĚĚƐǀŝƐƵĂůŝŶƚĞƌĞƐƚǁŝƚŚƚŚĞŝƌŵĂŐĞŶƚĂƉŝŶŬƚŽƌĞĚĚŝƐŚ ƉƵƌƉůĞďůŽŽŵƐ͘dŚĞƐĞĚĞůŝĐĂƚĞďůŽƐƐŽŵƐŇŽǁĞƌŝŶƚŚĞƐƉƌŝŶŐ͕ďĞĨŽƌĞƚŚĞ ƚƌĞĞǁŝůůůĞĂĨŽƵƚ͘ƵƌŝŶŐƚŚĞĨĂůůƚŽǁŝŶƚĞƌŵŽŶƚŚƐƚŚĞĂƵƚƵŵŶĚŝƐƉůĂLJŽĨ ĐŽůŽƌĐŽŶƐŝƐƚƐŽĨďƌŝŐŚƚLJĞůůŽǁƐƚƵƌŶŝŶŐƚŽƌĞĚĂŶĚĮŶĂůůLJďƌŽǁŶ͘ EĞǁĞĂůĂŶĚŚƌŝƐƚŵĂƐdƌĞĞŝƐĂŶĞǀĞƌŐƌĞĞŶĂŶĚǁŝůůƉƌŽǀŝĚĞůĂƐƟŶŐ ĚĂƌŬŐƌĞĞŶĐŽůŽƌƚŚƌŽƵŐŚŽƵƚƚŚĞLJĞĂƌ͘ƵƌŝŶŐƐƉƌŝŶŐĂŶĚĐĂƌƌLJŝŶŐŝŶƚŽ ƐƵŵŵĞƌƚŚĞƐŚŽǁLJƌĞĚŇŽǁĞƌƐǁŝůůƉƌŽǀŝĚĞǀŝƐƵĂůŝŶƚĞƌĞƐƚ͘ Water Gum Tree ĂůƐŽƉƌŽǀŝĚĞƐůĂƐƟŶŐLJĞĂƌůŽŶŐĐŽůŽƌǁŝƚŚŝƚƐĞǀĞƌŐƌĞĞŶ ĐĂŶŽƉLJ͘dŚĞůĞĂĨĐŽůŽƌŝƐĂŵĞĚŝƵŵŐƌĞĞŶƉƌŽǀŝĚŝŶŐƐŽŵĞĐŽŶƚƌĂƐƚĨƌŽŵ ƚŚĞ ŽƚŚĞƌ ƐƚƌĞĞƚ ƚƌĞĞƐ͘  ƵƌŝŶŐ ƐƉƌŝŶŐ ĂŶĚ ĐĂƌƌLJŝŶŐ ŝŶƚŽ ƚŚĞ ƐƵŵŵĞƌ ƐŵĂůůLJĞůůŽǁŇŽǁĞƌƐĚĞǀĞůŽƉĂƚƚŚĞďĂƐĞŽĨƚŚĞůĞĂǀĞƐ͕ĐƌĞĂƟŶŐĂůŝŐŚƚĞƌ ĐŽůŽƌĞĚĐĂŶŽƉLJ͘ &ŝŐƵƌĞϰͲϭϬŽŶĐĞƉƚƵĂů WůĂŶƟŶŐWůĂŶWĂƩĞƌŶ WůĂŶƚdƌĞĞƐϯϬΖŽŶ ĞŶƚĞƌĂƚĂĐŬŽĨ ^ŝĚĞǁĂůŬ WůĂŶƚdƌĞĞƐϭϬΖŽŶĞŶƚĞƌ ĨƌŽŵƌŝǀĞǁĂLJƐ͕hƟůŝƚLJ WŽůĞƐ͕ĂŶĚ^ƚƌĞĞƚ>ŝŐŚƚƐ ϱΖ^ŝĚĞǁĂůŬ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ73 4 EKd^͗ tĂƚĞƌ'ƵŵƐƐŚŽƵůĚďĞƚŚĞƉƌŝŵĂƌLJƐƚƌĞĞƚƚƌĞĞ͘ ŶƚƌŝĞƐƐŚĂůůďĞŇĂŶŬĞĚďLJŽŶĞEĞǁĞĂůĂŶĚŚƌŝƐƚŵĂƐdƌĞĞŽŶĞĂĐŚƐŝĚĞ͕ĂtĞƐƚĞƌŶZĞĚďƵĚǁŝůůďĞƉůĂĐĞĚďĞƚǁĞĞŶ ƚŚĞEĞǁĞĂůĂŶĚŚƌŝƐƚŵĂƐdƌĞĞĂŶĚWƌŝŵĂƌLJƚƌĞĞ͘/ĨĞŶƚƌLJƐƉĂĐŝŶŐŽŶůLJĂůůŽǁƐĨŽƌŽŶĞƚƌĞĞƚŚĞE͘͘dƐŚĂůůďĞƵƐĞĚ͘ ůůdƌĞĞƐǁŝůůďĞƉůĂŶƚĞĚďĞŚŝŶĚƚŚĞƐŝĚĞǁĂůŬĂƚϯϬ͛ŽŶĐĞŶƚĞƌ͘ ůůƚƌĞĞƐĂƌĞĂƚůĞĂƐƚϮϱ͛ĂǁĂLJĨƌŽŵŝŶƚĞƌƐĞĐƟŽŶƐ͘ ůůƚƌĞĞƐĂƌĞĂƚůĞĂƐƚϭϬ͛ĂǁĂLJĨƌŽŵĚƌŝǀĞǁĂLJ͕ƵƟůŝƚLJƉŽůĞƐĂŶĚƐƚƌĞĞƚůŝŐŚƚƐ͘ ^ŚƌƵďƐ͕ĚƌŽƵŐŚƚƚŽůĞƌĂŶƚŐƌĂƐƐĞƐĂŶĚŐƌŽƵŶĚĐŽǀĞƌƐǁŝůůďĞƉůĂŶƚĞĚĂůŽŶŐƉĂƌŬǁĂLJĂŶĚĞĂƐĞŵĞŶƚ͘ ΎdŚĞĞdžĂĐƚůŽĐĂƟŽŶŽĨƐƚƌĞĞƚƚƌĞĞƐǁŝůůďĞĚĞƚĞƌŵŝŶĞĚďĂƐĞĚŽŶĚƌŝǀĞǁĂLJůŽĐĂƟŽŶƐĂŶĚƐŝŐŚƚͲůŝŶĞĚŝƐƚĂŶĐĞƌĞƋƵŝƌĞŵĞŶƚƐ͘ džŝƐƟŶŐDĞĚŝĂŶ͕ WůĂŶƟŶŐƚŽZĞŵĂŝŶ ϯΖ>ĂŶĚƐĐĂƉĞĂƐĞŵĞŶƚ ŽƌĞĚŝĐĂƟŽŶ ϯΖWĂƌŬǁĂLJ ĞŶƚĞƌůŝŶĞ ƌŽƵŐŚƚdŽůĞƌĂŶƚ'ƌĂƐƐĞƐ ĂŶĚ'ƌŽƵŶĚĐŽǀĞƌ^ŚŽƵůĚďĞ WůĂŶƚĞĚǁŝƚŚŝŶƚŚĞWĂƌŬǁĂLJĂŶĚ ĞĚŝĐĂƟŽŶͬĂƐĞŵĞŶƚ^ƉĂĐĞ d>ϰͳϮdZEW>EdW>dd TREES MARINA STRAWBERRY TREE ƌďƵƚƵƐΖDĂƌŝŶĂΖ ,ĞŝŐŚƚ͗ϮϬͲϰϬŌ ^ƉƌĞĂĚ͗ϮϬͲϯϬŌ dLJƉĞ͗ǀĞƌŐƌĞĞŶ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗WŝŶŬ >DKEKdd>Zh^, ĂůůŝƐƚĞŵŽŶĐŝƚƌŝŶƵƐ ,ĞŝŐŚƚ͗ϮϬͲϮϱŌ ^ƉƌĞĂĚ͗ϭϬͲϭϮŌ dLJƉĞ͗ǀĞƌŐƌĞĞŶ tĂƚĞƌhƐĞ͗DŽĚĞƌĂƚĞ &ůŽǁĞƌŽůŽƌ͗ZĞĚ &KZ^dWE^zZh ĞƌĐŝƐĐĂŶĂĚĞŶƐŝƐΖ&ŽƌĞƐƚ WĂŶƐLJΖ ,ĞŝŐŚƚ͗ϮϬŌ ^ƉƌĞĂĚ͗ϮϱŌ dLJƉĞ͗ĞĐŝĚƵŽƵƐ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗WŝŶŬ t^dZEZh ĞƌĐŝƐŽĐĐŝĚĞŶƚĂůŝƐ ,ĞŝŐŚƚ͗ϮϬŌ ^ƉƌĞĂĚ͗ϭϬͲϮϬŌ dLJƉĞ͗ĞĐŝĚƵŽƵƐ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗DĂŐĞŶƚĂ >hD/dZZEE FAN PALM ŚĂŵĂĞƌŽƉƐŚƵŵŝůŝƐΖĐĞƌŝĨĞƌĂΖ ,ĞŝŐŚƚ͗ϴͲϭϮŌ ^ƉƌĞĂĚ͗ϭϬͲϭϱŌ dLJƉĞ͗WĂůŵ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗Eͬ TOYON ,ĞƚĞƌŽŵĞůĞƐĂƌďƵƟĨŽůŝĂ ,ĞŝŐŚƚ͗ϮϬŌ ^ƉƌĞĂĚ͗ϭϬͲϮϬŌ dLJƉĞ͗ǀĞƌŐƌĞĞŶ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗ZĞĚ CREPE MYRTLE >ĂŐĞƌƐƚƌŽĞŵŝĂŝŶĚŝĐĂ ,ĞŝŐŚƚ͗ϮϱͲϯϬŌ ^ƉƌĞĂĚ͗ϭϱͲϮϱŌ dLJƉĞ͗ĞĐŝĚƵŽƵƐ tĂƚĞƌhƐĞ͗DŽĚĞƌĂƚĞ &ůŽǁĞƌŽůŽƌ͗WŝŶŬzĂƌƌŽǁ͕ EŝĂŐĂƌĂ͕ZĞĚ͕tŚŝƚĞ CATALINA IRONWOOD >LJŽŶŽƚŚĂŵŶƵƐŇŽƌŝďƵŶĚƵƐ ƐƐƉ͘ĂƐƉůĞŶŝŝĨŽůŝƵƐ ,ĞŝŐŚƚ͗ϮϬͲϯϬŌ tĞŝŐŚƚ͗ϭϱͲϮϬŌ dLJƉĞ͗ǀĞƌŐƌĞĞŶ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗tŚŝƚĞ 74 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ d>ϰͳϮdZEW>EdW>dd dZ^ΈKEd/EhΉ Et>E CHRISTMAS TREE DĞƚƌŽƐŝĚĞƌŽƐƚŽŵĞŶƚŽƐĂ ,ĞŝŐŚƚ͗ϮϬͲϯϬŌ ^ƉƌĞĂĚ͗ϭϬͲϭϱŌ dLJƉĞ͗ǀĞƌŐƌĞĞŶ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗ZĞĚ TORREY PINE WŝŶƵƐƚŽƌƌĞLJĂŶĂ ,ĞŝŐŚƚ͗ϮϱͲϳϱŌ ^ƉƌĞĂĚ͗ϮϱͲϱϬŌ dLJƉĞ͗ǀĞƌŐƌĞĞŶ tĂƚĞƌhƐĞ͗sĞƌLJ>Žǁ &ůŽǁĞƌŽůŽƌ͗Eͬ FERN PINE WŽĚŽĐĂƌƉƵƐŐƌĂĐŝůŝŽƌ ,ĞŝŐŚƚ͗ϮϬͲϯϱŌ ^ƉƌĞĂĚ͗ϭϬͲϮϬŌ dLJƉĞ͗ǀĞƌŐƌĞĞŶ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗/ŶƐŝŐŶŝĮĐĂŶƚ ŇŽǁĞƌƐ D:^d/hdzΠ INDIAN HAWTHORN ZŚĂƉŚŝŽůĞƉŝƐdžΖDŽŶƟĐΖ ,ĞŝŐŚƚ͗ϭϱͲϮϱŌ ^ƉƌĞĂĚ͗ϴͲϭϬŌ dLJƉĞ͗ǀĞƌŐƌĞĞŶ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗WŝŶŬ tdZ'hD dƌŝƐƚĂŶŝŽƉƐŝƐůĂƵƌŝŶĂ ,ĞŝŐŚƚ͗ϮϱͲϰϬŌ tĞŝŐŚƚ͗ϭϬͲϮϬŌ dLJƉĞ͗ǀĞƌŐƌĞĞŶ tĂƚĞƌhƐĞ͗DŽĚĞƌĂƚĞ &ůŽǁĞƌŽůŽƌ͗zĞůůŽǁ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ75 4 d>ϰͳϮdZEW>EdW>dd ^,Zh^E'ZKhEKsZ LITTLE RIVER WATTLE ĐĂĐŝĂĐŽŐŶĂƚĂŽƵƐŝŶ/Ʃ ,ĞŝŚƚ͗ϮͲϯŌ ^ƉƌĞĂĚ͗ϰͲϲŌ dLJƉĞ͗^ŚƌƵď tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗WĂůĞzĞůůŽǁ LITTLE JOHN DWARF Kdd>Zh^, ĂůůŝƐƚĞŵŽŶΖůŝƩůĞũŽŚŶΖ ,ĞŝŚƚ͗ϯͲϱŌ ^ƉƌĞĂĚ͗ϰͲϲŌ dLJƉĞ͗^ŚƌƵď tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗ZĞĚ DWARF DAYLILY ,ĞŵĞƌŽĐĂůůŝƐŚLJďƌŝĚ ,ĞŝŐŚƚ͗ϭͲϮŝŶ tĞŝŐŚƚ͗ϭͲϮŌ dLJƉĞ͗WĞƌĞŶŶŝĂů tĂƚĞƌhƐĞ͗DŽĚĞƌĂƚĞ &ůŽǁĞƌŽůŽƌ͗sĂƌŝĞƐ GOOSEBERRY ZŝďĞƐ^ƉƉ͘ ,ĞŝŐŚƚ͗ϰͲϲŌ ^ƉƌĞĂĚ͗ϰͲϲŌ dLJƉĞ͗^ŚƌƵď tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗sĂƌŝĞƐ KDWdEd>W>hD ĂƌŝƐƐĂŵĂĐƌŽĐĂƌƉĂ ΖŽdžǁŽŽĚĞĂƵƚLJΖ ,ĞŝŐŚƚ͗ϮŌ ^ƉƌĞĂĚ͗ϮŌ dLJƉĞ͗^ŚƌƵď tĂƚĞƌhƐĞ͗>ŽǁͲDŽĚĞƌĂƚĞ &ůŽǁĞƌŽůŽƌ͗tŚŝƚĞ NEW GOLD LANTANA >ĂŶƚĂŶĂdžΖEĞǁ'ŽůĚΖ ,ĞŝŐŚƚ͗ϭϮͲϭϱŝŶ ^ƉƌĞĂĚ͗ϭϮͲϮϰŝŶ dLJƉĞ͗WĞƌĞŶŶŝĂů tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗zĞůůŽǁ ^EdZh PYRACANTHA WLJƌĂĐĂŶƚŚĂŬŽŝĚnjƵŵŝŝΖ^ĂŶƚĂ ƌƵnjΖ ,ĞŝŐŚƚ͗ϱŌ ^ƉƌĞĂĚ͗ϮͲϯŌ dLJƉĞ͗^ŚƌƵďͬ'ƌŽƵŶĚĐŽǀĞƌ tĂƚĞƌhƐĞ͗DŽĚĞƌĂƚĞ &ůŽǁĞƌŽůŽƌ͗tŚŝƚĞ Ed>W>hDΖ'ZE ZWdΖ ĂƌŝƐƐĂŵĂĐƌŽĐĂƌƉĂ͚'ƌĞĞŶ ĂƌƉĞƚ͛ ,ĞŝŐŚƚ͗ϭϮͲϭϱŝŶ tĞŝŐŚƚ͗ϰͲϱŌ dLJƉĞ͗^ŚƌƵďͬ'ƌŽƵŶĚĐŽǀĞƌ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗tŚŝƚĞ 76 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ d>ϰͳϮdZEW>EdW>dd ^,Zh^E'ZKhEKsZΈKEd/EhΉ BALLERINA INDIAN HAWTHORN ZŚĂƉŚŝŽůĞƉŝƐŝŶĚŝĐĂ ΖĂůůĞƌŝŶĂΖ ,ĞŝŐŚƚ͗ϮͲϯŌ ^ƉƌĞĂĚ͗ϮͲϯŌ dLJƉĞ͗^ŚƌƵď tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗WŝŶŬ >h^' ^ĂůǀŝĂĐůĞǀĞůĂŶĚŝŝ ,ĞŝŐŚƚ͗ϰͲϱŌ ^ƉƌĞĂĚ͗ϰͲϱŌ dLJƉĞ͗^ŚƌƵď tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗ůƵĞsŝŽůĞƚ ,hDD/E'/Z^' ^ĂůǀŝĂƐƉĂƚŚĂĐĞĂ ,ĞŝŐŚƚ͗ϭͲϮŌ ^ƉƌĞĂĚ͗ϰͲϱŌ dLJƉĞ͗WĞƌĞŶŶŝĂů tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗ZŽƐĞWŝŶŬ COAST ROSEMARY tĞƐƚƌŝŶŐŝĂĨƌƵƟĐŽƐĂ ,ĞŝŐŚƚ͗ϰͲϲŌ ^ƉƌĞĂĚ͗ϲͲϭϮŌ dLJƉĞ͗^ŚƌƵď tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗tŚŝƚĞ ^hh>Ed^ 'ZEKE/hD ĞŽŶŝƵŵΖDŝŶƚ^ĂƵĐĞƌΖ ,ĞŝŐŚƚ͗ϮͲϯŌ ^ƉƌĞĂĚ͗ϭͲϮŌ dLJƉĞ͗^ƵĐĐƵůĞŶƚ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗zĞůůŽǁ CROWN OF THORNS ƵƉŚŽƌďŝĂŵŝůŝŝ ,ĞŝŐŚƚ͗ϯͲϲŌ ^ƉƌĞĂĚ͗ϮͲϯŌ dLJƉĞ͗^ƵĐĐƵůĞŶƚ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗sĂƌŝĞƐ >h>&>K ůŽĞΖůƵĞůĨΖ ,ĞŝŐŚƚ͗ϭͲϮŌ ^ƉƌĞĂĚ͗ϭͲϮŌ dLJƉĞ͗^ƵĐĐƵůĞŶƚ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗KƌĂŶŐĞ CHALK LIVEFOREVER ƵĚůĞLJĂƉƵůǀĞƌƵůĞŶƚĂ ,ĞŝŐŚƚ͗ϭͲϮŌ ^ƉƌĞĂĚ͗ϭͲϮŌ dLJƉĞ͗^ƵĐĐƵůĞŶƚ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗ZĞĚ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ77 4 d>ϰͳϮdZEW>EdW>dd ^hh>Ed^ΈKEd/EhΉ ,WZZ>zh͕ KhZ>KZΖ^E> ,ĞƐƉĞƌŽLJƵĐĐĂǁŚŝƉƉůĞŝ ,ĞŝŐŚƚ͗ϮͲϯŌ ^ƉƌĞĂĚ͗ϯͲϰŌ dLJƉĞ͗^ƵĐĐƵůĞŶƚ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗tŚŝƚĞ >W,EdΖ^&KK WŽƌƚƵůĂĐĂƌŝĂĂĨƌĂ ,ĞŝŐŚƚ͗ϴͲϭϮŌ ^ƉƌĞĂĚ͗ϰͲϲŌ dLJƉĞ͗^ƵĐĐƵůĞŶƚ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗>ĂǀĞŶĚĞƌ 'Z^^^E'Z^^ͳ>/< PACIFIC REEDGRASS ĂůĂŵĂŐƌŽƐƟƐŶƵƚŬĂĞŶƐŝƐ ,ĞŝŚƚ͗ϮͲϯŌ ^ƉƌĞĂĚ͗ϰŌ dLJƉĞ͗'ƌĂƐƐ tĂƚĞƌhƐĞ͗DŽĚĞƌĂƚĞͲ,ŝŐŚ &ůŽǁĞƌŽůŽƌ͗dĂŶ BERKELEY SEDGE ĂƌĞdžĚŝǀƵůƐĂ ,ĞŝŚƚ͗ϭͲϮŌ ^ƉƌĞĂĚ͗ϭͲϮŌ dLJƉĞ͗'ƌĂƐƐͲ>ŝŬĞ tĂƚĞƌhƐĞ͗DŽĚĞƌĂƚĞ &ůŽǁĞƌŽůŽƌ͗ƌŽǁŶ >h&>y>/>z ŝĂŶĞůůĂĐĂĞƌƵůĞĂΖĂƐƐĂ ůƵĞΖ ,ĞŝŚƚ͗ϭͲϮŌ ^ƉƌĞĂĚ͗ϭŌ dLJƉĞ͗'ƌĂƐƐͲ>ŝŬĞ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗>ŝŐŚƚůƵĞ WHITE STRIPED d^DE&>y>/>z ŝĂŶĞůůĂƚĂƐŵĂŶŝĐĂ ΖsĂƌŝĞŐĂƚĂΖ ,ĞŝŚƚ͗ϭͲϮŌ ^ƉƌĞĂĚ͗ϭŌ dLJƉĞ͗'ƌĂƐƐͲ>ŝŬĞ tĂƚĞƌhƐĞ͗DŽĚĞƌĂƚĞ &ůŽǁĞƌŽůŽƌ͗ůƵĞ >/dd>Zs&>y>/>z ŝĂŶĞůůĂƌĞǀŽůƵƚĂ>ŝƩůĞZĞǀ ,ĞŝŚƚ͗ϮͲϰŝŶ tĞŝŐŚƚ͗ϭͲϮŌ dLJƉĞ͗'ƌĂƐƐͲ>ŝŬĞ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗ůƵĞsŝŽůĞƚ >/&KZE/&^h &ĞƐƚƵĐĂĐĂůŝĨŽƌŶŝĐĂ ,ĞŝŚƚ͗ϮͲϯŌ ^ƉƌĞĂĚ͗ϭͲϮŌ dLJƉĞ͗'ƌĂƐƐ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗zĞůůŽǁ 78 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ d>ϰͳϮdZEW>EdW>dd 'Z^^^E'Z^^ͳ>/<ΈKEd/EhΉ KDDKEZh^, :ƵŶĐƵƐĞīƵƐƵƐ ,ĞŝŚƚ͗ϮͲϰŌ ^ƉƌĞĂĚ͗ϮͲϰŌ dLJƉĞ͗'ƌĂƐƐͲ>ŝŬĞ tĂƚĞƌhƐĞ͗DŽĚĞƌĂƚĞ &ůŽǁĞƌŽůŽƌ͗zĞůůŽǁ GIANT WILD RYE >ĞLJŵƵƐĐŽŶĚĞŶƐĂƚƵƐ ,ĞŝŚƚ͗ϮͲϯŌ ^ƉƌĞĂĚ͗ϭͲϮŌ dLJƉĞ͗'ƌĂƐƐ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗'ŽůĚĞŶtŚĞĂƚ DEER GRASS DƵŚůĞŶďĞƌŐŝĂƌŝŐĞŶƐ ,ĞŝŚƚ͗ϰͲϱŌ tĞŝŐŚƚ͗ϰͲϲŌ dLJƉĞ͗'ƌĂƐƐ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗^ŝůǀĞƌ d>^&^h &ĞƐƚƵĐĂŵĂŝƌĞŝ ,ĞŝŚƚ͗ϮͲϯŌ ^ƉƌĞĂĚ͗ϮͲϯŌ dLJƉĞ͗'ƌĂƐƐ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗tŚŝƚĞ >/:,>h&^h &ĞƐƚƵĐĂŐůĂƵĐĂΖůŝũĂŚůƵĞΖ ,ĞŝŚƚ͗ϭŌ ^ƉƌĞĂĚ͗ϭͲϮŌ dLJƉĞ͗'ƌĂƐƐ tĂƚĞƌhƐĞ͗>Žǁ &ůŽǁĞƌŽůŽƌ͗'ŽůĚĞŶ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ79 4 80 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚĞůĂŶĚƐĐĂƉŝŶŐǁŝƚŚŝŶĞdžŝƐƟŶŐŵĞĚŝĂŶƐŝƐŝŶĞdžĐĞůůĞŶƚ ĐŽŶĚŝƟŽŶ͘ /ƚ ŝƐ ĂŶƟĐŝƉĂƚĞĚ ƚŚĂƚ ƚŚĞ ĞdžŝƐƟŶŐ ŵĞĚŝĂŶ ĐŽŶĮŐƵƌĂƟŽŶĂŶĚƉůĂŶƟŶŐǁŝůůƌĞŵĂŝŶ͘WůĂŶƚƐĂŶĚƚƌĞĞƐ ƚŚĂƚŶĞĞĚƚŽďĞƌĞƉůĂĐĞĚŽǀĞƌƟŵĞƐŚŽƵůĚďĞƐĞůĞĐƚĞĚ ĨƌŽŵƚŚĞƚƌĞĞĂŶĚƉůĂŶƚƉĂůĞƩĞ͕dĂďůĞϰͲϮ͘ ^ƉĞĐŝĂůĂĐĐŽŵŵŽĚĂƟŽŶƐŵĂLJŶĞĞĚƚŽďĞŵĂĚĞƚŽĂůůŽǁ ƚƌĞĞŐƌŽǁƚŚǁŚŝůĞƐƟůůŵĂŝŶƚĂŝŶŝŶŐƐƵĸĐŝĞŶƚƐƉĂĐĞĨŽƌ ƐŝĚĞǁĂůŬƐĂŶĚďƵŝůĚŝŶŐƐ͘/ƚŝƐƌĞĐŽŵŵĞŶĚĞĚƚŚĂƚƐƚƌĞĞƚ ƚƌĞĞƐ ďĞ ƉůĂŶƚĞĚ ŝŶ ^ŝůǀĂ ĞůůƐ ǁŚĞƌĞ ĂƉƉƌŽƉƌŝĂƚĞ͘ dŽ ĞŶƐƵƌĞ ƚŚĂƚ ƚŚŝƐ ĐŽŶĐĞƉƚ ŝƐ ĨĞĂƐŝďůĞ ĂůŽŶŐ ĞĂĐŚ ŽƵůĞǀĂƌĚ͕ƚŚĞŝƚLJƐŚŽƵůĚĐŽŶƐŝĚĞƌŝŵƉůĞŵĞŶƟŶŐĂ ƉŝůŽƚƉƌŽŐƌĂŵƚŽƚĞƐƚƚŚŝƐƚLJƉĞŽĨƐLJƐƚĞŵ͘dŚĞƐĞŐƌŝĚͲůŝŬĞ ƐƚƌƵĐƚƵƌĞƐƉƌĞǀĞŶƚƐŽŝůĐŽŵƉĂĐƟŽŶ͕ĂůůŽǁŝŶŐĨŽƌŐƌĞĂƚĞƌ ƌŽŽƚŐƌŽǁƚŚĂŶĚŝŵƉƌŽǀŝŶŐƚƌĞĞŚĞĂůƚŚĂŶĚůŝĨĞƐƉĂŶ͘ dŚĞŚŝŐŚůLJƉĞƌǀŝŽƵƐůĂLJĞƌŽĨƐŽŝůďĞŶĞĂƚŚƚŚĞƚƌĞĞƐ ĂůƐŽŝŵƉƌŽǀĞƐƐƚŽƌŵǁĂƚĞƌŵĂŶĂŐĞŵĞŶƚďLJĂďƐŽƌďŝŶŐ ƌƵŶŽī͘ dŚĞ ƐŚƌƵď ĂŶĚ ŐƌŽƵŶĚ ĐŽǀĞƌ ƉĂůĞƩĞ ŚĂƐ ďĞĞŶ ƐĞůĞĐƚĞĚĨƌŽŵƚŚĞŝƚLJ͛ƐƌŽƵŐŚƚdŽůĞƌĂŶƚWůĂŶƚ>ŝƐƚƚŽ ĐŽŵƉůĞŵĞŶƚƚŚĞŵĂŐĞŶƚĂͲƌĞĚƐƚƌĞĞƚƚƌĞĞƉĂƩĞƌŶ͘dŚĞ ƚƌĞĞĂŶĚƉůĂŶƚůŝƐƚŝƐƉƌŽǀŝĚĞĚŝŶdĂďůĞϰͲϮ͕dƌĞĞĂŶĚ WĂůĞƩĞ͘ 4.3.5 Recent Caltrans Enhancements ĂůƚƌĂŶƐŚĂƐĂůƐŽĐŽŵƉůĞƚĞĚĂĨĞǁĞŶŚĂŶĐĞŵĞŶƚĂŶĚ ƐĂĨĞƚLJƉƌŽũĞĐƚƐĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ͘ŶĞǁƚƌĂĸĐ ƐŝŐŶĂůĂŶĚƉĞĚĞƐƚƌŝĂŶĐƌŽƐƐŝŶŐŚĂǀĞďĞĞŶĐŽŵƉůĞƚĞĚ Ăƚ ^ƚŽŶLJďƌŽŽŬ ƌŝǀĞ ĂŶĚ ĞĂĐŚ ŽƵůĞǀĂƌĚ͘ DĞĚŝĂŶ ĞŶŚĂŶĐĞŵĞŶƚƐĂŶĚĂĨĞŶĐĞŚĂǀĞĂůƐŽďĞĞŶĐŽŵƉůĞƚĞĚ ŽŶĞĂĐŚŽƵůĞǀĂƌĚďĞƚǁĞĞŶ>LJŶƌŽƐĞƌŝǀĞĂŶĚ ^ƚŽŶĞLJďƌŽŽŬ ƌŝǀĞ͘ ^ĞĐƟŽŶ ϰ͘ϲ͕ DŽďŝůŝƚLJ͕ ĨƵƌƚŚĞƌ ĚŝƐĐƵƐƐĞƐƉĞĚĞƐƚƌŝĂŶĞŶŚĂŶĐĞŵĞŶƚƐĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ͘ dŚĞĞdžŝƐƟŶŐŵĞĚŝĂŶƉůĂŶƟŶŐƐĂƌĞŝŶĞdžĐĞůůĞŶƚĐŽŶĚŝƟŽŶĂŶĚĂƌĞĞdžƉĞĐƚĞĚ ƚŽƌĞŵĂŝŶĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ͘ dŚĞŵĞĚŝĂŶƚƌĞĞƐĂŶĚŐƌŽƵŶĚĐŽǀĞƌĐŽŵƉůĞŵĞŶƚƚŚĞƉůĂŶƚƉĂůĞƩĞ ŝĚĞŶƟĮĞĚŝŶƚŚŝƐ^ƉĞĐŝĮĐWůĂŶ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ81 4 EĞǁ>ƐƚƌĞĞƚůŝŐŚƚƐŝŶĐƌĞĂƐĞǀŝƐŝďŝůŝƚLJĨŽƌƉĞĚĞƐƚƌŝĂŶĂŶĚǀĞŚŝĐƵůĂƌ ƚƌĂĸĐ͘ 4.3.6 Undergrounding Utilities and Improving Street Lights ŶŽƚŚĞƌ ŝŵƉŽƌƚĂŶƚ ĂƐƉĞĐƚ ŽĨ ŝŵƉƌŽǀŝŶŐ ĞĂĐŚ ŽƵůĞǀĂƌĚŝƐĂĚĚƌĞƐƐŝŶŐƚŚĞŽǀĞƌŚĞĂĚĞůĞĐƚƌŝĐ͕ƉŚŽŶĞ͕ ĐĂďůĞdsĂŶĚŝŶƚĞƌŶĞƚƐĞƌǀŝĐĞůŝŶĞƐ͕ƉŽůĞƐ͕ĂŶĚŐƵLJͲ ǁŝƌĞƐƚŚĂƚƚƌĂŶƐǀĞƌƐĞŵƵĐŚŽĨƚŚĞƐƚƌĞĞƚ͘dŚĞƵƟůŝƚLJ ƉŽůĞƐ ƚŚĂƚ ƌƵŶ ĂůŽŶŐ ĞĂĐŚ ŽƵůĞǀĂƌĚ ĂƌĞ ũŽŝŶƚůLJ ŽǁŶĞĚďLJ^ŽƵƚŚĞƌŶĂůŝĨŽƌŶŝĂĚŝƐŽŶ;^Ϳ͕ƚŚĞŝƚLJ ŽĨŶĂŚĞŝŵ͕ĂŶĚƚĞůĞĐŽŵŵƵŶŝĐĂƟŽŶĐŽŵƉĂŶŝĞƐ͘dŚĞ ƵŶĚĞƌŐƌŽƵŶĚŝŶŐŽĨƚŚĞƐĞƵƟůŝƟĞƐǁŝůůŝŵƉƌŽǀĞĞůĞĐƚƌŝĐ ƐLJƐƚĞŵƌĞůŝĂďŝůŝƚLJĨŽƌƚŚĞĂƌĞĂ͕ĂŶĚĂůůŽǁƐĨŽƌŽƚŚĞƌ ĂĞƐƚŚĞƟĐŝŵƉƌŽǀĞŵĞŶƚƐƚŽƚŚĞĐŽƌƌŝĚŽƌ͘dŚĞĞĂĐŚ ŽƵůĞǀĂƌĚƵŶĚĞƌŐƌŽƵŶĚŝŶŐƉƌŽũĞĐƚǁĂƐĂƉƉƌŽǀĞĚďLJ ŝƚLJŽƵŶĐŝůŝŶ:ƵůLJŽĨϮϬϭϳĂƐƉĂƌƚŽĨƚŚĞhŶĚĞƌŐƌŽƵŶĚ ŽŶǀĞƌƐŝŽŶ WƌŽŐƌĂŵΖƐ ϱͲzĞĂƌ WůĂŶ͘ dŚĞ ŝƚLJ ǁŝůů ĐŽŽƌĚŝŶĂƚĞ ǁŝƚŚ ^ ĂŶĚ ƚŚĞ ƚĞůĞĐŽŵŵƵŶŝĐĂƟŽŶ ĐŽŵƉĂŶŝĞƐŽŶĂũŽŝŶƚƉƌŽũĞĐƚƚŽƵŶĚĞƌŐƌŽƵŶĚĂůů ŽǀĞƌŚĞĂĚƵƟůŝƟĞƐ͘^ĂůƐŽŽǁŶƐϲϲ͕ϬϬϬǀŽůƚůŝŶĞƐ ƚŚĂƚƌƵŶĂůŽŶŐĂůůZŽĂĚĂŶĚƚƵƌŶƐŽƵƚŚŽŶĞĂĐŚ ŽƵůĞǀĂƌĚƚŽƚŚĞŝƚLJůŝŵŝƚ͕ĂŶĚǁŝůůƌĞŵĂŝŶŽǀĞƌŚĞĂĚ͘ dŚĞĐƵƌƌĞŶƚĨƵŶĚŝŶŐƐĞƚĂƐŝĚĞĨŽƌƵŶĚĞƌŐƌŽƵŶĚŝŶŐ^ ůŝŶĞƐŝŶĐůƵĚĞƐƚŚĞŝƌĚŝƐƚƌŝďƵƟŽŶůŝŶĞƐ;ϭϮ͕ϬϬϬǀŽůƚƐĂŶĚ ďĞůŽǁͿ͘^ŚŽƵůĚĂĚĚŝƟŽŶĂůĨƵŶĚŝŶŐďĞĐŽŵĞĂǀĂŝůĂďůĞ͕ ƚŚĞ ŝƚLJ ǁŝůů ƌĞǀŝĞǁ ĂĚĚŝƟŽŶĂů ƌŽĂĚǁĂLJƐ ǁŚĞƌĞ ^ůŝŶĞƐƉĂƐƐƚŚƌŽƵŐŚ͘ƐƉĂƌƚŽĨƚŚĞƵŶĚĞƌŐƌŽƵŶĚ ĐŽŶǀĞƌƐŝŽŶƉƌŽũĞĐƚ͕ƚŚĞŝƚLJǁŝůůŝŶƐƚĂůůŶĞǁůŝŐŚƚƉŽůĞƐ ƚŚĂƚŝŶĐůƵĚĞŶĞǁ>ůƵŵŝŶĂƌŝĞƐĨŽƌŝŶĐƌĞĂƐĞĚǀŝƐŝďŝůŝƚLJ ĂůŽŶŐƚŚĞƉƵďůŝĐƌŝŐŚƚͲŽĨͲǁĂLJ͘dŚĞĐŽŶĐĞƉƚƵĂůĚĞƐŝŐŶ ĨŽƌƚŚĞƐƚƌĞĞƚůŝŐŚƚƐŝƐƐŚŽǁŶŚĞƌĞ͘ dŚĞĞdžŝƐƟŶŐůŽĐĂƟŽŶŽĨƵƟůŝƚLJƉŽůĞƐĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚŝŵƉĞĚĞƐ ƉĞĚĞƐƚƌŝĂŶĂŶĚďŝĐLJĐůĞŵŽďŝůŝƚLJ͘ 82 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ 4.3.7 Branding the Boulevard ƵƌŝŶŐƚŚĞƉƌĞƉĂƌĂƟŽŶŽĨƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐ WůĂŶ͕ ƚŚĞ DĂLJŽƌ ŽĨ ŶĂŚĞŝŵ ŝŶŝƟĂƚĞĚ Ă ƐĞƉĂƌĂƚĞ ĞīŽƌƚƚŽĐŽŶƐŝĚĞƌĂĐŽƌƌŝĚŽƌͲǁŝĚĞƌĞďƌĂŶĚŝŶŐĞīŽƌƚ ƚŚĂƚǁŽƵůĚŝŶǀŽůǀĞĂůůƚŚĞĐŝƟĞƐĂůŽŶŐƚŚĞďŽƵůĞǀĂƌĚ ŝŶKƌĂŶŐĞŽƵŶƚLJ͘dŚŝƐĞīŽƌƚŝƐŬŶŽǁŶĂƐƚŚĞ͞ĞĂĐŚ ŽƵůĞǀĂƌĚ ŽĂůŝƟŽŶ͟ ĂŶĚ ŝŶĐůƵĚĞƐ ƚŚĞ ĐŝƟĞƐ ŽĨ >Ă ,ĂďƌĂ͕ >Ă DŝƌĂĚĂ͕ ƵĞŶĂ WĂƌŬ͕ ŶĂŚĞŝŵ͕ ^ƚĂŶƚŽŶ͕ tĞƐƚŵŝŶƐƚĞƌ͕'ĂƌĚĞŶ'ƌŽǀĞ͕ĂŶĚ,ƵŶƟŶŐƚŽŶĞĂĐŚ͘ ZĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵĞĂĐŚŽĨƚŚĞĐŝƟĞƐŵĞƚƌĞŐƵůĂƌůLJ ƚŽĚĞǀĞůŽƉƐŽŵĞĐŽŵŵŽŶƐƚƌĞĞƚƐĐĂƉĞĞůĞŵĞŶƚƐƚŚĂƚ ĐŽƵůĚďĞƵƐĞĚƚŽĞůĞǀĂƚĞƚŚĞŝŵĂŐĞĂŶĚŚŝƐƚŽƌŝĐĂů ŝŵƉŽƌƚĂŶĐĞŽĨƚŚŝƐĐŽƌƌŝĚŽƌŝŶKƌĂŶŐĞŽƵŶƚLJ͘ dŚĞƌĞďƌĂŶĚŝŶŐĞīŽƌƚŚĂƐƌĞƐƵůƚĞĚŝŶƚŚĞĐŽŶĐĞƉƚƵĂů ĚĞƐŝŐŶŽĨŶĞǁƐŝŐŶĂŐĞ͕ďĂŶŶĞƌƐ͕ŵŝůĞͲŵĂƌŬĞƌƐ͕ĂŶĚ ƉŽƚĞŶƟĂůŝŶƚĞƌƐĞĐƟŽŶƚƌĞĂƚŵĞŶƚƐƚŚĂƚĐĂŶďĞůŽĐĂƚĞĚ ƚŚƌŽƵŐŚŽƵƚ ƚŚĞ ϮϬͲŵŝůĞ ƌŽĂĚǁĂLJ͘ /Ŷ ĂĚĚŝƟŽŶ ƚŽ ŝĚĞŶƟĨLJŝŶŐƚŚĞŶƵŵďĞƌŽĨŵŝůĞƐƚŽƚŚĞďĞĂĐŚ͕ƚŚĞ ŵŝůĞͲŵĂƌŬĞƌƐ ĐŽƵůĚ ĂůƐŽ ĐŽŶƚĂŝŶ ƉŽŝŶƚƐ ŽĨ ŝŶƚĞƌĞƐƚ ŝŶĨŽƌŵĂƟŽŶƌĞůĂƚĞĚƚŽĚĞƐƟŶĂƟŽŶƐŝŶĞĂĐŚŝƚLJ͘dŚĞƐĞ ƌĞďƌĂŶĚŝŶŐĞůĞŵĞŶƚƐǁŝůůĐŽŶƟŶƵĞƚŽďĞƌĞĮŶĞĚďLJ ƚŚĞĐŽŵŵŝƩĞĞĂŶĚƚŚĞŶŝŵƉůĞŵĞŶƚĞĚďLJŝŶĚŝǀŝĚƵĂů ũƵƌŝƐĚŝĐƟŽŶƐ͘ /ƚ ŝƐ ƉŽƐƐŝďůĞ ƚŚĂƚ ƚŚĞ ĨĂďƌŝĐĂƟŽŶ ŽĨ ĐĞƌƚĂŝŶ ƐŝŐŶƐ ĂŶĚ ŵŝůĞͲŵĂƌŬĞƌƐ ĐŽƵůĚ ďĞ ĚŽŶĞ ŝŶͲ ŚŽƵƐĞďLJŽŶĞŽƌƚǁŽũƵƌŝƐĚŝĐƟŽŶƐ͕ƚŽŬĞĞƉĐŽƐƚƐĚŽǁŶ͘ ůŽŶŐǁŝƚŚƚŚĞƌĞďƌĂŶĚŝŶŐĞīŽƌƚ͕ƚŚĞĐŽŵŵŝƩĞĞŝƐ ĐŽŶƐŝĚĞƌŝŶŐ ĂŶŶƵĂů ĞǀĞŶƚƐ͕ ƐƵĐŚ ĂƐ Ă ŵĂƌĂƚŚŽŶ Žƌ ďŝŬĞĨĞƐƟǀĂů͕ƚŽĚƌĂǁĂƩĞŶƟŽŶƚŽĂŶĂƌĞĂƚŚĂƚŝƐƚŚĞ ĨŽĐƵƐŽĨƌĞǀŝƚĂůŝnjĂƟŽŶĞīŽƌƚƐďLJĞĂĐŚĐŝƚLJ͘ĚĚŝƟŽŶĂů ĞĐŽŶŽŵŝĐĚĞǀĞůŽƉŵĞŶƚĞīŽƌƚƐƟĞĚƚŽďƌĂŶĚŝŶŐĂƌĞ ĨƵƌƚŚĞƌĚŝƐĐƵƐƐĞĚŝŶŚĂƉƚĞƌϱ͕ĚŵŝŶŝƐƚƌĂƟŽŶĂŶĚ /ŵƉůĞŵĞŶƚĂƟŽŶ͘ ŶĞǀĞŶƚƐƵĐŚĂƐĂŝĐůĂǀŝĂĚĂLJĐŽƵůĚďĞĂůĂƵŶĐŚĞǀĞŶƚĨŽƌƚŚĞĞĂĐŚ ŽƵůĞǀĂƌĚƌĞďƌĂŶĚŝŶŐƚŚĂƚďĞĐŽŵĞƐĂŶĂŶŶƵĂůĞǀĞŶƚ͘ďŽǀĞ͗^ĂŶƚĂŶĂ ŝůĂǀŝĂ͕ϮϬϭϰ͘WŚŽƚŽƌĞĚŝƚ͗WůĂĐĞtŽƌŬƐ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ83 4 Figure 4-11 Proposed Branding for Beach Boulevard Merchandise MILE MARKERSThemed Signage Bus Shelter SignageIntersection Identity Median SignageBus Wraps 84 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ LINCOLN AVENUE ĚĚŝƟŽŶĂůĚĞǀĞůŽƉŵĞŶƚ ĐĂƉĂĐŝƚLJĂůůŽǁƐĨŽƌŵŝdžĞĚͲƵƐĞ ĐŽŶĮŐƵƌĂƟŽŶƐǁŝƚŚƐƚƌƵĐƚƵƌĞĚ ƉĂƌŬŝŶŐ͕ĐƌĞĂƟŶŐƐƉĂĐĞĨŽƌĂ ǀĂƌŝĞƚLJŽĨĐŽŵŵŽŶŽƉĞŶƐƉĂĐĞ ĂŵĞŶŝƟĞƐĨŽƌƌĞƐŝĚĞŶƚƐĂŶĚ ǀŝƐŝƚŽƌƐ ƉŽĐŬĞƚƉĂƌŬƚƵĐŬĞĚ ŝŶƚŽĂŶĞǁĚĞǀĞůŽƉŵĞŶƚ ŝƐĂŶĂŵĞŶŝƚLJĨŽƌĂƌĞĂ ďƵƐŝŶĞƐƐĞƐĂŶĚƌĞƐŝĚĞŶƚƐ &ŝŐƵƌĞϰͲϭϮůƚĞƌŶĂƟǀĞtĂLJƐƚŽ/ŶĐŽƌƉŽƌĂƚĞ Open Space in Future Development Projects 4.3.8 Outdoor Places Along the Boulevard KƵƚĚŽŽƌ ƉůĂĐĞƐ͕ Žƌ ƉĞŽƉůĞ ƉůĂĐĞƐ͕ ĂƌĞ ƐƉĂĐĞƐ ƚŚĂƚ ĞdžƚĞŶĚ ƚŚĞ ŝŶĚŽŽƌ ĞŶǀŝƌŽŶŵĞŶƚ ƚŽ ƚŚĞ ŽƵƚĚŽŽƌƐ͘ dŚĞLJĂƌĞĞƐƐĞŶƟĂůĐŽŵƉŽŶĞŶƚƐŽĨƉůĂĐĞŵĂŬŝŶŐʹĂŶĚ ĐŽŶƚƌŝďƵƚĞƐŝŐŶŝĮĐĂŶƚůLJƚŽƚŚĞĐŚĂƌĂĐƚĞƌĂŶĚĂĐƟǀŝƚLJ ůĞǀĞůŽĨĂƉůĂĐĞ͘dŚĞƐĞƉůĂĐĞƐĂƌĞĐƌĞĂƚĞĚƚŚƌŽƵŐŚƚŚĞ ĐůƵƐƚĞƌŝŶŐŽĨďƵŝůĚŝŶŐƐĂŶĚůĂŶĚƐĐĂƉĞƐƚŽĚĞĮŶĞƉůĂnjĂƐ͕ ĐŽƵƌƚLJĂƌĚƐ͕ƚĞƌƌĂĐĞƐ͕ŽƵƚĚŽŽƌĚŝŶŝŶŐĂƌĞĂƐ͕ƌŽŽĨƚŽƉ ŐĂƌĚĞŶƐĂŶĚƌĞĐƌĞĂƟŽŶĂƌĞĂƐ͘&ŽƌĂďƵƐLJĂƌƚĞƌŝĂůƐƵĐŚ ĂƐĞĂĐŚŽƵůĞǀĂƌĚ͕ƚŚĞůŽĐĂƟŽŶĂŶĚĚĞƐŝŐŶŽĨƚŚĞƐĞ ŽƵƚĚŽŽƌƐƉĂĐĞƐƌĞƋƵŝƌĞƐƐƉĞĐŝĂůĂƩĞŶƟŽŶ͘EĞǁŽƉĞŶ ƐƉĂĐĞƌĞƋƵŝƌĞŵĞŶƚƐ͕ŝŶĐůƵĚŝŶŐĚĞƐŝŐŶƐƚĂŶĚĂƌĚƐŚĂǀĞ ďĞĞŶĐƌĞĂƚĞĚĨŽƌĞĂĐŚŽĨƚŚĞŵŝdžĞĚͲƵƐĞ͕ƌĞƐŝĚĞŶƟĂů͕ ĂŶĚĐŽŵŵĞƌĐŝĂůĚĞƐŝŐŶĂƟŽŶƐŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶ͘dŚĞ ďĂƐŝĐĚĞƐŝŐŶƉĂƌĂŵĞƚĞƌƐŝŶĐůƵĚĞ͗ • ^ŚĂĚĞƉƌŽƚĞĐƟŽŶ͕ƐĞĂƟŶŐ͕ůŝŐŚƟŶŐ͕ĂŶĚƚƌĂƐŚ ƌĞĐĞƉƚĂĐůĞƐ͘^ŚĂĚĞĐĂŶďĞƉƌŽǀŝĚĞĚƚŚƌŽƵŐŚ ƵŵďƌĞůůĂƐ͕ĂǁŶŝŶŐƐ͕ƚƌĞůůŝƐĞƐ͕ĂŶĚĐĂŶŽƉŝĞƐ ƚŚĂƚĂƌĞŝŶƚĞŐƌĂƚĞĚŝŶƚŽƚŚĞďƵŝůĚŝŶŐŽƌŽǀĞƌ ŽƉĞŶƐƉĂĐĞƐ͘ • sŝƐƵĂůĨŽĐƵƐĨĞĂƚƵƌĞƐ͕ƐƵĐŚĂƐƉƵďůŝĐĂƌƚ͕ ĨŽƵŶƚĂŝŶ͕ƐƉĞĐŝŵĞŶƚƌĞĞ͕ŽƌƌĞĐƌĞĂƟŽŶĂƌĞĂƐ͕ ƚŽƐĞƌǀĞĂƐĂĨŽĐĂůƉŽŝŶƚŽĨƚŚĞƐƉĂĐĞ͘ • &ƵƌŶŝƚƵƌĞĂŶĚĮdžƚƵƌĞƐƐŚŽƵůĚĐŽŵƉůĞŵĞŶƚ ƚŚĞĂƌĐŚŝƚĞĐƚƵƌĂůƐƚLJůĞŽĨƚŚĞƉƌŽũĞĐƚ͘ • ŽŶŶĞĐƟǀŝƚLJƚŽŶĞĂƌďLJƉƵďůŝĐƐƉĂĐĞƐǀŝĂĂ ƉĂƐĞŽŽƌƐŝĚĞǁĂůŬ͘ • /ŶĐŽƌƉŽƌĂƟŶŐĂĐŽƌŶĞƌůĂŶĚƐĐĂƉĞĂƌĞĂ͕ ĐŽƵƌƚLJĂƌĚ͕ƉůĂnjĂ͕ŽƌƚĞƌƌĂĐĞĂƚĂŶLJŵĂũŽƌ ŝŶƚĞƌƐĞĐƟŽŶƚŽĞůĞǀĂƚĞƚŚĞĂƩƌĂĐƟǀĞŶĞƐƐ ĂŶĚƵƐĞŽĨƚŚĞƐƉĂĐĞ͘ • ĞƐŝŐŶŝŶŐĚŽŽƌƐ͕ǁŝŶĚŽǁƐĂŶĚďĂůĐŽŶŝĞƐƚŽ ŽƉĞŶŽƌůŽŽŬŽŶƚŽƚŚĞŽƵƚĚŽŽƌƐƉĂĐĞ͘ • hƐŝŶŐůĂŶĚƐĐĂƉĞƚƌĞĂƚŵĞŶƚƐ͕ƐƵĐŚĂƐǀŝŶĞƐ͕ ůĂƫĐĞ͕ŽƌƉůĂŶƚƐǁŝƚŚǀĞƌƟĐĂůĨŽƌŵƚŽƐŽŌĞŶ ǁĂůůƐƐƵƌƌŽƵŶĚŝŶŐƚŚĞƐƉĂĐĞ͘ &ŝŐƵƌĞϰͲϭϮŝůůƵƐƚƌĂƚĞƐƚŚĞĚŝīĞƌĞŶƚƚLJƉĞƐŽĨŽƵƚĚŽŽƌ ƉůĂĐĞƐƚŚĂƚĐĂŶďĞŝŶƚĞŐƌĂƚĞĚǁŝƚŚŶĞǁĚĞǀĞůŽƉŵĞŶƚ ĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ85 4 WƵďůŝĐůLJĂǀĂŝůĂďůĞŽƉĞŶƐƉĂĐĞ ĐŽƵůĚďĞƵƐĞĚƚŽĂĐƟǀĂƚĞƚŚĞ ƐƚƌĞĞƚǁŝƚŚŽƵƚĚŽŽƌĚŝŶŝŶŐ ĂŶĚƐĞĂƟŶŐ ZĞĚĞǀĞůŽƉŵĞŶƚĂƚƚŚĞ ƐŽƵƚŚĞĂƐƚĐŽƌŶĞƌŝƐĂŶ ŽƉƉŽƌƚƵŶŝƚLJĨŽƌǀĞƌƟĐĂůŵŝdžĞĚͲ ƵƐĞĚĞǀĞůŽƉŵĞŶƚǁŝƚŚŚŽƵƐŝŶŐ ŽǀĞƌƌĞƚĂŝůĂŶĚŽƚŚĞƌƐĞƌǀŝĐĞ ƵƐĞƐ džŝƐƟŶŐŐĂƐ ƐƚĂƟŽŶ dŚŝƐŝůůƵƐƚƌĂƟǀĞƐŚŽǁƐĂŶ ŽƵƚĚŽŽƌĂŵƉŚŝƚŚĞĂƚĞƌ͖ƚŚĞ ĮŶĂůƉůĂŶĨŽƌƚŚĞtĞƐƚŐĂƚĞ ƐŝƚĞŝƐĞdžƉĞĐƚĞĚƚŽŝŶĐůƵĚĞ ĂƉƵďůŝĐŽƉĞŶƐƉĂĐĞĂƌĞĂ ǁŚŝĐŚĐŽƵůĚďĞĂĐƟǀĞůLJ ƉƌŽŐƌĂŵŵĞĚĨŽƌtĞƐƚ ŶĂŚĞŝŵĞǀĞŶƚƐ dŚĞĚĞǀĞůŽƉŵĞŶƚƐƚĂŶĚĂƌĚƐ ĐŽŶƚĂŝŶĂůƚĞƌŶĂƟǀĞǁĂLJƐƚŽ ĚĞƐŝŐŶƚŚĞĐŽƌŶĞƌƐŽĨŵĂũŽƌ ŝŶƚĞƌƐĞĐƟŽŶƐ WŽƚĞŶƟĂůƌŽŽŌŽƉ ŐĂƌĚĞŶ;ƉƌŝǀĂƚĞ ŽƉĞŶƐƉĂĐĞͿ dŚĞƐƵŶŝĐŽŶ͕ĨŽƌŵĞƌůLJƉĂƌƚŽĨ ƚŚĞǁĂǀĞĨŽƵŶƚĂŝŶĂƚĂůŝĨŽƌŶŝĂ ĚǀĞŶƚƵƌĞΖƐ^ƵŶƐŚŝŶĞWůĂnjĂ͕ ǁĂƐŐŝǀĞŶƚŽƚŚĞŝƚLJďLJƚŚĞ ŝƐŶĞLJŽƌƉŽƌĂƟŽŶĂŶĚĐŽƵůĚďĞ ŝŶĐŽƌƉŽƌĂƚĞĚŝŶƚŽƚŚĞŽƉĞŶƐƉĂĐĞ ĚĞƐŝŐŶĨŽƌƚŚĞtĞƐƚŐĂƚĞƐŝƚĞBEACH BOULEVARD 86 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ 4.4 PARKS AND RECREATION WĂƌŬƐ͕ƌĞĐƌĞĂƟŽŶ͕ĂŶĚŽƉĞŶƐƉĂĐĞƉůĂLJĂŶŝŵƉŽƌƚĂŶƚ ƉĂƌƚŝŶƚŚĞŽǀĞƌĂůůƋƵĂůŝƚLJŽĨůŝĨĞĨŽƌtĞƐƚŶĂŚĞŝŵ ƌĞƐŝĚĞŶƚƐ͕ĞŵƉůŽLJĞĞƐ͕ĂŶĚǀŝƐŝƚŽƌƐ͘dŚƌĞĞƉƌŽŵŝŶĞŶƚ ƌĞĐƌĞĂƟŽŶĨĂĐŝůŝƟĞƐƉƌŽǀŝĚĞŽƉĞŶƐƉĂĐĞĂŶĚŽƵƚĚŽŽƌ ƌĞĐƌĞĂƟŽŶŽƉƉŽƌƚƵŶŝƟĞƐĨŽƌƚŚĞĂƌĞĂ͘ 4.4.1 Existing Parks ^ĐŚǁĞŝƚnjĞƌĂŶĚdǁŝůĂZĞŝĚƉĂƌŬƐƉƌŽǀŝĚĞĂƉƉƌŽdžŝŵĂƚĞůLJ ϮϱĂĐƌĞƐŽĨŽƉĞŶĂŶĚƌĞĐƌĞĂƟŽŶĂůƐƉĂĐĞƐǁŝƚŚŝŶƚŚĞ ďŽƵŶĚĂƌŝĞƐŽĨƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶ͘ŽƚŚ ƉĂƌŬƐĂƌĞĂĚũĂĐĞŶƚƚŽƐĐŚŽŽůĨĂĐŝůŝƟĞƐǁŝƚŚĂĚĚŝƟŽŶĂů ŽƉĞŶƐƉĂĐĞͬƉĂƌŬĂĐƌĞĂŐĞƚŚĂƚŝƐŶŽƚŝŶĐůƵĚĞĚŝŶƚŚŝƐ WůĂŶ͘ŽƚŚƉĂƌŬƐĂƌĞǁĞůůĂƉƉŽŝŶƚĞĚǁŝƚŚĂŵĞŶŝƟĞƐ ƚŚĂƚĂƉƉĞĂůƚŽĂǀĂƌŝĞƚLJŽĨĂŐĞƐĂŶĚĂĐƟǀŝƟĞƐ͘ Schweitzer Park >ŽĐĂƚĞĚŽŶƚŚĞĞĂƐƚƐŝĚĞŽĨƚŚĞ^WĂƌĞĂ͕^ĐŚǁĞŝƚnjĞƌ WĂƌŬŝƐϭϭ͘ϱĂĐƌĞƐŽĨĚĞĚŝĐĂƚĞĚŽƉĞŶƐƉĂĐĞ͕ϳĂĐƌĞƐŽĨ ǁŚŝĐŚĂƌĞǁŝƚŚŝŶƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͘ĞƐŝŐŶĂƚĞĚĂƐ ĂŶĞŝŐŚďŽƌŚŽŽĚƉĂƌŬ͕ĂŵĞŶŝƟĞƐŝŶĐůƵĚĞĂĐŚŝůĚƌĞŶΖƐ ƉůĂLJĂƌĞĂ͕ďĂƐŬĞƚďĂůůĐŽƵƌƚ͕ƉŝĐŶŝĐƚĂďůĞƐ͕ƌĞƐƚƌŽŽŵƐ͕ ĂƐŽŌďĂůůĮĞůĚĂŶĚĂƌĞĐĞŶƚůLJĐŽŵƉůĞƚĞĚƐŬĂƚĞĨĂĐŝůŝƚLJ͘ Twila Reid Park ĚũĂĐĞŶƚ ƚŽ dǁŝůĂ ZĞŝĚ ůĞŵĞŶƚĂƌLJ ^ĐŚŽŽů͕ ƚŚŝƐ ĐŽŵŵƵŶŝƚLJƉĂƌŬŝƐůŽĐĂƚĞĚŽŶƚŚĞǁĞƐƚƐŝĚĞŽĨƚŚĞ ^WĂƌĞĂ͘dŚĞƉĂƌŬŝƐϮϳ͘ϮĂĐĞƐŽĨǁŚŝĐŚϭϴĂĐƌĞƐ ĂƌĞǁŝƚŚŝŶƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͘ƐůĞǁŽĨĂŵĞŶŝƟĞƐ ƌĂŶŐŝŶŐ ĨƌŽŵ Ă <Ăŵ͊ ĐŚŝůĚƌĞŶΖƐ ƉůĂLJ ĂƌĞĂ͕ ĚŝƐĐ ŐŽůĨ͕ ŚŽƌƐĞƐŚŽĞ ƉŝƚƐ͕ ůŝŐŚƚĞĚ ƐƉŽƌƚƐ ĮĞůĚƐ͕ ƉŝĐŶŝĐ ƐŚĞůƚĞƌƐ ĂŶĚ ƚĂďůĞƐ͕ ƚŽ Ă ƌĞĐƌĞĂƟŽŶ ĐĞŶƚĞƌ ǁŝƚŚ ƉƵďůŝĐƌĞƐƚƌŽŽŵƐŚĂǀĞƐĞƌǀĞĚƚŚĞĐŽŵŵƵŶŝƚLJƐŝŶĐĞ ϭϵϲϱ͘dǁŽŶĞǁĂŵĞŶŝƟĞƐƚŚĂƚĂƉƉĞĂůƚŽƐĞŶŝŽƌƐŝŶ ƚŚĞ ĂƌĞĂ ŝŶĐůƵĚĞ ƐŚƵŋĞďŽĂƌĚ ĂŶĚ ƉŝĐŬůĞ ďĂůů͘ dŚŝƐ ƉĂƌŬŚŽƐƚƐƚŚĞĂŶŶƵĂůtĞƐƚŶĂŚĞŝŵEĞŝŐŚďŽƌŚŽŽĚ ĞǀĞůŽƉŵĞŶƚŽƵŶĐŝů;tEͿtĞƐƚĞƌŶĂƌďĞĐƵĞĂŶĚ ,ŽůŝĚĂLJdƌĞĞ>ŝŐŚƟŶŐĞǀĞŶƚ͘ EĞǁůLJƌĞƐƚŽƌĞĚĮĞůĚƐƉƌŽǀŝĚĞĂƉůĂĐĞĨŽƌůŽĐĂůŽƌŐĂŶŝnjĞĚƐƉŽƌƚƐŐƌŽƵƉƐƚŽ ƉƌĂĐƟĐĞĂŶĚĐŽŵƉĞƚĞ͘ EĞǁƉŝĐŬůĞďĂůůĐŽƵƌƚƐĂƌĞĂƉŽƉƵůĂƌĂŵĞŶŝƚLJĂƚdǁŝůĂZĞŝĚWĂƌŬ͘ >ŽĐĂůĞǀĞŶƚƐƐƵĐŚĂƐƚŚĞtEtĞƐƚĞƌŶĂƌďĞƋƵĞĂƌĞǁĞůůĂƩĞŶĚĞĚďLJ ƌĞƐŝĚĞŶƚƐĂŶĚƐƵƉƉŽƌƚĞĚďLJĂƌĞĂďƵƐŝŶĞƐƐĞƐ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ87 4 4.4.2 Park Improvements tŚŝůĞĂŵĞŶŝƟĞƐƐƵĐŚĂƐƚŚĞƐŬĂƚĞƉĂƌŬĂŶĚƉŝĐŬůĞ ďĂůůĐŽƵƌƚǁĞƌĞƌĞĐĞŶƚůLJĂĚĚĞĚƚŽƚŚĞƉĂƌŬƐŶŽƚĞĚ ĂďŽǀĞ͕ĨƵƚƵƌĞŝŵƉƌŽǀĞŵĞŶƚƐĨŽƌďŽƚŚƉĂƌŬƐŝŶĐůƵĚĞ ƐĂĨĞƚLJ ĞŶŚĂŶĐĞŵĞŶƚƐ͘ dŚĞ ŝƚLJΖƐ ŽŵŵƵŶŝƚLJ ^ĞƌǀŝĐĞΖƐ ĂŶĚ WŽůŝĐĞ ĚĞƉĂƌƚŵĞŶƚƐ ĂƌĞ ǁŽƌŬŝŶŐ ƚŽŐĞƚŚĞƌƚŽĂĚĚĐĂŵĞƌĂƐĂŶĚůŝŐŚƟŶŐƚŽďŽƚŚƉĂƌŬƐ͘ dŚĞƌĞ ĂƌĞ ĂůƐŽ ƐĞǀĞƌĂů ŽƉƉŽƌƚƵŶŝƟĞƐ ƚŽ ŝŶƚĞŐƌĂƚĞ ƐƵƐƚĂŝŶĂďůĞŝŶĨƌĂƐƚƌƵĐƚƵƌĞŝŶƚŽƚŚĞƐĞĂƌĞĂƐ͘ŚĂƉƚĞƌ ϱ͕ĚŵŝŶŝƐƚƌĂƟŽŶĂŶĚ/ŵƉůĞŵĞŶƚĂƟŽŶ͕ĚĞƐĐƌŝďĞƐƚŚĞ ĂĐƟŽŶƐƚŽĐŽŵƉůĞƚĞƚŚĞƐĞŝŵƉƌŽǀĞŵĞŶƚƐ͘ 4.4.3 West Anaheim Youth Center dŚĞtĞƐƚŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌ;tzͿĨĞĂƚƵƌĞƐĂŶ ĂƉƉƌŽdžŝŵĂƚĞůLJϭϬ͕ϬϬϬƐƋƵĂƌĞĨŽŽƚŐLJŵŶĂƐŝƵŵǁŝƚŚ ĂĨƵůůƐŝnjĞďĂƐŬĞƚďĂůůĐŽƵƌƚ͕ƐŝdžŚĂůĨͲĐŽƵƌƚƐ͕ĂŶĚƚǁŽ ǀŽůůĞLJďĂůůĐŽƵƌƚƐ͘KƚŚĞƌĨĂĐŝůŝƚLJĂŵĞŶŝƟĞƐŝŶĐůƵĚĞĂ ĐŽŵŵƵŶŝƚLJƌŽŽŵ͕ĚĂŶĐĞͬĮƚŶĞƐƐƌŽŽŵ͕ĐŽŵƉƵƚĞƌůĂď͕ ƚǁŽLJŽƵƚŚĂĐƟǀŝƚLJƌŽŽŵƐ͕ĂŶĚƚǁŽƌŽŽŵƐĚĞĚŝĐĂƚĞĚ ƚŽƚĞĞŶƉƌŽŐƌĂŵŵŝŶŐ͘dŚŝƐĨĂĐŝůŝƚLJŝƐĂƉĂƌƚŶĞƌƐŚŝƉ ďĞƚǁĞĞŶ ƚŚĞ ŝƚLJ ŽĨ ŶĂŚĞŝŵ͕ ŽLJƐ Θ 'ŝƌůƐ ůƵďƐ͕ zD͕ĂŶĚƚŚĞDĂŐŶŽůŝĂ^ĐŚŽŽůŝƐƚƌŝĐƚ͘dŚƌŽƵŐŚŽƵƚ ƚŚĞ ĐŽŵŵƵŶŝƚLJ ĞŶŐĂŐĞŵĞŶƚ ƉŚĂƐĞ ŽĨ ƚŚĞ ƉƌŽũĞĐƚ ƐĞǀĞƌĂů ƐĞŶŝŽƌƐ ƌĞƋƵĞƐƚĞĚ ƉƌŽŐƌĂŵƐ ĂŶĚ ĐůĂƐƐĞƐ ŐĞĂƌĞĚ ƚŽǁĂƌĚ ƚŚĞŝƌ ĚĞŵŽŐƌĂƉŚŝĐ ĂŶĚ ŶŽƚĞĚ ƚŚĂƚ ƚŚĞtzŵĂLJďĞĂƉŽƚĞŶƟĂůƐƉĂĐĞƚŽŚŽůĚĐůĂƐƐĞƐ͘ ƚƚŚŝƐƟŵĞƚŚĞƌĞĂƌĞŶŽŵĂũŽƌĐŚĂŶŐĞƐĞdžƉĞĐƚĞĚĨŽƌ ƚŚĞtz͕ŚŽǁĞǀĞƌ͕ƐĞĐƟŽŶƐϰ͘ϱ^ƵƐƚĂŝŶĂďŝůŝƚLJĂŶĚ ϰ͘ϴWŽůŝĐĞĂŶĚ&ŝƌĞ͕ĚĞƐĐƌŝďĞŽƉƉŽƌƚƵŶŝƟĞƐƚŽĞdžƉĂŶĚ ƐĞƌǀŝĐĞƐŽŶƚŚĞtzƉƌŽƉĞƌƚLJ͘ dŚĞŶĞǁƐŬĂƚĞƉĂƌŬĂƚ^ĐŚǁĞŝƚnjĞƌWĂƌŬŝƐĂƉŽƉƵůĂƌŚĂŶŐŽƵƚƐƉŽƚĨŽƌ tĞƐƚŶĂŚĞŝŵLJŽƵƚŚ͘ dŚĞtĞƐƚŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌŚŽƐƚĞĚĐŽŵŵƵŶŝƚLJǁŽƌŬƐŚŽƉƐĂŶĚƚŚĞ ŽŵŵƵŶŝƚLJĚǀŝƐŽƌLJŽŵŵŝƩĞĞŵĞĞƟŶŐƐĨŽƌƚŚŝƐ^ƉĞĐŝĮĐWůĂŶ͘ 88 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ 4.5 SUSTAINABILITY ŶĂŚĞŝŵŚĂƐĂůǁĂLJƐďĞĞŶĂŶ͞ĞĂƌůLJĂĚŽƉƚĞƌ͟ǁŚĞŶ ŝƚ ĐŽŵĞƐ ƚŽ ƐƵƐƚĂŝŶĂďŝůŝƚLJ ĂŶĚ ŐƌĞĞŶ ŝŶŝƟĂƟǀĞƐ͕ ĂƐ ĚĞŵŽŶƐƚƌĂƚĞĚďLJƚŚĞŶĂŚĞŝŵWƵďůŝĐhƟůŝƟĞƐ;WhͿ ŵŝƐƐŝŽŶ ƐƚĂƚĞŵĞŶƚ ĨƌŽŵ ƚŚĞ ŝƚLJ͛Ɛ ',' ZĞĚƵĐƟŽŶ WůĂŶ͗ dŚĞ΀Wh΁ŝƐĐŽŵŵŝƩĞĚƚŽƌĞĚƵĐŝŶŐ','ĞŵŝƐƐŝŽŶƐ ďLJŝŵƉůĞŵĞŶƟŶŐŶŽƚŽŶůLJƚŚĞůĞƩĞƌŽĨƐƚĂƚĞůĂǁƐ ĂŶĚ ƌĞŐƵůĂƟŽŶƐ͕ ďƵƚ ĂůƐŽ ƚŚĞŝƌ ƐƉŝƌŝƚ͕ ŝŶ ŽƌĚĞƌ ƚŽ ŵĂŬĞ ŶĂŚĞŝŵ ŵŽƌĞ ƐƵƐƚĂŝŶĂďůĞ ĨŽƌ ĨƵƚƵƌĞ ŐĞŶĞƌĂƟŽŶƐǁŚŝůĞďĂůĂŶĐŝŶŐƚŚĞŶĞĞĚƚŽŵŝƟŐĂƚĞ ĐƵƐƚŽŵĞƌƌĂƚĞŝŵƉĂĐƚƐ͘ dŚĞĨŽůůŽǁŝŶŐŬĞLJƐƵƐƚĂŝŶĂďŝůŝƚLJŽƉƉŽƌƚƵŶŝƟĞƐǁĞƌĞ ŝĚĞŶƟĮĞĚĨŽƌƚŚĞ^WŝŶƚŚĞ','ZĞĚƵĐƟŽŶWůĂŶ͕ ĨƌŽŵĐŽŵŵƵŶŝƚLJĨĞĞĚďĂĐŬ͕ĂŶĚŝŶŵĞĞƟŶŐƐǁŝƚŚƚŚĞ ŝƚLJ WůĂŶŶŝŶŐ ĂŶĚ WƵďůŝĐ hƟůŝƚLJ ĚĞƉĂƌƚŵĞŶƚƐ͘ dŚĞ ŽƉƉŽƌƚƵŶŝƟĞƐĂƌĞŽƌŐĂŶŝnjĞĚďLJƚŽƉŝĐĂŶĚĚĞƐĐƌŝďĞĚ ďĞůŽǁ͕ ĂĐĐŽŵƉĂŶLJŝŶŐ ƐƵƐƚĂŝŶĂďůĞ ŝŵƉůĞŵĞŶƚĂƟŽŶ ĂĐƟŽŶƐĂƌĞƉƌŽǀŝĚĞĚŝŶŚĂƉƚĞƌϱ͕ĚŵŝŶŝƐƚƌĂƟŽŶĂŶĚ /ŵƉůĞŵĞŶƚĂƟŽŶ͘ High Quality Transit Areas dŚĞĂƌĞĂƐĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚĂŶĚ>ŝŶĐŽůŶǀĞŶƵĞ ĂƌĞĚĞƐŝŐŶĂƚĞĚĂƐ,ŝŐŚYƵĂůŝƚLJdƌĂŶƐŝƚƌĞĂƐ;,YdƐͿ ďLJ^'ŝŶƚŚĞϮϬϭϲͲϮϬϰϬZĞŐŝŽŶĂůdƌĂŶƐƉŽƌƚĂƟŽŶ WůĂŶͬ^^;ZdWͬ^^Ϳ͘dŚĞLJƋƵĂůŝĨLJĂƐƐƵĐŚ͕ďĞĐĂƵƐĞ ƚŚĞLJ ĂƌĞ ǁŝƚŚŝŶ ŽŶĞ ŚĂůĨͲŵŝůĞ ŽĨ ƚƌĂŶƐŝƚ ƐƚŽƉƐ ƚŚĂƚ ĂƌĞƐĞƌǀŝĐĞĚĂƚůĞĂƐƚĞǀĞƌLJϭϱŵŝŶƵƚĞƐĚƵƌŝŶŐƉĞĂŬ ĐŽŵŵƵƟŶŐ ŚŽƵƌƐ͕ ŵĂŬŝŶŐ ƚŚĞŵ ƉƌŝŵĞ ůŽĐĂƟŽŶƐ ĨŽƌ ƐƵƐƚĂŝŶĂďůĞ ŚŽƵƐŝŶŐ ĂŶĚ ĞŵƉůŽLJŵĞŶƚ ŐƌŽǁƚŚ͘ >ŽĐĂƟŶŐŶĞǁŚŽƵƐŝŶŐĂŶĚũŽďƐŝŶĂƌĞĂƐǁŚĞƌĞĨƌĞƋƵĞŶƚ ƚƌĂŶƐŝƚŽƉƟŽŶƐĂƌĞĂǀĂŝůĂďůĞĐĂŶƐŝŐŶŝĮĐĂŶƚůLJƌĞĚƵĐĞ ǀĞŚŝĐůĞ ŵŝůĞƐ ƚƌĂǀĞůĞĚ ;sDdͿ ďĞĐĂƵƐĞ ĐŽŶǀĞŶŝĞŶƚ ĂĐĐĞƐƐŵĂŬĞƐŝƚĞĂƐŝĞƌĨŽƌŵŽƌĞƉĞŽƉůĞƚŽƵƐĞƚƌĂŶƐŝƚ ĨŽƌƚŚĞŝƌĚĂŝůLJĐŽŵŵƵƚĞŝŶƐƚĞĂĚŽĨƉĞƌƐŽŶĂůǀĞŚŝĐůĞƐ͘ /ŶĐƌĞĂƐŝŶŐƚƌĂŶƐŝƚƌŝĚĞƌƐŚŝƉ͕ŝŶƚƵƌŶ͕ĂůůŽǁƐƚƌĂŶƐŝƚ ŽƉĞƌĂƚŽƌƐ ƚŽ ŝŶĐƌĞĂƐĞ ĐĂƉĂĐŝƚLJ ĂŶĚ ƉƌŽǀŝĚĞ ĞǀĞŶ ŵŽƌĞĨƌĞƋƵĞŶƚƐĞƌǀŝĐĞƚŽŵŽƌĞĂƌĞĂƐ͘ dƌĂŶƐŝƚ WƌŝŽƌŝƚLJ WƌŽũĞĐƚƐ ;dWWͿ͘ƐĂŶŝŶĐĞŶƟǀĞƚŽ ĞŶĐŽƵƌĂŐĞƚŚĞŐƌŽǁƚŚĞŶǀŝƐŝŽŶĞĚŝŶĂŶĚĂƌŽƵŶĚ,ŝŐŚ YƵĂůŝƚLJdƌĂŶƐŝƚƌĞĂƐďLJƚŚĞZdWͬ^^͕ƉƌŽũĞĐƚƐƚŚĂƚ ŵĞĞƚƚŚĞƌĞƋƵŝƌĞŵĞŶƚƐĂƌĞĞůŝŐŝďůĞĨŽƌĂǀĂƌŝĞƚLJŽĨ YƐƚƌĞĂŵůŝŶŝŶŐŽƉƟŽŶƐ͘dŽŵĞĞƚƌĞƋƵŝƌĞŵĞŶƚƐ͕ ƉƌŽũĞĐƚƐŵƵƐƚ͕ϭͿďĞǁŝƚŚŝŶЪŵŝůĞŽĨĂŶ,Yd;ǁŚŝĐŚ ŝŶĐůƵĚĞƐĂůůŽĨƚŚĞ^WĂƌĞĂͿ͕ϮͿďĞĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞ ^^ĂƐĚĞƚĞƌŵŝŶĞĚďLJƚŚĞŝƚLJŽĨŶĂŚĞŝŵ͕ϯͿĐŽŶƚĂŝŶ ĂƚůĞĂƐƚϱϬƉĞƌĐĞŶƚƌĞƐŝĚĞŶƟĂůƵƐĞ͕ĂŶĚϰͿƉƌŽƉŽƐĞĂ ŵŝŶŝŵƵŵŽĨϮϬĚǁĞůůŝŶŐƵŶŝƚƐƉĞƌĂĐƌĞ͘ /ŶĮůůĞǀĞůŽƉŵĞŶƚ dŚĞ ĞĂĐŚ ŽƵůĞǀĂƌĚ ^ƉĞĐŝĮĐ WůĂŶ ĂƌĞĂ ĐŽŶƚĂŝŶƐ ŵĂŶLJĞdžŝƐƟŶŐďƵŝůĚŝŶŐƐƚŚĂƚĂƌĞĞŝƚŚĞƌŽďƐŽůĞƚĞŽƌ ƵŶĚĞƌƵƟůŝnjĞĚ͘/ŶĂĚĚŝƟŽŶ͕ƚŚĞƌĞĂƌĞƐĞǀĞƌĂůǀĂĐĂŶƚ ƉĂƌĐĞůƐŽĨůĂŶĚ͕ƌĂŶŐŝŶŐĨƌŽŵ͘ϱĂĐƌĞƐƚŽϮϱĂĐƌĞƐŝŶ ƐŝnjĞ͘dŽŐĞƚŚĞƌ͕ƚŚĞƐĞƉĂƌĐĞůƐƌĞƉƌĞƐĞŶƚƐŝŐŶŝĮĐĂŶƚŝŶĮůů ĚĞǀĞůŽƉŵĞŶƚŽƉƉŽƌƚƵŶŝƟĞƐ͘dŚĞŝŶƚĞŶƚŽĨƚŚĞ^ƉĞĐŝĮĐ WůĂŶŝƐƚŽƌĞĂůŝŐŶĨƵƚƵƌĞůĂŶĚƵƐĞĂŶĚnjŽŶŝŶŐĨŽƌƚŚĞ ĂƌĞĂďĂƐĞĚŽŶĞdžŝƐƟŶŐĂŶĚĨƵƚƵƌĞŵĂƌŬĞƚĚĞŵĂŶĚ͕ ĂŶĚƚŽĂůůŽǁĨŽƌŝŶƚĞŶƐŝĮĐĂƟŽŶŽĨƌĞƐŝĚĞŶƟĂůĂŶĚŶŽŶͲ ƌĞƐŝĚĞŶƟĂůƵƐĞƐŝŶƉƌŽdžŝŵŝƚLJƚŽƚƌĂŶƐŝƚ͘dŚĞ^ƉĞĐŝĮĐ WůĂŶĂůƐŽŚĂƐĂŶŽƉƉŽƌƚƵŶŝƚLJƚŽĚƌĂǁĨƌŽŵĂŶĚƚĂŝůŽƌ ƚŚĞŵŝdžĞĚͲƵƐĞnjŽŶĞƐƚŚĂƚĂƌĞĂƉƉůŝĞĚĞůƐĞǁŚĞƌĞŝŶƚŚĞ ŝƚLJ͕ƚŽĞŶĐŽƵƌĂŐĞĂďƌŽĂĚĞƌƌĂŶŐĞŽĨŚŽƵƐŝŶŐƚLJƉĞƐ ƚŽŵĞĞƚĚĞŵĂŶĚƐŝŶƚŚĞĂƌĞĂĂŶĚƐƵƉƉŽƌƚĂĚĚŝƟŽŶĂů ĐŽŵŵƵŶŝƚLJͲƐĞƌǀŝŶŐ ĐŽŵŵĞƌĐŝĂů ĂŶĚ ƌĞƚĂŝů ƵƐĞƐ͘ KǀĞƌĂůů͕ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ ƉƌŽǀŝĚĞƐ ĂŶ ŽƉƉŽƌƚƵŶŝƚLJ ƚŽŝŵƉůĞŵĞŶƚŵĂŶLJdƌĂŶƐŝƚWƌŝŽƌŝƚLJWƌŽũĞĐƚƐƵƉĂŶĚ ĚŽǁŶĞĂĐŚŽƵůĞǀĂƌĚ͘ ZĞŶĞǁĂďůĞWŽƌƞŽůŝŽ^ƚĂŶĚĂƌĚ͞/ŶƐƚĂůůĂƟŽŶƐ͟ dŚĞƌĞŝƐĂŶŽƉƉŽƌƚƵŶŝƚLJƚŽŝŶĐƌĞĂƐĞƚŚĞƉĞƌĐĞŶƚĂŐĞŽĨ ƌĞŶĞǁĂďůĞƐŝŶƚŚĞŶĂŚĞŝŵ͛ƐƉŽǁĞƌƐƵƉƉůLJŵŝdžǁŝƚŚ ĂĚĚŝƟŽŶĂůŝƚLJͲŽǁŶĞĚƐŽůĂƌƉŚŽƚŽǀŽůƚĂŝĐŝŶƐƚĂůůĂƟŽŶƐ ŝŶ ƚŚĞ ^W ĂƌĞĂ͘ /ŶŝƟĂů ŵĞĞƟŶŐƐ ǁŝƚŚ ƚŚĞ Wh ŝĚĞŶƟĮĞĚƚŚĞĨŽůůŽǁŝŶŐƉŽƐƐŝďůĞĐĂƉŝƚĂůZĞŶĞǁĂďůĞ WŽƌƞŽůŝŽ^ƚĂŶĚĂƌĚƐ;ZW^ͿŝŵƉƌŽǀĞŵĞŶƚƐǁŚŝĐŚĐŽƵůĚ ďĞŝŵƉůĞŵĞŶƚĞĚďLJƚŚĞƉƌŝǀĂƚĞƐĞĐƚŽƌĂƐƉĂƌƚŽĨŶĞǁ ĚĞǀĞůŽƉŵĞŶƚƉƌŽƉŽƐĂůƐ͕ŽƌďLJWhĨŽƌƉƵďůŝĐůLJŽǁŶĞĚ ůĂŶĚƐ͘ tĞƐƚŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌ͘dŚĞŝƚLJͲŽǁŶĞĚtĞƐƚ ŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌŽŶĞĂĐŚŽƵůĞǀĂƌĚƉƌŽǀŝĚĞƐ ĂŶ ŽƉƉŽƌƚƵŶŝƚLJ ĨŽƌ ŝƚLJͲŽǁŶĞĚ ƐŽůĂƌ ƉŚŽƚŽǀŽůƚĂŝĐ ƐLJƐƚĞŵƐŽŶƚŚĞƌŽŽŌŽƉĂŶĚƉĂƌŬŝŶŐƐŚĂĚĞƐƚƌƵĐƚƵƌĞƐ͘ Twila Reid and Schweitzer Parks.^ŽůĂƌƐŚĂĚĞ ƐƚƌƵĐƚƵƌĞƐ ĂŶĚͬ Žƌ ƐŽůĂƌ ƚƌĞĞƐ ĐŽƵůĚ ďĞ ĂĚĚĞĚ ƚŽ dǁŝůĂZĞŝĚWĂƌŬĂŶĚͬŽƌ^ĐŚǁĞŝƚnjĞƌWĂƌŬ;ŝŶƚŚĞƉĂƌŬƐ ĂŶĚƉĂƌŬŝŶŐůŽƚͿ͘dŚĞƐĞĐŽƵůĚƉƌŽǀŝĚĞĞůĞĐƚƌŝĐŝƚLJĨŽƌ ĂĚĚŝƟŽŶĂůĂĚĂƉƟǀĞůŝŐŚƟŶŐƚŽŝŶĐƌĞĂƐĞƐĂĨĞƚLJĂƚƚŚĞ ƉĂƌŬƐ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ89 4 DĞĚŝĐĂů KĸĐĞ ƵŝůĚŝŶŐ WĂƌŬŝŶŐ ^ƚƌƵĐƚƵƌĞ͘ The ƉĂƌŬŝŶŐ ƐƚƌƵĐƚƵƌĞ Ăƚ ƚŚĞ ĐŽƌŶĞƌ ŽĨ KƌĂŶŐĞ ǀĞŶƵĞ ĂŶĚĞĂĐŚŽƵůĞǀĂƌĚƉƌŽǀŝĚĞƐĂƌĞƚƌŽĮƚŽƉƉŽƌƚƵŶŝƚLJ ƚŽ ĂĚĚ ƐŽůĂƌ ƉĂŶĞůƐ Žƌ ŽƚŚĞƌ ƌĞŶĞǁĂďůĞ ĞŶĞƌŐLJ ƚĞĐŚŶŽůŽŐLJŽŶƚŚĞƌŽŽĨŽĨƚŚĞƐƚƌƵĐƚƵƌĞ͘ tĞƐƚŐĂƚĞ͘dŚĞtĞƐƚŐĂƚĞƐŝƚĞĐŽƵůĚĂůƐŽŝŶĐŽƌƉŽƌĂƚĞ ;ZW^ͿŝŶƐƚĂůůĂƟŽŶƐŝŶƚŽƐŝƚĞŽƌďƵŝůĚŝŶŐĚĞƐŝŐŶ͕ƐƵĐŚĂƐ ƉŚŽƚŽǀŽůƚĂŝĐƉĂŶĞůƐ͕ƐŽůĂƌƉŽǁĞƌĞĚůŝŐŚƟŶŐ͕ĞƚĐ͘ ĚǀĂŶĐĞĚŶĞƌŐLJĸĐŝĞŶĐLJ Integrated Demand Side Management. dŚĞ ^ƚĂƚĞ ŽĨĂůŝĨŽƌŶŝĂ͛Ɛ>ŽŶŐͲdĞƌŵŶĞƌŐLJĸĐŝĞŶĐLJ^ƚƌĂƚĞŐŝĐ WůĂŶ;ƚŚĞWůĂŶͿǁĂƐĐŽŵŵŝƐƐŝŽŶĞĚďLJƚŚĞĂůŝĨŽƌŶŝĂ WƵďůŝĐhƟůŝƟĞƐŽŵŵŝƐƐŝŽŶ;WhͿŝŶϮϬϬϳ͕ĂĚŽƉƚĞĚ ďLJƚŚĞWhŝŶϮϬϬϴ͕ĂŶĚĂŵĞŶĚĞĚŝŶϮϬϭϬ͘dŚĞWůĂŶ ůĂLJƐŽƵƚĂƉĂƚŚƚŽŵĞĞƚƚŚĞ^ƚĂƚĞ͛ƐĞŶĞƌŐLJĞĸĐŝĞŶĐLJ ĂŶĚ ŐƌĞĞŶŚŽƵƐĞ ŐĂƐ ƌĞĚƵĐƟŽŶ ŐŽĂůƐ ƚŚƌŽƵŐŚ ƚŚĞ LJĞĂƌϮϬϮϬďLJĞƐƚĂďůŝƐŚŝŶŐĂǀŝƐŝŽŶ͕ƐĞƫŶŐŐŽĂůƐ͕ĂŶĚ ŽƵƚůŝŶŝŶŐ ĂŶ ŝŵƉůĞŵĞŶƚĂƟŽŶ ƉůĂŶ ƚŽ ĂĐŚŝĞǀĞ ĞĂĐŚ ŐŽĂůǁŝƚŚŝŶƚǁĞůǀĞĚŝīĞƌĞŶƚĐĂƚĞŐŽƌŝĞƐ͘KŶĞŽĨƚŚĞ ĐĂƚĞŐŽƌŝĞƐƚŚĂƚƚŚĞWůĂŶƌĞĐŽŐŶŝnjĞƐŝƐƚŚĞŝŶƚĞŐƌĂƟŽŶ ŽĨ ĚĞŵĂŶĚͲƐŝĚĞ ŵĂŶĂŐĞŵĞŶƚ ;^DͿ ŽƉƟŽŶƐ͕ ƐƵĐŚ ĂƐ ŝŵƉƌŽǀŝŶŐ ƚŚĞ ĞŶĞƌŐLJ ĞĸĐŝĞŶĐLJ ŽĨ ĞŶĚ ƵƐĞƌƐ ŚŽŵĞƐ͕ďƵƐŝŶĞƐƐĞƐ͕ĂŶĚǀĞŚŝĐůĞƐ͕ĚĞŵĂŶĚƌĞƐƉŽŶƐĞ ƉƌŽŐƌĂŵƐƚŚĂƚĞŶĐŽƵƌĂŐĞĞŶĚͲƵƐĞƌƐƚŽŵĂŬĞƐŚŽƌƚͲ ƚĞƌŵƌĞĚƵĐƟŽŶƐŝŶĞŶĞƌŐLJƵƐĞĚƵƌŝŶŐƐƉĞĐŝĮĐŚŽƵƌƐ͕ ĂŶĚ ĚŝƐƚƌŝďƵƚĞĚ ŐĞŶĞƌĂƟŽŶ ƚĞĐŚŶŽůŽŐŝĞƐ ŝŶĐůƵĚŝŶŐ ƐŽůĂƌƉĂŶĞůƐ͕ĨƵĞůĐĞůůƐ͕ĂŶĚŽƚŚĞƌĞŶĞƌŐLJͲŐĞŶĞƌĂƟŶŐ ŽƉƟŽŶƐƚŚĂƚĨĞĞĚĞŶĞƌŐLJŝŶƚŽƚŚĞƵƟůŝƚLJŐƌŝĚĂŶĚŚĞůƉ ƌĞůŝĞǀĞƚŚĞƵƟůŝƚLJ͛ƐĐĂƉĂĐŝƚLJĐŽŶƐƚƌĂŝŶƚƐĂƐǁĞůůĂƐŝƚƐ ĞŶĞƌŐLJŐĞŶĞƌĂƟŽŶƌĞƋƵŝƌĞŵĞŶƚƐ͘ dŚĞ ŝƚLJ ŽĨ ŶĂŚĞŝŵ ŚĂƐ ĂůƌĞĂĚLJ ĞƐƚĂďůŝƐŚĞĚ Ă ŶƵŵďĞƌŽĨƉƌĂĐƟĐĞƐƚLJƉŝĐĂůůLJŽƵƚůŝŶĞĚŝŶĂĚĞŵĂŶĚ ƐŝĚĞŵĂŶĂŐĞŵĞŶƚƉƌŽŐƌĂŵŝŶĐůƵĚŝŶŐ͕ϭͿƉƌŽŵŽƟŶŐ ĞŶĞƌŐLJ ĞĸĐŝĞŶƚ ĚĞǀĞůŽƉŵĞŶƚ ǀŝĂ ŐƌĞĞŶ ďƵŝůĚŝŶŐ ĂŶĚƉƵďůŝĐƵƟůŝƚLJŝŶĐĞŶƟǀĞƐ͕ϮͿĞĚƵĐĂƟŶŐƚŚĞƉƵďůŝĐ ĂďŽƵƚ ƐƵƐƚĂŝŶĂďůĞ ŝƐƐƵĞƐ ƚŚƌŽƵŐŚ ĞŶĞƌŐLJ ĂƵĚŝƚƐ͕ ƉƵďůŝĐ ƐĞƌǀŝĐĞ ĂŶŶŽƵŶĐĞŵĞŶƚƐ͕ ƵƟůŝƚLJ ďŝůů ŝŶƐĞƌƚƐ͕ ƚƌĂŝŶŝŶŐ ƉƌŽŐƌĂŵƐ͕ ĂŶĚ ŽƚŚĞƌ ŽƵƚƌĞĂĐŚ ƉƌŽŐƌĂŵƐ͕ ĂŶĚϯͿĞƐƚĂďůŝƐŚŝŶŐĂǀĂƌŝĞƚLJŽĨĚŝƐƚƌŝďƵƚĞĚŐĞŶĞƌĂƟŽŶ ƉƌŽŐƌĂŵƐ͕ ĚĞƐĐƌŝďĞĚ ŝŶ ĚĞƚĂŝů ŝŶ ƚŚĞ ZĞŶĞǁĂďůĞ ŶĞƌŐLJƐĞĐƟŽŶůĂƚĞƌŝŶƚŚŝƐĚŽĐƵŵĞŶƚ͘ dŚĞƌĞ ƌĞŵĂŝŶƐ ĂŶ ŽƉƉŽƌƚƵŶŝƚLJ ƚŽ ĞŶŚĂŶĐĞ ĂŶĚ ƐƵƉƉůĞŵĞŶƚƚŚĞƐĞŝŶŝƟĂƟǀĞƐďLJĐŽŶƐŽůŝĚĂƟŶŐĞdžŝƐƟŶŐ ƉƌŽŐƌĂŵƐ ƵŶĚĞƌ ƚŚĞ ƵŵďƌĞůůĂ ŽĨ ĂŶ ŝŶƚĞŐƌĂƚĞĚ ĚĞŵĂŶĚͲƐŝĚĞŵĂŶĂŐĞŵĞŶƚƉƌŽŐƌĂŵĨŽƌƚŚĞ^WƚŚĂƚ ĐŽƵůĚďĞĞdžƉĂŶĚĞĚĂŶĚƌĞĮŶĞĚƚŽŝŶĐůƵĚĞĂĚĞŵĂŶĚ ƌĞƐƉŽŶƐĞƉƌŽŐƌĂŵ͕ĂŶĚƚĂƌŐĞƚĞĚŐƵŝĚĞůŝŶĞƐĨŽƌŚŽǁ ĞdžŝƐƟŶŐĐŝƚLJͲǁŝĚĞĞīŽƌƚƐǁŝůůĂƉƉůLJƚŽƚŚĞ^WĂƌĞĂ͘ ^h^d/E/>/dz dŚĞ ^ƚƌĂƚĞŐŝĐ 'ƌŽǁƚŚ ŽƵŶĐŝů ĚĞĮŶĞƐ Ă sustainable community as one that promotes equity, health, and safety, and strengthens the ĞĐŽŶŽŵLJǁŚŝůĞƉƌŽƚĞĐƟŶŐƚŚĞĞŶǀŝƌŽŶŵĞŶƚ͘ dŚĞĞdžŝƐƟŶŐŵĞĚŝĐĂůŽĸĐĞďƵŝůĚŝŶŐĂŶĚƉĂƌŬŝŶŐŐĂƌĂŐĞĂƚƚŚĞĐŽƌŶĞƌ ŽĨĞĂĐŚŽƵůĞǀĂƌĚĂŶĚKƌĂŶŐĞǀĞŶƵĞĂƌĞŽƉƉŽƌƚƵŶŝƟĞƐĨŽƌĞŶĞƌŐLJ ĞĸĐŝĞŶƚƌĞƚƌŽĮƚƵƉŐƌĂĚĞƐƐƵĐŚĂƐƐŽůĂƌƉĂŶĞůƐŽƌŽƚŚĞƌƌĞŶĞǁĂďůĞĞŶĞƌŐLJ ƚĞĐŚŶŽůŽŐLJ͘ 90 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ ĚǀĂŶĐĞĚ>ŝŐŚƟŶŐ^ƚƌĂƚĞŐŝĞƐ ĐĐŽƌĚŝŶŐ ƚŽ ƚŚĞ ĂůŝĨŽƌŶŝĂ ŶĞƌŐLJ ŽŵŵŝƐƐŝŽŶ͕ ůŝŐŚƟŶŐ ĂĐĐŽƵŶƚƐ ĨŽƌ ĂƉƉƌŽdžŝŵĂƚĞůLJ ϯϱ ƉĞƌĐĞŶƚ ŽĨ ĞůĞĐƚƌŝĐŝƚLJ ƵƐĞ ŝŶ ĐŽŵŵĞƌĐŝĂů ďƵŝůĚŝŶŐƐ ĂŶĚ ϮϮ ƉĞƌĐĞŶƚŝŶƌĞƐŝĚĞŶƟĂůƵŶŝƚƐ͕ŵĂŬŝŶŐůŝŐŚƟŶŐĂƐŝnjĞĂďůĞ ĐŽŶƚƌŝďƵƚŽƌ ƚŽ ŐƌĞĞŶŚŽƵƐĞ ŐĂƐĞƐ͘ ^ŽŵĞ ŽĨ ƚŚĞ ĂĚǀĂŶĐĞŵĞŶƚƐŝŶůŝŐŚƟŶŐƚĞĐŚŶŽůŽŐLJĂŶĚĞĸĐŝĞŶĐLJ ŚĂǀĞ ďĞĞŶ ŝŶĐŽƌƉŽƌĂƚĞĚ ŝŶƚŽ ƚŚĞ ƵŝůĚŝŶŐ ŽĚĞ͘ KƚŚĞƌ ŵŽƌĞ ŝŶŶŽǀĂƟǀĞ͕ ŚŝŐŚͲĞĸĐĂĐLJ͕ ŚŝŐŚ ĐŽůŽƌ ƋƵĂůŝƚLJůŝŐŚƟŶŐƚĞĐŚŶŽůŽŐŝĞƐĂŶĚƉƌŽĚƵĐƚƐĂƌĞƋƵŝĐŬůLJ ĞǀŽůǀŝŶŐ͕ďĞĐŽŵŝŶŐŵŽƌĞƌĞĂĚŝůLJĂǀĂŝůĂďůĞĂŶĚĐŽƐƚͲ ĞīĞĐƟǀĞ͘ ^ŽŵĞ ŽƉƉŽƌƚƵŶŝƟĞƐ ƚŽ ƌĞĚƵĐĞ ĞůĞĐƚƌŝĐŝƚLJ ƵƐĞĚĨŽƌůŝŐŚƟŶŐŝŶĐůƵĚĞ͗ Twila Reid Park. dŚĞŝƚLJŚĂƐŝĚĞŶƟĮĞĚdǁŝůĂZĞŝĚ WĂƌŬĂƐĂŶĂƌĞĂŽĨĨŽĐƵƐĨŽƌŝŵƉƌŽǀĞŵĞŶƚŝŶƚŚĞ^W ĂƌĞĂ͘ EƵŵĞƌŽƵƐ ŽƉƉŽƌƚƵŶŝƟĞƐ ĨŽƌ ƵƐŝŶŐ ĂĚǀĂŶĐĞĚ ůŝŐŚƟŶŐƐƚƌĂƚĞŐŝĞƐĂŶĚƐŽůƵƟŽŶƐĂƚƚŚŝƐƉĂƌŬĂƌĞďĞŝŶŐ ĐŽŶƐŝĚĞƌĞĚ͘ KƚŚĞƌ ĚǀĂŶĐĞĚ >ŝŐŚƟŶŐ ƉƉůŝĐĂƟŽŶƐ͘/ŶƚĞƌŝŽƌ ďƵŝůĚŝŶŐ ůŝŐŚƟŶŐĂƉƉůŝĐĂƟŽŶƐĐŽƵůĚ LJŝĞůĚ ƐŝŐŶŝĮĐĂŶƚ ĞŶĞƌŐLJƐĂǀŝŶŐƐŝŶĐŽƌƌŝĚŽƌƐ͕ƐƚĂŝƌǁĞůůƐ͕ƐĐŚŽŽůƐ͕ĂŶĚ ŚŽƐƉŝƚĂůŝƚLJďƵŝůĚŝŶŐƐ͘ŶĞƌŐLJƐĂǀŝŶŐƐĐŽƵůĚďĞƌĞĂůŝnjĞĚ ĨƌŽŵ>ƐƚƌĞĞƚůŝŐŚƟŶŐ͕ƉĂƌŬŝŶŐůŽƚůŝŐŚƟŶŐ͕ƉĂƌŬŝŶŐ ƐƚƌƵĐƚƵƌĞůŝŐŚƟŶŐ͕ƐŝŐŶĂŐĞ͕ǁĂůůƉĂĐŬƐ͕ĂŶĚƉĂƚŚǁĂLJ ůŝŐŚƟŶŐ͘ EĞǁ Žƌ ƌĞƚƌŽĮƚ ůŝŐŚƟŶŐ Ăƚ ƚŚĞ ŚŽƐƉŝƚĂů͕ zŽƵƚŚ ĞŶƚĞƌ͕ ŵŽƚĞůƐ͕ ĂŶĚ ŽƚŚĞƌ ^W ůĂŶĚ ƵƐĞƐ͕ ĐŽƵůĚƉƌŽǀŝĚĞƐŝŐŶŝĮĐĂŶƚĞŶĞƌŐLJƐĂǀŝŶŐ͕ŐƌĞĞŶŚŽƵƐĞ ŐĂƐ ƌĞĚƵĐƟŽŶ͕ ĂŶĚ ĞŶŚĂŶĐĞĚ ŚĞĂůƚŚ ĂŶĚ ƐĂĨĞƚLJ ŽƉƉŽƌƚƵŶŝƟĞƐ͘/ƚŝƐƌĞĐŽŵŵĞŶĚĞĚƚŚĂƚƚŚĞƐƉĞĐŝĮĐ ƉůĂŶŝŶĐůƵĚĞŝŶĐĞŶƟǀĞƐĨŽƌƚŚĞƐĞĂƉƉůŝĐĂƟŽŶƐ͘ >ŝŐŚƟŶŐ'ƵŝĚĞůŝŶĞƐĨŽƌEŽŵŵƵŶŝƟĞƐ͘/ŶĐĞŶƟǀĞƐ ĂŶĚŐƵŝĚĞůŝŶĞƐĐŽƵůĚďĞĞƐƚĂďůŝƐŚĞĚĨŽƌƚŚĞ^WĂƌĞĂ ƚŽ ƉƌŽŵŽƚĞ ůŝŐŚƟŶŐ ƚŚĂƚ ŚĞůƉƐ ĚĞǀĞůŽƉŵĞŶƚ ŵĞĞƚ njĞƌŽŶĞƚĞŶĞƌŐLJ;EͿƐƚĂŶĚĂƌĚƐ͘ dŚĞŝƚLJŝƐĐŽŶƐŝĚĞƌŝŶŐĂĚǀĂŶĐĞĚůŝŐŚƟŶŐƐƚƌĂƚĞŐŝĞƐƚŽŝŶĐƌĞĂƐĞƐĂĨĞƚLJ ĂŶĚƵƐĂďŝůŝƚLJŽĨdǁŝůĂZĞŝĚWĂƌŬ͘ ZKEdEZ'zΈEΉ ĞƌŽŶĞƚĞŶĞƌŐLJďƵŝůĚŝŶŐƐĂƌĞƵůƚƌĂͲĞĸĐŝĞŶƚŶĞǁ ĐŽŶƐƚƌƵĐƟŽŶĂŶĚĚĞĞƉĞŶĞƌŐLJƌĞƚƌŽĮƚƉƌŽũĞĐƚƐ that consume only as much energy as they ƉƌŽĚƵĐĞĨƌŽŵĐůĞĂŶ͕ƌĞŶĞǁĂďůĞƌĞƐŽƵƌĐĞƐ͘ ^ŽƵƌĐĞ͗EĞǁƵŝůĚŝŶŐƐ/ŶƐƟƚƵƚĞ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ91 4 Renewable Energy ^ŽůĂƌ/ŶĐĞŶƟǀĞƐ͘dŚĞƌĞĂƌĞŽƉƉŽƌƚƵŶŝƟĞƐƚŽƉƌŽǀŝĚĞ ŝŶĐĞŶƟǀĞƐĐŽƵƉůĞĚǁŝƚŚĂĚǀĂŶĐĞĚĞŶĞƌŐLJĞĸĐŝĞŶĐLJ ;ƐƵĐŚĂƐǀŽůƵŶƚĂƌLJƌĞƐŝĚĞŶƟĂůEϮϬϭϲdŝƚůĞϮϰͿ͘ ,ŽǁĞǀĞƌ͕ŶĂŚĞŝŵŚĂƐŵĞƚŝƚƐ^ϭƚĂƌŐĞƚƐĂŶĚĂƐ ŽĨ KĐƚŽďĞƌ ϮϬϭϱ͕ ĂŶĚ ŝƐ ŶŽ ůŽŶŐĞƌ ŽīĞƌŝŶŐ ƐŽůĂƌ ŝŶĐĞŶƟǀĞƐ ƚŽ ŶĂŚĞŝŵ ƌĞƐŝĚĞŶĐĞƐ Žƌ ďƵƐŝŶĞƐƐĞƐ͘ &ƵƌƚŚĞƌŵŽƌĞ͕ǁŚŝůĞƐŽůĂƌĞŶĞƌŐLJŝƐĂŐŽŽĚŝĚĞĂ͕ƚŚĞ ĐŽƐƚŝŵƉĂĐƚƐĂƌĞŐƌĞĂƚĞƌƚŚĂŶǁŚĂƚĐƵƐƚŽŵĞƌƐƉĂLJĨŽƌ ĞŶĞƌŐLJŝŶƚŚĞŝƚLJŽĨŶĂŚĞŝŵ͘ dƌĂŶƐƉŽƌƚĂƟŽŶ CALSTART Partnership.>^dZdŝƐĂŶŽŶƉƌŽĮƚ ƐƚƌĂƚĞŐŝĐ ďƌŽŬĞƌ ĨŽƌ ĐůĞĂŶ ƚƌĂŶƐƉŽƌƚĂƟŽŶ͘ dŚĞ ŝƚLJ ŵŝŐŚƚĐŽŶƐŝĚĞƌďĞĐŽŵŝŶŐĂŵĞŵďĞƌŽĨ>^dZdƚŽ ĂĐĐĞƐƐƚŚĞůĂƚĞƐƚĐůĞĂŶĨƵĞůƚƌĂŶƐƉŽƌƚĂƟŽŶƐŽůƵƟŽŶƐ ĂƐ ǁĞůů ĂƐ ĨƵŶĚŝŶŐ ŽƉƉŽƌƚƵŶŝƟĞƐ ƐƵĐŚ ĂƐ ĞůĞĐƚƌŝĐ ǀĞŚŝĐůĞ ĐŚĂƌŐŝŶŐ ƐƚĂƟŽŶ ƉƌŽŐƌĂŵƐ͘ dŚĞ ^W ĂƌĞĂ ŝƐƐĞƌǀĞĚďLJƚǁŽƚƌĂŶƐŝƚĂŐĞŶĐŝĞƐ͕ŶĂŚĞŝŵZĞƐŽƌƚ dƌĂŶƐƉŽƌƚĂƟŽŶ;ZdͿĂŶĚƚŚĞKƌĂŶŐĞŽƵŶƚLJdƌĂŶƐŝƚ ƵƚŚŽƌŝƚLJ;KdͿ͘KĨƚŚŽƐĞ͕ZdŝƐĂĐƵƌƌĞŶƚŵĞŵďĞƌ ŽĨ>^dZd ůĞĐƚƌŝĐ sĞŚŝĐůĞ ŚĂƌŐŝŶŐ ^ƚĂƟŽŶƐ ;s^Ϳ͘Wh ŚĂƐŝŶĐĞŶƟǀĞƐƚŽŝŶƐƚĂůůs^͕ǁŚŝĐŚǁŽƵůĚŚĞůƉƚŽ ĞŶŚĂŶĐĞĂĐĐĞƐƐƚŽĞůĞĐƚƌŝĐǀĞŚŝĐůĞƐŝŶƚŚĞ^WĂƌĞĂ͘ dŚĞƐĞŝŶĐĞŶƟǀĞƐƐŚŽƵůĚďĞƉƌŽŵŽƚĞĚŝŶƚŚĞ^ƉĞĐŝĮĐ WůĂŶ͕ĂŶĚƐƚĂŶĚĂƌĚƐĂŶĚŝŶĐĞŶƟǀĞƐĐŽƵůĚďĞŐŝǀĞŶĨŽƌ ĚĞǀĞůŽƉĞƌƐƚŽŝŶĐůƵĚĞs^ŝŶƚŚĞŝƌƉƌŽũĞĐƚƐ͘ ,LJĚƌŽŐĞŶ&ƵĞůŝŶŐ^ƚĂƟŽŶ͘džƉůŽƌĞŚĂǀŝŶŐŚLJĚƌŽŐĞŶ ĨƵĞůŝŶŐĂƚŽŶĞŽĨƚŚĞŐĂƐƐƚĂƟŽŶƐŝŶƚŚĞ^WƚŽŚĞůƉ ĞdžƉĂŶĚƚŚĞ͞ŚLJĚƌŽŐĞŶŚŝŐŚǁĂLJ͘͟ƐŝŵŝůĂƌƐƚĂƟŽŶŝƐ ůŽĐĂƚĞĚĂƚƚŚĞŝŶƚĞƌƐĞĐƟŽŶŽĨĂƐƚ>ĂWĂůŵĂǀĞŶƵĞ ĂŶĚEŽƌƚŚdƵƐƟŶǀĞŶƵĞŝŶŶĂŚĞŝŵ͘ ŽŵƉƌĞƐƐĞĚ EĂƚƵƌĂů 'ĂƐ ;E'Ϳ &ƵĞůŝŶŐ ^ƚĂƟŽŶƐ͘ /ŶƐƚĂůůŝŶŐ ĂŶĚ ŝŶĐĞŶƟǀŝnjŝŶŐ E' ĨƵĞůŝŶŐ ƐƚĂƟŽŶƐ ĐŽƵůĚ ŚĞůƉ ƚŽ ĂĚǀĂŶĐĞ ĂůƚĞƌŶĂƟǀĞ ĐůĞĂŶ ŵŽĚĞƐ ŽĨ ƚƌĂŶƐƉŽƌƚĂƟŽŶ ĂŶĚ ƌĞĚƵĐĞĚ ',' ĞŵŝƐƐŝŽŶƐͶĂŶ ĞdžĂŵƉůĞŝƐƚŚĞŽŶĞŽŶůdŽƌŽZŽĂĚĂŶĚƚŚĞϱĨƌĞĞǁĂLJ͘ tĂƚĞƌĸĐŝĞŶĐLJ dŚĞƌĞŝƐĂŶŽƉƉŽƌƚƵŶŝƚLJƚŽƵƉŐƌĂĚĞǁĂƚĞƌŵĞƚĞƌƐŝŶ ƚŚĞĂƌĞĂƚŽǁĞĂƚŚĞƌďĂƐĞĚŽƌƐŽŝůƐƐĞŶƐŝŶŐ͘dŚĞƌĞĂƌĞ ƐƵďƐƚĂŶƟĂůǁĂƚĞƌĐŽŶƐĞƌǀĂƟŽŶ͕ĞŶĞƌŐLJƐĂǀŝŶŐƐ͕ĂŶĚ ŐƌĞĞŶŚŽƵƐĞŐĂƐƌĞĚƵĐƟŽŶŽƉƉŽƌƚƵŶŝƟĞƐĂƐƐŽĐŝĂƚĞĚ ǁŝƚŚŝŶƐƚĂůůŝŶŐǁĞĂƚŚĞƌͲďĂƐĞĚŝƌƌŝŐĂƟŽŶĐŽŶƚƌŽůůĞƌƐ͘ WhĐŽƵůĚŽīĞƌŝŶĐĞŶƟǀĞƐĨŽƌƚŚĞƐĞĐŽŶƚƌŽůƐ͘ dŚĞ ŝƚLJ ĐŽƵůĚ ĂůƐŽ ĞdžƉůŽƌĞ Ă ƉŝůŽƚ ƉƌŽũĞĐƚ ƐŝŵŝůĂƌ ƚŽ ƚŚĞ DĞƚƌŽƉŽůŝƚĂŶ tĂƚĞƌ ŝƐƚƌŝĐƚ ;DtͿ ĨƵŶĚĞĚ ƉƌŽŐƌĂŵǁŝƚŚƚŚĞhĂǀŝƐŶĞƌŐLJĸĐŝĞŶĐLJĞŶƚĞƌͬ tĂƚĞƌ ŶĞƌŐLJ ĸĐŝĞŶĐLJ ĞŶƚĞƌ͘ dŚŝƐ ƉƌŽŐƌĂŵ ŝŵƉůĞŵĞŶƚƐ ǁĞĂƚŚĞƌͲďĂƐĞĚ ŵĞƚĞƌ ƌĞƚƌŽĮƚƐ ŝŶ ƚĞƐƚ ĂƌĞĂƐŝŶĞdžĐŚĂŶŐĞĨŽƌƌĞĐĞŝǀŝŶŐĚĂƚĂƚŚĂƚŵĞĂƐƵƌĞƐ ƚŚĞ ĞīĞĐƟǀĞŶĞƐƐ ŽĨ ƚŚĞ ƌĞƚƌŽĮƚ ƵƉŐƌĂĚĞƐ͘  ŐŽŽĚ ůŽĐĂƟŽŶĨŽƌĂƚĞƐƚĐŽƵůĚďĞŽŶĞŽĨƚŚĞƉĂƌŬƐŝŶƚŚĞ ĂƌĞĂ͘ ͞>ĂďŽƌĂƚŽƌLJƚŽDĂƌŬĞƚ͟WŝůŽƚƐĂŶĚĞŵŽŶƐƚƌĂƟŽŶƐ dŚĞ^WĂƌĞĂŝƐĂƉƌŝŵĞůŽĐĂƟŽŶĨŽƌƚĞƐƟŶŐ ůĂďŽƌĂƚŽƌLJͲƚŽͲŵĂƌŬĞƚ ƚĞĐŚŶŽůŽŐLJ͘ dŚĞ ^ƉĞĐŝĮĐ WůĂŶ ĐĂŶ ŝŶĐůƵĚĞ ĂĚĚŝƟŽŶĂů ŝŶĨŽƌŵĂƟŽŶ ƐƵƉƉŽƌƟŶŐ ƉŽƐƐŝďůĞƉĂƌƚŶĞƌƐŚŝƉƐƚŽƚĞƐƚƚŚĞĨŽůůŽǁŝŶŐƉƌŽŐƌĂŵƐ ƌĞůĂƚĞĚƚŽĞŶĞƌŐLJĂŶĚ','ĐŽŶƐĞƌǀĂƟŽŶ͗ • ĞƌŽŶĞƚĞŶĞƌŐLJŵƵůƟͲĨĂŵŝůLJ͞ƉŝůŽƚ͟ • ZĞŶĞǁĂďůĞƉŽƌƞŽůŝŽƐƚĂŶĚĂƌĚĨŽƌĞĂĐŚ ŽƵůĞǀĂƌĚ͞ƉŝůŽƚ͟ 92 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ 4.6 MOBILITY dŚĞŵŽďŝůŝƚLJƉůĂŶĨŽƌƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐ WůĂŶŝƐĞƐƚĂďůŝƐŚĞĚďLJƚŚĞŝƚLJΖƐŝƌĐƵůĂƟŽŶůĞŵĞŶƚ ŽĨƚŚĞ'ĞŶĞƌĂůWůĂŶĂŶĚŝĐLJĐůĞDĂƐƚĞƌWůĂŶ͘dŚĞƐĞ ƚǁŽ ĚŽĐƵŵĞŶƚƐ ƐĞƚ ƐƚĂŶĚĂƌĚƐ ĂŶĚ ƉŽůŝĐLJ ĚŝƌĞĐƟŽŶ ƌĞůĂƚĞĚƚŽŵŽďŝůŝƚLJƚŚƌŽƵŐŚŽƵƚƚŚĞŝƚLJŽĨŶĂŚĞŝŵ͘ WůĂŶƐ ĨŽƌ Ăůů ŵŽĚĞƐ ŽĨ ƚƌĂŶƐƉŽƌƚĂƟŽŶ ǁŝƚŚŝŶ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ ĂƌĞĂ ĂƌĞ ŐƵŝĚĞĚ ďLJ ƚŚŽƐĞ ĚŽĐƵŵĞŶƚƐ ĂŶĚ ĚŝƐĐƵƐƐĞĚ ĨƵƌƚŚĞƌ ŝŶ ƚŚĞ ƐĞĐƟŽŶƐ ďĞůŽǁ͘ ^ƉĞĐŝĮĐŝŵƉůĞŵĞŶƚĂƟŽŶĂĐƟŽŶƐƌĞůĂƚĞĚƚŽŵŽďŝůŝƚLJ ŝŵƉƌŽǀĞŵĞŶƚƐĨŽƌƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶ ĂƌĞĂĂƌĞƉƌŽǀŝĚĞĚŝŶŚĂƉƚĞƌϱ͕ĚŵŝŶŝƐƚƌĂƟŽŶĂŶĚ /ŵƉůĞŵĞŶƚĂƟŽŶ͘ƐŵĞŶƟŽŶĞĚŝŶ^ĞĐƟŽŶϰ͘ϯ͘ϯĂďŽǀĞ͕ ƚŚĞŝƚLJŝƐĐŽŶƐŝĚĞƌŝŶŐƌĞůŝŶƋƵŝƐŚŵĞŶƚŽĨƚŚĞĞĂĐŚ ŽƵůĞǀĂƌĚƌŝŐŚƚͲŽĨͲǁĂLJĨƌŽŵĂůƚƌĂŶƐƐŽƚŚĂƚƚŚĞŝƚLJ ǁŽƵůĚ ŚĂǀĞ ĐŽŶƚƌŽů ŽǀĞƌ Ăůů ŝŵƉƌŽǀĞŵĞŶƚƐ ǁŝƚŚŝŶ ƚŚĞ ƌŝŐŚƚͲŽĨͲǁĂLJ͕ ŝŶĐůƵĚŝŶŐ ƐŝĚĞǁĂůŬƐ͕ ůĂŶĚƐĐĂƉŝŶŐ͕ ŵĞĚŝĂŶƐ͕ĚƌŝǀĞǁĂLJĂĐĐĞƐƐ͕ƉĞĚĞƐƚƌŝĂŶĐƌŽƐƐŝŶŐƐ͕ĂŶĚ ĂŶLJŶĞĐĞƐƐĂƌLJůĂŶĞŝŵƉƌŽǀĞŵĞŶƚƐƚŽĂĐĐŽŵŵŽĚĂƚĞ ƚƌĂĸĐ͘ dŚĞ ŝŵƉƌŽǀĞŵĞŶƚƐ ĚŝƐĐƵƐƐĞĚ ƚŚƌŽƵŐŚŽƵƚ ƚŚŝƐ ƐĞĐƟŽŶ ĐĂŶ ďĞ ŝŵƉůĞŵĞŶƚĞĚ ǁŝƚŚ Žƌ ǁŝƚŚŽƵƚ ƌĞůŝŶƋƵŝƐŚŵĞŶƚŽĨƚŚĞƌŝŐŚƚͲŽĨͲǁĂLJ͘ 4.6.1 Roadway Classifications ^ƚƌĞĞƚƐ ǁŝƚŚŝŶ ƚŚĞ ^W ĂƌĞĂ ĂƌĞ ĚŝǀŝĚĞĚ ŝŶƚŽ ϯ ĐůĂƐƐŝĮĐĂƟŽŶƐ͗DĂũŽƌƌƚĞƌŝĂů͕WƌŝŵĂƌLJƌƚĞƌŝĂů͕ ĂŶĚ ^ĞĐŽŶĚĂƌLJ ƌƚĞƌŝĂů ĂŶĚ ŽůůĞĐƚŽƌ ^ƚƌĞĞƚ͘ dŚĞ ĐůĂƐƐŝĮĐĂƟŽŶƐ ĂƌĞ ĚĞĮŶĞĚ ŝŶ dĂďůĞ ϰͲϯ͕ ZŽĂĚǁĂLJ ůĂƐƐŝĮĐĂƟŽŶƐ͕ ƐŚŽǁŶ ŽŶ &ŝŐƵƌĞ ϰͲϭϯ͕ ZŽĂĚǁĂLJ ůĂƐƐŝĮĐĂƟŽŶƐ͕ĂŶĚĂƉƉůŝĐĂďůĞƐƚƌĞĞƚƐĞŐŵĞŶƚƐǁŝƚŚŝŶ ƚŚĞ^WĂƌĞĂĂƌĞĚĞƐĐƌŝďĞĚďĞůŽǁ͘ Beach Boulevard ĞĂĐŚŽƵůĞǀĂƌĚͬĂůŝĨŽƌŶŝĂ^ƚĂƚĞZŽƵƚĞϯϵŝƐƚŚĞŵĂŝŶ ƌŽĂĚǁĂLJƚŚƌŽƵŐŚƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂĂŶĚŝƐĐůĂƐƐŝĮĞĚ ĂƐĂ^ƚĂƚĞ,ŝŐŚǁĂLJďLJĂůƚƌĂŶƐĂŶĚĂDĂũŽƌƌƚĞƌŝĂůďLJ ƚŚĞŝƚLJŽĨŶĂŚĞŝŵ'ĞŶĞƌĂůWůĂŶŝƌĐƵůĂƟŽŶůĞŵĞŶƚ ĂŶĚ ƚŚĞ KƌĂŶŐĞ ŽƵŶƚLJ dƌĂŶƐƉŽƌƚĂƟŽŶ ƵƚŚŽƌŝƚLJΖƐ ϮϬϭϳDĂƐƚĞƌWůĂŶŽĨƌƚĞƌŝĂů,ŝŐŚǁĂLJƐ;ϮϬϭϳDW,Ϳ͘ dŚŝƐŶŽƌƚŚͲƐŽƵƚŚƌŽĂĚǁĂLJďĞŐŝŶƐŝŶƚŚĞŝƚLJŽĨ>Ă ,ĂďƌĂ ĂŶĚ ĞŶĚƐ ŝŶ ƚŚĞ ŝƚLJ ŽĨ ,ƵŶƟŶŐƚŽŶ ĞĂĐŚ͘ tŝƚŚŝŶ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ ĂƌĞĂ ƚŚĞ ƐƚƌĞĞƚ ŚĂƐ ĞŝŐŚƚ ůĂŶĞƐǁŝƚŚĂƉŽƐƚĞĚƐƉĞĞĚůŝŵŝƚŽĨϰϱŵŝůĞƐƉĞƌŚŽƵƌ͘ tŝƚŚŝŶƚŚĞŝƚLJŽĨƵĞŶĂWĂƌŬ͕ƚŚĞƌŽĂĚƌĂŶŐĞƐĨƌŽŵ ϲƚŽϴůĂŶĞƐ͘/ŶƚŚĞŝƚLJŽĨ^ƚĂŶƚŽŶĞĂĐŚŽƵůĞǀĂƌĚ ŵĂŝŶƚĂŝŶƐĞŝŐŚƚůĂŶĞƐ͘dŚŝƐƌŽĂĚǁĂLJŝƐĐƵƌƌĞŶƚůLJƵŶĚĞƌ ĂůƚƌĂŶƐũƵƌŝƐĚŝĐƟŽŶŝŶƚŚĞŝƚLJŽĨŶĂŚĞŝŵ͘ ĞĂĐŚŽƵůĞǀĂƌĚŝƐĂDĂũŽƌƌƚĞƌŝĂůĐŽŶŶĞĐƟŶŐ>Ă,ĂďƌĂƚŽ,ƵŶƟŶŐƚŽŶ ĞĂĐŚ ƚŚƌŽƵŐŚ ƚŚĞ ĐŝƟĞƐ ŽĨ ƵĞŶĂ WĂƌŬ͕ ŶĂŚĞŝŵ͕ ^ƚĂŶƚŽŶ͕ ĂŶĚ tĞƐƚŵŝŶƐƚĞƌ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ93 4 TYPE DESCRIPTION APPLICABLE STREET DĂũŽƌ ƌƚĞƌŝĂů ZŽĂĚǁĂLJƐ ƚŚĂƚ ĐŽŶŶĞĐƚ ƚŽ ĨƌĞĞǁĂLJƐ ĂŶĚ ƚLJƉŝĐĂůůLJ ŚĂǀĞ ƐŝdžůĂŶĞƐ͕ĂŵĞĚŝĂŶ͕ůĞŌƚƵƌŶ ƉŽĐŬĞƚƐ͕ƉĂƌŬŝŶŐůĂŶĞƐĂĚũĂĐĞŶƚ ƚŽĞĂĐŚĐƵƌďĂŶĚĂƚLJƉŝĐĂůƌŝŐŚƚͲ ŽĨͲǁĂLJǁŝƚŚŽĨϭϮϬĨĞĞƚ;ĞĂĐŚ ŽƵůĞǀĂƌĚŝƐĐŽŶƐŝĚĞƌĞĚĂDĂũŽƌ ƌƚĞƌŝĂů ǁŝƚŚ Ă ƌŝŐŚƚͲŽǁͲǁĂLJ ǁŝĚƚŚŽĨϭϯϮʹϭϰϰĨĞĞƚͿ͘ Beach Boulevard WƌŝŵĂƌLJ ƌƚĞƌŝĂů ZŽĂĚǁĂLJƐ ƚŚĂƚ ƉƌŽǀŝĚĞ ĨŽƌ ĐŝƌĐƵůĂƟŽŶ ǁŝƚŚŝŶ ƚŚĞ ŝƚLJ ĂŶĚ ƚŽ ŝƚƐ ĂĚũĂĐĞŶƚ ĐŽŵŵƵŶŝƟĞƐ͘ WƌŝŵĂƌLJ ĂƌƚĞƌŝĂůƐ ĂƌĞ ƚLJƉŝĐĂůůLJ ƐŝdžůĂŶĞĚŝǀŝĚĞĚĨĂĐŝůŝƟĞƐǁŝƚŚŶŽ ƉĂƌŬŝŶŐŽƌĨŽƵƌůĂŶĞĚŝǀŝĚĞĚǁŝƚŚ ůĞŌƚƵƌŶƉŽĐŬĞƚƐĂŶĚƚǁŽƉĂƌŬŝŶŐ ůĂŶĞƐ͘ dŚĞ ƚLJƉŝĐĂů ƌŝŐŚƚͲŽĨͲǁĂLJ ǁŝĚƚŚŽĨĂƉƌŝŵĂƌLJĂƌƚĞƌŝĂůŝƐϭϬϲ ĨĞĞƚ͘ >ŝŶĐŽůŶ ǀĞŶƵĞΘĂůů ZŽĂĚ ^ĞĐŽŶĚĂƌLJ ƌƚĞƌŝĂů ZŽĂĚǁĂLJƐ ƚŚĂƚ ƉƌŽǀŝĚĞ ĨŽƌ ĐŝƌĐƵůĂƟŽŶ ǁŝƚŚŝŶ ƚŚĞ ŝƚLJ͘ ^ĞĐŽŶĚĂƌLJ ĂƌƚĞƌŝĂů ĨĂĐŝůŝƟĞƐ ĂƌĞ ĨŽƵƌͲůĂŶĞ ƌŽĂĚǁĂLJƐ͕ ǁŝƚŚ ƚǁŽ ƉĂƌŬŝŶŐůĂŶĞƐ͕ƚŚĂƚĂƌĞƵŶĚŝǀŝĚĞĚ͘ dŚĞƐĞ ĨĂĐŝůŝƟĞƐ ŚĂǀĞ Ă ƚLJƉŝĐĂů ƌŝŐŚƚͲŽĨͲǁĂLJǁŝĚƚŚŽĨϵϬĨĞĞƚ͘ KƌĂŶŐĞ ǀĞŶƵĞ͕ tĞƐƚĞƌŶ ǀĞŶƵĞ͕ĂůĞ ǀĞŶƵĞΘ ƌŽĂĚǁĂLJ ^ŽƵƌĐĞ͗ŝƚLJŽĨŶĂŚĞŝŵ'ĞŶĞƌĂůWůĂŶŝƌĐƵůĂƟŽŶůĞŵĞŶƚ͕ϮϬϬϰ͘ d>ϰͳϯZKtz>^^/&/d/KE^ Lincoln Avenue >ŝŶĐŽůŶǀĞŶƵĞŝƐĚĞƐŝŐŶĂƚĞĚĂƐĂWƌŝŵĂƌLJƌƚĞƌŝĂů ŝŶƚŚĞŝƚLJΖƐ'ĞŶĞƌĂůWůĂŶĂŶĚĂƐĂDĂũŽƌƌƚĞƌŝĂůŝŶ ƚŚĞϮϬϭϳDW,͘>ŝŶĐŽůŶǀĞŶƵĞďĞŐŝŶƐŝŶƚŚĞŝƚLJ ŽĨKƌĂŶŐĞĂƚ^ƚĂƚĞZŽƵƚĞϱϱĂŶĚĞŶĚƐŝŶ,ĂǁĂŝŝĂŶ 'ĂƌĚĞŶƐ;ƚƵƌŶŝŶŐŝŶƚŽĂƌƐŽŶ^ƚƌĞĞƚͿ͘tŝƚŚŝŶƚŚĞ^W ĂƌĞĂ>ŝŶĐŽůŶǀĞŶƵĞŝƐĂĚŝǀŝĚĞĚĨŽƵƌůĂŶĞĨĂĐŝůŝƚLJǁŝƚŚ ůĞŌͲƚƵƌŶƉŽĐŬĞƚƐ͕ĂŶĚĂƉŽƐƚĞĚƐƉĞĞĚůŝŵŝƚŽĨϰϬŵŝůĞƐ ƉĞƌŚŽƵƌ͘ Orange Avenue KƌĂŶŐĞ ǀĞŶƵĞ ŝƐ ĚĞƐŝŐŶĂƚĞĚ Ă ^ĞĐŽŶĚĂƌLJ ƌƚĞƌŝĂů ŝŶƚŚĞŝƚLJΖƐ'ĞŶĞƌĂůWůĂŶĂŶĚŝŶƚŚĞϮϬϭϳDW,͘ KƌĂŶŐĞ ǀĞŶƵĞ ďĞŐŝŶƐ ŝŶ ƚŚĞ ŝƚLJ ŽĨ ŶĂŚĞŝŵ Ăƚ ƵĐůŝĚ^ƚƌĞĞƚĂŶĚĞŶĚƐŝŶLJƉƌĞƐƐĂƚůŽŽŵĮĞůĚ^ƚƌĞĞƚ ŝŶLJƉƌĞƐƐ͘tŝƚŚŝŶƚŚĞ^WĂƌĞĂKƌĂŶŐĞǀĞŶƵĞŚĂƐ ĨŽƵƌƵŶĚŝǀŝĚĞĚůĂŶĞƐ͕ůĞŌͲƚƵƌŶƉŽĐŬĞƚƐ͕ĂŶĚĂƉŽƐƚĞĚ ƐƉĞĞĚůŝŵŝƚŽĨϯϱŵŝůĞƐƉĞƌŚŽƵƌ͘ Ball Road Ăůů ZŽĂĚ ŝƐ ĚĞƐŝŐŶĂƚĞĚ Ă WƌŝŵĂƌLJ ƌƚĞƌŝĂů ŝŶ ƚŚĞ ŝƚLJΖƐ'ĞŶĞƌĂůWůĂŶĂŶĚŝŶƚŚĞϮϬϭϳDW,͘ĂůůZŽĂĚ ďĞŐŝŶƐŝŶƚŚĞŝƚLJŽĨKƌĂŶŐĞĂƐdĂŌǀĞŶƵĞ͕ƚƵƌŶƐŝŶƚŽ ĂůůZŽĂĚŝŶŶĂŚĞŝŵĂƚ^ZͲϱϳĂŶĚĞŶĚƐŝŶLJƉƌĞƐƐ ;ƚƵƌŶŝŶŐŝŶƚŽtĂƌĚůŽǁZŽĂĚͿ͘tŝƚŚŝŶƚŚĞ^WĂƌĞĂ ĂůůZŽĂĚŚĂƐĨŽƵƌƵŶĚŝǀŝĚĞĚůĂŶĞƐ͕ůĞŌͲƚƵƌŶƉŽĐŬĞƚƐ͕ ĂŶĚŚĂƐĂƉŽƐƚĞĚƐƉĞĞĚůŝŵŝƚŽĨϰϬŵŝůĞƐƉĞƌŚŽƵƌ͘ 4.6.2 Beach Boulevard Roadway Impacts  dƌĂĸĐ /ŵƉĂĐƚ ŶĂůLJƐŝƐ ;d/Ϳ ǁĂƐ ƉƌĞƉĂƌĞĚ ĨŽƌ ƚŚĞ ^W͕ ĂŶĚ ŝƐ ŝŶĐůƵĚĞĚ ĂƐ ƉƉĞŶĚŝdž & ŝŶ ƚŚĞ ŶǀŝƌŽŶŵĞŶƚĂů /ŵƉĂĐƚ ZĞƉŽƌƚ ;/ZͿ͘ dŚŝƐ ĂŶĂůLJƐŝƐ ŝĚĞŶƟĮĞĚĂŶƵŵďĞƌŽĨƐŝŐŶŝĮĐĂŶƚƚƌĂĸĐŝŵƉĂĐƚƐĂƚ ĐĞƌƚĂŝŶ ŝŶƚĞƌƐĞĐƟŽŶƐ ĂŶĚ ƌŽĂĚǁĂLJ ƐĞŐŵĞŶƚƐ ƚŚĂƚ ĂƌĞĚŝƐĐƵƐƐĞĚŝŶĚĞƚĂŝůŝŶƚŚĞ/ZĂŶĚd/͘dŚĞ/Z͛Ɛ ^ƚĂƚĞŵĞŶƚƐ ŽĨ KǀĞƌƌŝĚŝŶŐ ŽŶƐŝĚĞƌĂƟŽŶƐ ;^KͿ ƉƌŽǀŝĚĞ ƚŚĞ ŶĞĐĞƐƐĂƌLJ ũƵƐƟĮĐĂƟŽŶƐ ƚŽ ŶŽƚ ŝŶĐůƵĚĞ ŵŝƟŐĂƟŽŶĨŽƌƚŚĞƐĞŝŵƉĂĐƚƐĂƐĂůůĂƌĞĞŝƚŚĞƌŽƵƚƐŝĚĞ ŽĨƚŚĞŝƚLJŽĨŶĂŚĞŝŵ͛ƐũƵƌŝƐĚŝĐƟŽŶƚŽŝŵƉůĞŵĞŶƚ ŵŝƟŐĂƟŽŶŽƌĂƌĞŝŶĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞǀŝƐŝŽŶ͕ŐŽĂůƐ ĂŶĚƉŽůŝĐŝĞƐŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶ͘ 94 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ95 4 BROADWAY ORANGE AVE LINCOLN AVE BEACHBLVDWESTERN AVEBALL RD DALE AVECity of Buena Park City of Stanton Roadway Classification Major Arterial Primary Arterial Secondary Arterial Right of Way City Boundary Specific Plan Area 0 500 1,000 Feet &ŝŐƵƌĞϰͲϭϯZŽĂĚǁĂLJůĂƐƐŝĮĐĂƟŽŶƐ ^ŽƵƌĐĞ͗ŝƚLJŽĨŶĂŚĞŝŵ͕ϮϬϭϲ 96 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ97 4 Right of Way Specific Plan Area City Boundary !!!Existing Median Fence Existing Crosswalk Segment Existing Signalized Crosswalk Proposed High Visibility Crosswalk ! ! ! ! ! ! !!!!!!!!!!!!BEACHBLVDFigure 4-14 Crosswalk Improvements ^ŽƵƌĐĞ͗ŝƚLJŽĨŶĂŚĞŝŵĂŶĚĂůƚƌĂŶƐ͕ϮϬϭϳ 4.6.3 Pedestrian Facilities ƐĚĞĮŶĞĚďLJƚŚĞŝƚLJΖƐŝƌĐƵůĂƟŽŶůĞŵĞŶƚ͕ƉĞĚĞƐƚƌŝĂŶ ĨĂĐŝůŝƟĞƐŝŶĐůƵĚĞƐŝĚĞǁĂůŬƐ͕ƚƌĂŝůƐ͕ǁĂůŬǁĂLJƐ͕ďƌŝĚŐĞƐ͕ ĐƌŽƐƐǁĂůŬƐ͕ƐŝŐŶĂůƐ͕ŝůůƵŵŝŶĂƟŽŶ͕ĂŶĚďĞŶĐŚĞƐ͕ĂŵŽŶŐ ŽƚŚĞƌƐ͘dŚĞƐĞĨĂĐŝůŝƟĞƐĂƌĞĂŶŝŵƉŽƌƚĂŶƚƉĂƌƚŽĨƚŚĞ ŝƚLJΖƐŶŽŶͲŵŽƚŽƌŝnjĞĚƚƌĂŶƐƉŽƌƚĂƟŽŶŶĞƚǁŽƌŬ͘ &ŽƌƚŚĞ^WĂƌĞĂ͕ĂůůƌŽĂĚǁĂLJƐŚĂǀĞƐŝĚĞǁĂůŬƐŽŶ ďŽƚŚ ƐŝĚĞƐ ŽĨ ƚŚĞ ƐƚƌĞĞƚ͘ DŽƐƚ ŵĂũŽƌ ŝŶƚĞƌƐĞĐƟŽŶƐ ŚĂǀĞ ĨŽƵƌͲůĞŐŐĞĚ ĐƌŽƐƐǁĂůŬƐͶĐƌŽƐƐŝŶŐƐ ŽŶ Ăůů ĨŽƵƌ ƐŝĚĞƐ ŽĨ ƚŚĞ ŝŶƚĞƌƐĞĐƟŽŶ͘ ůƚŚŽƵŐŚ ƚŚĞ ĞdžŝƐƟŶŐ ƐŝĚĞǁĂůŬƐ ĂƌĞ ǁĞůů ĐŽŶŶĞĐƚĞĚ ĂůŽŶŐ ƚŚĞ ĐŽƌƌŝĚŽƌ͕ ƐŝĚĞǁĂůŬ ǁŝĚƚŚƐ ǀĂƌLJ ĂŶĚ ƚŚĞƌĞ ĂƌĞ ůŽŶŐ ĚŝƐƚĂŶĐĞƐ ďĞƚǁĞĞŶĐƌŽƐƐǁĂůŬƐ͘^ĞĐƟŽŶϰ͘ϯ͘ϯ͕ĞĂĐŚŽƵůĞǀĂƌĚ ZĞͲĞƐŝŐŶ͕ ĚĞƐĐƌŝďĞƐ ƚŚĞ ƉůĂŶŶĞĚ ĐŚĂŶŐĞƐ ƚŽ ƚŚĞ ƐƚƌĞĞƚƐĐĂƉĞĂŶĚƐŝĚĞǁĂůŬĨŽƌĞĂĐŚŽƵůĞǀĂƌĚ͘ WĞĚĞƐƚƌŝĂŶĐƌŽƐƐǁĂůŬƐĂĐƌŽƐƐĞĂĐŚŽƵůĞǀĂƌĚĂƌĞ ĐŽŶƐƚƌĂŝŶĞĚďLJƚŚĞǁŝĚĞƌŽĂĚǁĂLJǁŝĚƚŚ;ĞŝŐŚƚůĂŶĞƐͿ͕ ǁŚŝĐŚ ĐĂƵƐĞƐ ůŽŶŐ ĐƌŽƐƐŝŶŐ ĚŝƐƚĂŶĐĞ ĂŶĚ ĂĚĚƐ ƚŽ ǀĞŚŝĐůĞĚĞůĂLJ͘&ŝŐƵƌĞϰͲϭϰ͕ƌŽƐƐǁĂůŬ/ŵƉƌŽǀĞŵĞŶƚƐ͕ ƐŚŽǁƐ ƚŚĞ ůŽĐĂƟŽŶ ŽĨ ƌĞĐĞŶƚůLJ ĐŽŵƉůĞƚĞĚ ĂŶĚ ƉƌŽƉŽƐĞĚ ƐŝĚĞǁĂůŬ ĞŶŚĂŶĐĞŵĞŶƚƐ ƚŚĂƚ ǁŝůů ŚĞůƉ ƉĞĚĞƐƚƌŝĂŶ ŵŽďŝůŝƚLJ ĂůŽŶŐ ƚŚĞ ĐŽƌƌŝĚŽƌ͘ ƌŽƐƐǁĂůŬ ŵĂƌŬŝŶŐƐƉƌŽǀŝĚĞŐƵŝĚĂŶĐĞĨŽƌƉĞĚĞƐƚƌŝĂŶƐĂŶĚŽƚŚĞƌ ŶŽŶͲŵŽƚŽƌŝnjĞĚǀĞŚŝĐůĞƐĐƌŽƐƐŝŶŐƌŽĂĚǁĂLJƐďLJĚĞĮŶŝŶŐ ĂŶ ĂƉƉƌŽƉƌŝĂƚĞ ƉĂƚŚǁĂLJ͘ ,ŝŐŚ ǀŝƐŝďŝůŝƚLJ ĐƌŽƐƐǁĂůŬƐ ƚLJƉŝĐĂůůLJŵĂŬĞƵƐĞŽĨůŽŶŐŝƚƵĚŝŶĂůŽƌΗĐŽŶƟŶĞŶƚĂů͕ΗŽƌ ΗůĂĚĚĞƌΗƐƚLJůĞƉĂǀĞŵĞŶƚŵĂƌŬŝŶŐƐǁŚŝĐŚĂƌĞǀŝƐŝďůĞƚŽ ĂƉƉƌŽĂĐŚŝŶŐƚƌĂĸĐ͘ ĞŶĞĮƚƐŽĨŚŝŐŚǀŝƐŝďŝůŝƚLJĐƌŽƐƐǁĂůŬƐŝŶĐůƵĚĞ͗ • ĞĮŶĞƐƚŚĞƐƉĂĐĞĨŽƌƉĞĚĞƐƚƌŝĂŶĐƌŽƐƐŝŶŐ ĂŶĚĂƩƌĂĐƚƐƉĞĚĞƐƚƌŝĂŶƐƚŽƚŚĞĂƉƉƌŽƉƌŝĂƚĞ ĐƌŽƐƐŝŶŐƉŽŝŶƚ • /ŵƉƌŽǀĞĚǀŝƐŝďŝůŝƚLJŽĨƉĞĚĞƐƚƌŝĂŶĐƌŽƐƐŝŶŐ ĂƌĞĂǁĂƌŶŝŶŐĚƌŝǀĞƌƐƚŚĂƚƉĞĚĞƐƚƌŝĂŶƚƌĂĸĐŝƐ ƚŽďĞĞdžƉĞĐƚĞĚ • ŝƐĐŽƵƌĂŐĞƐĚƌŝǀĞƌƐĨƌŽŵĞŶĐƌŽĂĐŚŝŶŐŝŶƚŽ ĐƌŽƐƐǁĂůŬƐ /ŵƉůĞŵĞŶƚĂƟŽŶ ŽĨ ŚŝŐŚ ǀŝƐŝďŝůŝƚLJ ĐƌŽƐƐǁĂůŬƐ ĐŽƵůĚ ŽĐĐƵƌŝŶƚĂŶĚĞŵǁŝƚŚĞĂĐŚŽƵůĞǀĂƌĚďƌĂŶĚŝŶŐĂƐ ŝĚĞŶƟĮĞĚŝŶ^ĞĐƟŽŶϰ͘ϯ͘ϳ͕ƌĂŶĚŝŶŐƚŚĞŽƵůĞǀĂƌĚ͘ ^ŝŶĐĞĞĂĐŚŽƵůĞǀĂƌĚŝƐĐƵƌƌĞŶƚůLJĂĂůƚƌĂŶƐĨĂĐŝůŝƚLJ͕ ŝŵƉƌŽǀĞŵĞŶƚƐǁŝƚŚŝŶ ƚŚĞƌŝŐŚƚͲŽĨͲǁĂLJŵĂLJƌĞƋƵŝƌĞ ƉĂƌƚŶĞƌƐŚŝƉǁŝƚŚĂůƚƌĂŶƐ͘ 98 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ TYPE DESCRIPTION ůĂƐƐ/ ůĂƐƐ/ďŝŬĞƉĂƚŚƐ͕ĂůƐŽƌĞĨĞƌƌĞĚƚŽĂƐ͞ůĂƐƐ / ŝŬĞǁĂLJƐ͕͟ Žƌ ƐŚĂƌĞĚ ƵƐĞ ƉĂƚŚƐ͕ ƉƌŽǀŝĚĞ Ă ĐŽŵƉůĞƚĞůLJ ƐĞƉĂƌĂƚĞĚ ƌŝŐŚƚͲŽĨͲǁĂLJ ĚĞƐŝŐŶĂƚĞĚĨŽƌƚŚĞĞdžĐůƵƐŝǀĞƵƐĞŽĨďŝĐLJĐůĞƐ ĂŶĚƉĞĚĞƐƚƌŝĂŶƐǁŝƚŚĐƌŽƐƐŇŽǁƐďLJŵŽƚŽƌŝƐƚƐ ŵŝŶŝŵŝnjĞĚ ůĂƐƐ// ůĂƐƐ//ďŝĐLJĐůĞůĂŶĞƐ͕ĂůƐŽƌĞĨĞƌƌĞĚƚŽĂƐ͞ůĂƐƐ // ďŝŬĞǁĂLJƐ͕͟ ƉƌŽǀŝĚĞ Ă ƌĞƐƚƌŝĐƚĞĚ ƌŝŐŚƚͲŽĨͲ ǁĂLJĚĞƐŝŐŶĂƚĞĚĨŽƌƚŚĞĞdžĐůƵƐŝǀĞŽƌƐĞŵŝͲ ĞdžĐůƵƐŝǀĞƵƐĞŽĨďŝĐLJĐůĞƐǁŝƚŚƚŚƌŽƵŐŚƚƌĂǀĞů ďLJŵŽƚŽƌǀĞŚŝĐůĞƐŽƌƉĞĚĞƐƚƌŝĂŶƐƉƌŽŚŝďŝƚĞĚ͕ ďƵƚǁŝƚŚǀĞŚŝĐůĞƉĂƌŬŝŶŐĂŶĚĐƌŽƐƐŇŽǁƐďLJ ƉĞĚĞƐƚƌŝĂŶƐĂŶĚŵŽƚŽƌŝƐƚƐƉĞƌŵŝƩĞĚ ƵīĞƌĞĚ ŝŬĞ >ĂŶĞƐ ƵīĞƌĞĚŝŬĞ>ĂŶĞƐĂƌĞůĂƐƐ//ďŝŬĞůĂŶĞƐƚŚĂƚ ƉƌŽǀŝĚĞĂƉĂŝŶƚĞĚďƵīĞƌĨŽƌůĂƚĞƌĂůƐĞƉĂƌĂƟŽŶ ďĞƚǁĞĞŶŵŽƚŽƌǀĞŚŝĐůĞƚƌĂǀĞůĂŶĚͬŽƌƉĂƌŬŝŶŐ ůĂŶĞƐ ĂŶĚ ďŝĐLJĐůĞƐ ĂƌĞ ĚĞƐŝŐŶĞĚ ƚŽ ǀŝƐƵĂůůLJ ƌĞŝŶĨŽƌĐĞ ^ĞĐƟŽŶ ϮϭϳϲϬ ŽĨ ƚŚĞ ĂůŝĨŽƌŶŝĂ sĞŚŝĐůĞ ŽĚĞ ƚŚĂƚ ƌĞƋƵŝƌĞƐ dŚƌĞĞ &ĞĞƚ ĨŽƌ ^ĂĨĞƚLJǁŚĞŶǀĞŚŝĐůĞƐƉĂƐƐďŝĐLJĐůŝƐƚƐ ůĂƐƐ/// ůĂƐƐ///ďŝŬĞƌŽƵƚĞƐ͕ĂůƐŽƌĞĨĞƌƌĞĚƚŽĂƐ ͞ůĂƐƐ /// ďŝŬĞǁĂLJƐ͕͟ ƉƌŽǀŝĚĞ Ă ƌŝŐŚƚͲŽĨͲǁĂLJ ŽŶͲƐƚƌĞĞƚŽƌŽīͲƐƚƌĞĞƚ͕ĚĞƐŝŐŶĂƚĞĚďLJƐŝŐŶƐ Žƌ ƉĞƌŵĂŶĞŶƚ ŵĂƌŬŝŶŐƐ ĂŶĚ ƐŚĂƌĞĚ ǁŝƚŚ ƉĞĚĞƐƚƌŝĂŶƐ ĂŶĚ ŵŽƚŽƌŝƐƚƐ͘ ůĂƐƐ /// ďŝŬĞ ƌŽƵƚĞƐƉƌŽǀŝĚĞƐŚĂƌĞĚƵƐĞǁŝƚŚŵŽƚŽƌǀĞŚŝĐůĞ ƚƌĂĸĐŝŶƚŚĞƐĂŵĞƚƌĂǀĞůůĂŶĞ ŝĐLJĐůĞ ŽƵůĞǀĂƌĚƐ ŝĐLJĐůĞŽƵůĞǀĂƌĚƐĂƌĞůĂƐƐ///ďŝŬĞƌŽƵƚĞƐ ŽŶůŽĐĂůƌŽĂĚƐŽƌƌĞƐŝĚĞŶƟĂůƐƚƌĞĞƚƐĚĞƐŝŐŶĞĚ ƚŽ ĨĂĐŝůŝƚĂƚĞ ƐĂĨĞ ĂŶĚ ĐŽŶǀĞŶŝĞŶƚ ďŝĐLJĐůĞ ƚƌĂǀĞů͘dƌĞĂƚŵĞŶƚƐĂƌĞĂŝŶƚĞŶĚĞĚƚŽŝŶĐƌĞĂƐĞ ŵŽƚŽƌŝƐƚƐ͛ ĂǁĂƌĞŶĞƐƐ ŽĨ ďŝĐLJĐůĞ ĂĐƟǀŝƚLJ ƚŚƌŽƵŐŚ ƚŚĞ ƵƐĞ ŽĨ ƚƌĂĸĐ ĐĂůŵŝŶŐ ĚĞǀŝĐĞƐ ƐƵĐŚĂƐƐŝŐŶƐ͕ƉĂǀĞŵĞŶƚŵĂƌŬŝŶŐƐ͕ĂŶĚƐƉĞĞĚ ĂŶĚǀŽůƵŵĞŵĂŶĂŐĞŵĞŶƚŵĞĂƐƵƌĞƐ ůĂƐƐ/sͬLJĐůĞ dƌĂĐŬ ůĂƐƐ/sLJĐůĞƚƌĂĐŬƐŽƌƐĞƉĂƌĂƚĞĚďŝŬĞǁĂLJƐ͕ ĂůƐŽ ƌĞĨĞƌƌĞĚ ƚŽ ĂƐ ͞ůĂƐƐ /s ďŝŬĞǁĂLJƐ͕͟ ƉƌŽŵŽƚĞ ĂĐƟǀĞ ƚƌĂŶƐƉŽƌƚĂƟŽŶ ĂŶĚ ƉƌŽǀŝĚĞ Ă ƌŝŐŚƚͲŽĨͲǁĂLJ ĚĞƐŝŐŶĂƚĞĚ ĞdžĐůƵƐŝǀĞůLJ ĨŽƌ ďŝĐLJĐůĞ ƚƌĂǀĞů ĂĚũĂĐĞŶƚ ƚŽ Ă ƌŽĂĚǁĂLJ ĂŶĚ ǁŚŝĐŚ ĂƌĞ ƐĞƉĂƌĂƚĞĚ ĨƌŽŵ ǀĞŚŝĐƵůĂƌ ƚƌĂĸĐ͘ dLJƉĞƐ ŽĨ ƐĞƉĂƌĂƟŽŶ ŝŶĐůƵĚĞ͕ ďƵƚ ĂƌĞ ŶŽƚ ůŝŵŝƚĞĚƚŽ͕ŐƌĂĚĞƐĞƉĂƌĂƟŽŶ͕ŇĞdžŝďůĞƉŽƐƚƐ͕ ŝŶŇĞdžŝďůĞ ƉŚLJƐŝĐĂů ďĂƌƌŝĞƌƐ͕ Žƌ ŽŶͲƐƚƌĞĞƚ ƉĂƌŬŝŶŐ͘dŚĞƌĞĂƌĞŶŽĞdžŝƐƟŶŐĐLJĐůĞƚƌĂĐŬƐŝŶ ƚŚĞŝƚLJŽĨŶĂŚĞŝŵ ^ŽƵƌĐĞ͗ŝƚLJŽĨŶĂŚĞŝŵ'ĞŶĞƌĂůWůĂŶŝƌĐƵůĂƟŽŶůĞŵĞŶƚ͕ϮϬϬϰ͘ d>ϰͳϰ/<tz&/E/d/KE^4.6.4 Bikeways dŚĞ ŝƚLJ ŽĨ ŶĂŚĞŝŵΖƐ WůĂŶŶĞĚ ZŽĂĚǁĂLJ EĞƚǁŽƌŬ ŝŶĐůƵĚĞƐůĂƐƐ/͕//͕ĂŶĚ///ďŝŬĞǁĂLJƐ͘dĂďůĞϰͲϰ͕ŝŬĞǁĂLJ ĞĮŶŝƟŽŶƐ͕ĚĞƐĐƌŝďĞƐĞĂĐŚŽĨƚŚĞĚŝīĞƌĞŶƚƚLJƉĞƐŽĨ ďŝŬĞǁĂLJƐĨŽƵŶĚŝŶƚŚĞŝƚLJ͘ƐƐŚŽǁŶŽŶ&ŝŐƵƌĞϰͲϭϰ͕ džŝƐƟŶŐ ĂŶĚ WƌŽƉŽƐĞĚ ŝŬĞǁĂLJƐ͕ ƚŚĞƌĞ ĂƌĞ ůŝŵŝƚĞĚ ĞdžŝƐƟŶŐ ďŝŬĞǁĂLJƐ ǁŝƚŚŝŶ ƚŚĞ ^W ĂƌĞĂ͘ dŚĞƌĞ ĂƌĞ ĞdžŝƐƟŶŐůĂƐƐ//ĂŶĚ///ďŝŬĞǁĂLJƐĂůŽŶŐĂůůZŽĂĚĂŶĚ tĞƐƚĞƌŶǀĞŶƵĞĂŶĚĂůĂƐƐ/ďŝŬĞƉĂƚŚĐŽŶŶĞĐƟŶŐ ^ĐŚǁĞŝƚnjĞƌWĂƌŬĂŶĚĂĚũĂĐĞŶƚƐĐŚŽŽůƚŽƚŚĞtĞƐƚ ŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌ͘ dŚĞ ŝƚLJ ŽĨ ŶĂŚĞŝŵΖƐ ŝĐLJĐůĞ DĂƐƚĞƌ WůĂŶ ;DWͿ ǁĂƐĂĚŽƉƚĞĚŝŶϮϬϭϳ͕ǁŝƚŚĂŐŽĂůŽĨƚƌŝƉůŝŶŐƚŚĞŝƚLJΖƐ ĞdžŝƐƟŶŐ ďŝŬĞǁĂLJƐ ĨƌŽŵ ϲϬ ƚŽ ϭϴϬ ŵŝůĞƐ͘ dŚĞ DW ƉƌŽƉŽƐĞƐŶĞǁďŝŬĞǁĂLJƐŝŶƚŚĞĨŽůůŽǁŝŶŐůŽĐĂƟŽŶƐ ǁŝƚŚŝŶƚŚĞ^WĂƌĞĂ͗ • ůĂƐƐ/ĂůŽŶŐƚŚĞĂƌďŽŶƌĞĞŬŚĂŶŶĞů͕ĂƐ ƐŚŽǁŶŽŶ&ŝŐƵƌĞϰͲϭϱ͕WƌŽƉŽƐĞĚĂƌďŽŶ ƌĞĞŬŝŬĞǁĂLJŽŶŶĞĐƟŽŶ • ůĂƐƐ//ĂůŽŶŐ>ŝŶĐŽůŶǀĞŶƵĞĂŶĚKƌĂŶŐĞ ǀĞŶƵĞ • hƉŐƌĂĚĞĞdžŝƐƟŶŐůĂƐƐ///ƐĞŐŵĞŶƚďĞƚǁĞĞŶ ŽŶĂůůZŽĂĚ;ďĞƚǁĞĞŶĞĂĐŚŽƵůĞǀĂƌĚĂŶĚ tĞƐƚĞƌŶǀĞŶƵĞͿƚŽůĂƐƐ// /ŶŽƌĚĞƌƚŽĞŶĐŽƵƌĂŐĞďŝŬŝŶŐŽŶƐůŽǁĞƌƐƉĞĞĚĂŶĚ ǀŽůƵŵĞ ƐƚƌĞĞƚƐ͕ ƚŚĞ DW ĚĞƐŝŐŶĂƚĞƐ ŶŽƌƚŚͲƐŽƵƚŚ ůĂƐƐ//ďŝŬĞǁĂLJƐŽŶĂůĞ^ƚƌĞĞƚĂŶĚtĞƐƚĞƌŶǀĞŶƵĞ ĂƐ ƉĂƌĂůůĞů ƌŽƵƚĞƐ ƚŽ ĞĂĐŚ ŽƵůĞǀĂƌĚ͘ ĂƐƚͲǁĞƐƚ ĐŽŶŶĞĐƟŽŶƐƚŽƚŚĞĐŽƌƌŝĚŽƌǁŽƵůĚďĞƉƌŽǀŝĚĞĚǀŝĂ >ŝŶĐŽůŶǀĞŶƵĞ͕KƌĂŶŐĞǀĞŶƵĞ͕ĂŶĚĂůůZŽĂĚ͘ 4.6.5 Truck Routes ĞĂĐŚ ŽƵůĞǀĂƌĚ ŝƐ Ă ^ƵƌĨĂĐĞ dƌĂŶƐƉŽƌƚĂƟŽŶ ƐƐŝƐƚĂŶĐĞ Đƚ ;^dͿ ŽĸĐŝĂů ƚƌƵĐŬ ƌŽƵƚĞ ĂƐ ƉĂƌƚ ŽĨ ƚŚĞ ƐƚĂƚĞ ŚŝŐŚǁĂLJ ƐLJƐƚĞŵ ;ĂůƚƌĂŶƐͿ͘ EĞĂƌ ƚŚĞ WƌŽũĞĐƚƌĞĂ͕ƚŚĞŝƚLJŽĨŶĂŚĞŝŵĚĞƐŝŐŶĂƚĞƐ>ŝŶĐŽůŶ ǀĞŶƵĞ͕ĂůůZŽĂĚĂŶĚ<ŶŽƩǀĞŶƵĞĂƐŽĸĐŝĂůůŽĐĂů ƚƌƵĐŬƌŽƵƚĞƐ͘ĐĐŽƌĚŝŶŐƚŽĂůƚƌĂŶƐƚƌĂĸĐĚĂƚĂ͕ƚǁŽ ƚŽƚŚƌĞĞƉĞƌĐĞŶƚŽĨƚŚĞƚŽƚĂůƚƌĂĸĐǀŽůƵŵĞŽŶĞĂĐŚ ŽƵůĞǀĂƌĚŝƐƚƌƵĐŬƚƌĂĸĐ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ99 4 &ŝŐƵƌĞϰͲϭϱdžŝƐƟŶŐĂŶĚWƌŽƉŽƐĞĚŝŬĞǁĂLJƐ ^ŽƵƌĐĞ͗ŝƚLJŽĨŶĂŚĞŝŵŝĐLJĐůĞDĂƐƚĞƌWůĂŶ͕ϮϬϭϳ 100 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ101 4 &ŝŐƵƌĞϰͲϭϲWƌŽƉŽƐĞĚĂƌďŽŶƌĞĞŬŝŬĞǁĂLJŽŶŶĞĐƟŽŶ ^ŽƵƌĐĞ͗ŝƚLJŽĨŶĂŚĞŝŵ͕ϮϬϭϳ 102 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ103 4 &ŽƵŶĚĞĚ ŝŶ ϮϬϬϮ͕ ŶĂŚĞŝŵ ZĞƐŽƌƚ dƌĂŶƐƉŽƌƚĂƟŽŶ ƐĞƌǀĞƐ ƚŚĞ ŝƚLJ ŽĨŶĂŚĞŝŵĂŶĚƚŚĞŐƌĞĂƚĞƌŶĂŚĞŝŵZĞƐŽƌƚΡĂƌĞĂĐŽŶŶĞĐƟŶŐ ƚŽ ŽƚŚĞƌ ƉŽƉƵůĂƌ ĚĞƐƟŶĂƟŽŶƐ ƐƵĐŚ ĂƐ ƚŚĞ ŶĂŚĞŝŵ ŽŶǀĞŶƟŽŶ ĞŶƚĞƌ͕ <ŶŽƩΖƐ ĞƌƌLJ &Ăƌŵ͕ Zd/͕ ĂŶĚ ^ŽƵƚŚ ŽĂƐƚ WůĂnjĂ͘ WŚŽƚŽƌĞĚŝƚ͗ŶĂŚĞŝŵZĞƐŽƌƚdƌĂŶƐƉŽƌƚĂƟŽŶ KƌĂŶŐĞ ŽƵŶƚLJ dƌĂŶƐƉŽƌƚĂƟŽŶ ƵƚŚŽƌŝƚLJ ŽƉĞƌĂƚĞƐ ƐĞǀĞƌĂů ďƵƐ ƌŽƵƚĞƐ ƚŚĂƚƉƌŽǀŝĚĞƐĞƌǀŝĐĞƚŽƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͘ 4.6.6 Transit dŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂŝƐƐĞƌǀŝĐĞĚďLJŵƵůƟƉůĞKƌĂŶŐĞ ŽƵŶƚLJdƌĂŶƐƉŽƌƚĂƟŽŶƵƚŚŽƌŝƚLJ;KdͿďƵƐƌŽƵƚĞƐ͘ dŚĞ ƌŽƵƚĞƐ ĂƌĞ ĚĞƐĐƌŝďĞĚ ďĞůŽǁ ĂŶĚ ƐŚŽǁŶ ŽŶ &ŝŐƵƌĞϰͲϭϲ͕dƌĂŶƐŝƚZŽƵƚĞƐ͘ƐĚŝƐĐƵƐƐĞĚŝŶŚĂƉƚĞƌ ϭ͕KdƵƉĚĂƚĞĚŝƚƐDĂƐƚĞƌWůĂŶͶĂůƐŽŬŶŽǁŶĂƐK dƌĂŶƐŝƚ sŝƐŝŽŶͶŝŶ ϮϬϭϳ͘ dŚƌŽƵŐŚ ƚŚĂƚ ĞīŽƌƚ ĞĂĐŚ ŽƵůĞǀĂƌĚĂŶĚ>ŝŶĐŽůŶǀĞŶƵĞŚĂǀĞďĞĞŶŝĚĞŶƟĮĞĚĂƐ ŽƉƉŽƌƚƵŶŝƚLJĐŽƌƌŝĚŽƌƐĨŽƌĨƵƚƵƌĞŚŝŐŚͲƋƵĂůŝƚLJƚƌĂŶƐŝƚ ƐĞƌǀŝĐĞ͘/ŵƉůĞŵĞŶƚĂƟŽŶŽĨƚŚĞƉůĂŶĐŽƵůĚŝŶĐůƵĚĞĂ ƐƚƌĞĞƚĐĂƌŽƌďƵƐƌĂƉŝĚƚƌĂŶƐŝƚůŝŶĞ͕ĂƐǁĞůůĂƐĂĚĚŝƟŽŶĂů ƐƚŽƉƐĂŶĚƵƉŐƌĂĚĞĚĨĂĐŝůŝƟĞƐ͘ ZŽƵƚĞϮϵ;>Ă,ĂďƌĂƚŽ,ƵŶƟŶŐƚŽŶĞĂĐŚͿ ZŽƵƚĞϮϵƌƵŶƐŶŽƌƚŚͲƐŽƵƚŚĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ͘ dŚĞƌŽƵƚĞďĞŐŝŶƐĂƚWĂĐŝĮĐŽĂƐƚ,ŝŐŚǁĂLJΘϭƐƚ^ƚƌĞĞƚ ŝŶ,ƵŶƟŶŐƚŽŶĞĂĐŚĂŶĚĞŶĚƐĂƚĞĂĐŚŽƵůĞǀĂƌĚΘ >Ă,ĂďƌĂŽƵůĞǀĂƌĚŝŶ>Ă,ĂďƌĂ͘ZŽƵƚĞϮϵŽƉĞƌĂƚĞƐ ǁŝƚŚϭϬͲϮϬŵŝŶƵƚĞŚĞĂĚǁĂLJƐŽŶǁĞĞŬĚĂLJƐĂŶĚϭϬͲϯϬ ŵŝŶƵƚĞŚĞĂĚǁĂLJƐŽŶǁĞĞŬĞŶĚƐ͘ ZŽƵƚĞϰϮ;^ĞĂůĞĂĐŚƚŽKƌĂŶŐĞͿ ZŽƵƚĞϰϮƌƵŶƐĞĂƐƚͲǁĞƐƚĂůŽŶŐ>ŝŶĐŽůŶǀĞŶƵĞ͘dŚĞ ƌŽƵƚĞďĞŐŝŶƐĂƚůĞĐƚƌŝĐǀĞŶƵĞΘDĂŝŶ^ƚƌĞĞƚŝŶ^ĞĂů ĞĂĐŚĂŶĚĞŶĚƐĂƚdŚĞsŝůůĂŐĞƐĂƚKƌĂŶŐĞŝŶƚŚĞŝƚLJ ŽĨKƌĂŶŐĞ͘ZŽƵƚĞϰϮŽƉĞƌĂƚĞƐǁŝƚŚϭϬͲϮϬŵŝŶƵƚĞ ŚĞĂĚǁĂLJƐŽŶǁĞĞŬĚĂLJƐĂŶĚϮϬͲϯϬŵŝŶƵƚĞŚĞĂĚǁĂLJƐ ŽŶǁĞĞŬĞŶĚƐ͘ ZŽƵƚĞϰϲ;>ŽƐůĂŵŝƚŽƐƚŽKƌĂŶŐĞͿ ZŽƵƚĞϰϲƌƵŶƐĞĂƐƚͲǁĞƐƚĂůŽŶŐĂůůZŽĂĚ͘dŚĞƌŽƵƚĞ ďĞŐŝŶƐ Ăƚ EŽƌǁĂůŬ ŽƵůĞǀĂƌĚ Θ tĂƌĚůŽǁ ZŽĂĚ ŝŶ >ŽƐůĂŵŝƚŽƐĂŶĚĞŶĚƐĂƚdŚĞsŝůůĂŐĞƐĂƚKƌĂŶŐĞŝŶ ƚŚĞŝƚLJŽĨKƌĂŶŐĞ͘ZŽƵƚĞϰϲƌƵŶƐŽŶϮϬͲϯϬŵŝŶƵƚĞ ŚĞĂĚǁĂLJƐŽŶǁĞĞŬĚĂLJƐĂŶĚϱϬͲϲϬŵŝŶƵƚĞŚĞĂĚǁĂLJƐ ŽŶǁĞĞŬĞŶĚƐ͘ 104 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ ŶĂŚĞŝŵZĞƐŽƌƚdƌĂŶƐŝƚŽƉĞƌĂƚĞƐĂǀĂƌŝĞƚLJŽĨǀĞŚŝĐůĞƐͶďƵƐĞƐ͕ƚƌŽůůĞLJƐ͕ ĂŶĚǀĂŶƐͶƚŽƉƌŽǀŝĚĞƐŚƵƩůĞƐĞƌǀŝĐĞďĞƚǁĞĞŶƚŚĞŶĂŚĞŝŵZĞƐŽƌƚĂƌĞĂ ĂŶĚŽƚŚĞƌĞŶƚĞƌƚĂŝŶŵĞŶƚͲĐĞŶƚƌŝĐĂƌĞĂƐŽĨKƌĂŶŐĞŽƵŶƚLJ͘ WŚŽƚŽƌĞĚŝƚ͗^ŽĂůDĞƚƌŽ͕&ůŝĐŬƌ Private Transit dŚĞ^WĂƌĞĂŝƐŶŽƚĐƵƌƌĞŶƚůLJƐĞƌǀŝĐĞĚďLJŶĂŚĞŝŵ ZĞƐŽƌƚdƌĂŶƐŝƚ;ZdͿ͕ŚŽǁĞǀĞƌ͕ƚŚĞƉƌŽdžŝŵŝƚLJŽĨƚŚĞ ĂƌĞĂƚŽĂǀĂƌŝĞƚLJŽĨĞŶƚĞƌƚĂŝŶŵĞŶƚƵƐĞƐĂŶĚĂůĂƌŐĞ ƚŽƵƌŝƐŵŵĂƌŬĞƚŝƐĂŶŽƉƉŽƌƚƵŶŝƚLJĨŽƌĞdžƉĂŶƐŝŽŶŽĨ ƐĞƌǀŝĐĞ͘&ŝŐƵƌĞϰͲϭϴ͕ŶĂŚĞŝŵZĞƐŽƌƚdƌĂŶƐƉŽƌƚĂƟŽŶ ZŽƵƚĞƐ͕ƐŚŽǁƐƚŚĞĐƵƌƌĞŶƚƌŽƵƚĞƐŽƉĞƌĂƚĞĚďLJZd͘ ĚĚŝƟŽŶĂůůLJ͕ ƚŚĞ ŝƚLJ ŽĨ ƵĞŶĂ WĂƌŬ ĂŶĚ ŶĞĂƌďLJ ĂůŝĨŽƌŶŝĂtĞůĐŽŵĞĞŶƚĞƌŚĂǀĞĂůƐŽĐŽŶƐŝĚĞƌĞĚ ŝŵƉůĞŵĞŶƟŶŐĂĞĂĐŚŽƵůĞǀĂƌĚƐŚƵƩůĞƐĞƌǀŝĐĞƚŽ ĐŽŶŶĞĐƚ ƚŚĞ ƵĞŶĂ WĂƌŬ ŶƚĞƌƚĂŝŶŵĞŶƚ ŽŶĞ ǁŝƚŚ ŽƚŚĞƌ ƉŽŝŶƚƐ ŽĨ ŝŶƚĞƌĞƐƚ ĂůŽŶŐ ĞĂĐŚ ŽƵůĞǀĂƌĚ͘ dŚŝƐ ƚLJƉĞ ŽĨ ƐĞƌǀŝĐĞ ĐŽƵůĚ ďĞ ŝŶƚĞŐƌĂƚĞĚ ǁŝƚŚ Zd Žƌ ĞdžƉůŽƌĞĚ ƚŚƌŽƵŐŚ ŽƚŚĞƌ ŵĞĂŶƐ ďLJ ƚŚĞ ĞĂĐŚ ŽƵůĞǀĂƌĚŽĂůŝƟŽŶ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ105 4 P P P P P P P P P P £[ £[ §¨¦ £[ ×× ×××× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× ×× I2Æa Æa UNINCORPORATED COUNTYCERRITOS AVE LINCOLN MAGNOLIA AVEKATELLA AVE CRESCENT AVE BALL RD LA PALMA AVE KNOTT AVEKnott's Berry Farm 0.5 mi Downtown Buena Park 1.0 miBuena Park Entertainment District 0.5 m CtrCity Anaheim 2.5 mi Disneyland Resort 5.0 mi Downtown Disney 5.0 mi Anaheim Convention Center 6.0 mi Great Wolf Lodge Water Park 7.5 mi Anaheim Garden Walk 6.5 m Adventure City 0.5 mi SANTA ANA GARDEN GROVE CYPRESS WESTMINSTER BUENA PARK STANTON ANAHEIM FULLERTON 22 91 39 5 560 60 701 33 35 37 543 47 38 30 21 25 50 46 33 29 43 543 35 42 56 60 430 721 54 26 OCTA Routes Routes offering 15 minutes (or less) Local Routes (1-99) Bravo Limited Stop Service Stationlink Metrolink - Rail Feeder Routes (400-499) (Weekday Rush Hour Only) Intercounty Express Service (Weekday Rush Hour Only) OC Metrolink Æa Bus Station I2 Rail Station P Key Destination Specific Plan Area City of Anaheim 00.51 Miles Figure 4-17 Transit Routes ^ŽƵƌĐĞ͗KƌĂŶŐĞŽƵŶƚLJdƌĂŶƐŝƚƵƚŚŽƌŝƚLJ͕ϮϬϭϲ 106 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ107 4 P P P P P P P P P P £[ £[ §¨¦ £[Beaches 12.0-20.0 mi ARTIC, Angels Stadium, Honda Center 9.0 mi UNINCORP. COUNTYCERRITOS AVE LINCOLN MAGNOLIA AVEKATELLA AVE CRESCENT AVE BA LL RD LA PALMA AVE KNOTT AVEKnott's Berry Farm 0.5 mi Downtown Buena Park 1.0 miBuena Park Entertainment District 0.5 mi CtrCity Anaheim 2.5 mi Disneyland Resort 5.0 mi Downtown Disney 5.0 mi Anaheim Convention Center 6.0 mi Great Wolf Lodge Water Park 7.5 mi Anaheim Garden Walk 6.5 mi Adventure City 0.5 mi SANTA ANA GARDEN GROVE CYPRESS WESTMINSTER BUENA PARK HUNTINGTON BEACH STANTON ANAHEIM FULLERTON 22 91 39 5 00.51 Miles Anaheim Resort Transportation Shuttle P Key Destination Specific Plan Area City of Anaheim &ŝŐƵƌĞϰͲϭϴŶĂŚĞŝŵZĞƐŽƌƚdƌĂŶƐƉŽƌƚĂƟŽŶZŽƵƚĞƐ ^ŽƵƌĐĞ͗ŶĂŚĞŝŵZĞƐŽƌƚdƌĂŶƐŝƚ͕ϮϬϭϳ 108 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ109 4 4.7 INFRASTRUCTURE /ŶĨƌĂƐƚƌƵĐƚƵƌĞ ŝƐ ĂŶ ŝŵƉŽƌƚĂŶƚ ĂƐƉĞĐƚ ŽĨ ĐŝƚLJͲǁŝĚĞ ƉůĂŶŶŝŶŐ͘ĸĐŝĞŶƚĂŶĚŇĞdžŝďůĞŝŶĨƌĂƐƚƌƵĐƚƵƌĞŝƐŶĞĞĚĞĚ ƚŽ ƐƵƉƉŽƌƚ ƌĞƐŝĚĞŶƚƐ͕ ďƵƐŝŶĞƐƐ͕ ĂŶĚ ǀŝƐŝƚŽƌƐ ĂůŝŬĞ͘ dŚŝƐƐĞĐƟŽŶƐƵŵŵĂƌŝnjĞƐďĂƐĞůŝŶĞĐŽŶĚŝƟŽŶƐŽĨƚŚĞ ĞdžŝƐƟŶŐƉƵďůŝĐƵƟůŝƟĞƐƚŚĂƚƐĞƌǀŝĐĞƚŚĞŝƚLJ͕ŝŶĐůƵĚŝŶŐ ǁĂƚĞƌƐƵƉƉůLJĂŶĚĚŝƐƚƌŝďƵƟŽŶ͕ǁĂƐƚĞǁĂƚĞƌƚƌĞĂƚŵĞŶƚ͕ ƌĞĐLJĐůĞĚǁĂƚĞƌ͕ŇŽŽĚĐŽŶƚƌŽůĂŶĚůŽĐĂůŝnjĞĚĚƌĂŝŶĂŐĞ͘ dŚŝƐŝŶĨŽƌŵĂƟŽŶŝƐƚŚĞďĂƐŝƐ ĨŽƌƌĞĐŽŵŵĞŶĚĂƟŽŶƐ ĂŶĚƐƚƌĂƚĞŐŝĞƐƚŽĞŶƐƵƌĞƚŚĂƚďĂƐŝĐƐĞƌǀŝĐĞƐĐĂŶďĞ ŵĞƚĂƐƚŚĞŝƚLJĂŶĚƚŚĞĞĂĐŚŽƵůĞǀĂƌĚĐŽƌƌŝĚŽƌ ŐƌŽǁ͘ dŚŝƐ ƐĞĐƟŽŶ ƉƌŽǀŝĚĞƐ ĂŶ ŽǀĞƌǀŝĞǁ ŽĨ ĞdžŝƐƟŶŐ ŝŶĨƌĂƐƚƌƵĐƚƵƌĞ ĐŽŶĚŝƟŽŶƐ͕ ƉůĂŶŶĞĚ ŝŵƉƌŽǀĞŵĞŶƚƐ ĨŽƌƚŚĞŵĂũŽƌŝŶĨƌĂƐƚƌƵĐƚƵƌĞƐLJƐƚĞŵƐŝŶĐůƵĚŝŶŐƐƚŽƌŵ ĚƌĂŝŶ͕ ƐĞǁĞƌ͕ ĂŶĚ ǁĂƚĞƌ ĂŶĚ ĚŝƐĐƵƐƐĞƐ ƚŚĞ ŝŵƉĂĐƚ ĨƵƚƵƌĞ ĚĞǀĞůŽƉŵĞŶƚ ĐŽƵůĚ ŚĂǀĞ ŽŶ ƚŚĞƐĞ ƐLJƐƚĞŵƐ͘ /ŵƉůĞŵĞŶƚĂƟŽŶ ĂĐƟŽŶƐ ƌĞůĂƚĞĚ ƚŽ ŝŶĨƌĂƐƚƌƵĐƚƵƌĞ ŝŵƉƌŽǀĞŵĞŶƚƐ ĐĂŶ ďĞ ĨŽƵŶĚ ŝŶ ŚĂƉƚĞƌ ϱ͕ ĚŵŝŶŝƐƚƌĂƟŽŶĂŶĚ/ŵƉůĞŵĞŶƚĂƟŽŶ͘ 4.7.1 Hydrology and Water Quality dŚĞ ϮϴϯͲĂĐƌĞ ^ƉĞĐŝĮĐ WůĂŶ ĂƌĞĂ ŝƐ ƉƌŝŵĂƌŝůLJ ďƵŝůƚͲ ŽƵƚ ǁŝƚŚ ĂŶ ĂǀĞƌĂŐĞ ŝŵƉĞƌǀŝŽƵƐ ĐŽŶĚŝƟŽŶ ŽĨ ĂƉƉƌŽdžŝŵĂƚĞůLJϲϱƉĞƌĐĞŶƚ͘dŚĞƉĞƌǀŝŽƵƐĂƌĞĂƐŝŶĐůƵĚĞ ƐŽŵĞůĂŶĚƐĐĂƉĞĚĂƌĞĂƐƐƵƌƌŽƵŶĚŝŶŐƌĞƐŝĚĞŶƟĂůĂŶĚ ĐŽŵŵĞƌĐŝĂůůĂŶĚƵƐĞƐ͕ǀĂĐĂŶƚůĂŶĚƵƐĞƐ͕ĂŶĚĞdžŝƐƟŶŐ ƉĂƌŬƐ͘ ĐĐŽƌĚŝŶŐ ƚŽ ƚŚĞ ^ƚŽƌŵ ƌĂŝŶ DĂƐƚĞƌ WůĂŶ͕ ƚŚĞŝƚLJŽĨŶĂŚĞŝŵŝƐƐĞƌǀĞĚďLJƚǁŽƉƌŝŵĂƌLJŇŽŽĚ ĐŽŶƚƌŽůĂŶĚĚƌĂŝŶĂŐĞƐLJƐƚĞŵƐ͘ ϭ͘dŚĞŝƚLJŽĨŶĂŚĞŝŵŽƉĞƌĂƚĞƐĂŶĚ ŵĂŝŶƚĂŝŶƐ ƚŚĞ ƐƚŽƌŵ ĚƌĂŝŶ ƐLJƐƚĞŵ ǁŚŝĐŚ ŝŶĐůƵĚĞƐĐĂƚĐŚďĂƐŝŶƐĂŶĚƐƚŽƌŵĚƌĂŝŶƉŝƉĞƐ ;ƉƌŝŵĂƌŝůLJ ƌĞŝŶĨŽƌĐĞĚ ĐŽŶĐƌĞƚĞ ƉŝƉĞ ;ZWͿͿ ƚŚĂƚƌĂŶŐĞŝŶĚŝĂŵĞƚĞƌĨƌŽŵϭϴ͟ƚŽϲϬ͟ǁŝƚŚŝŶ ƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͘ Ϯ͘ KƌĂŶŐĞ ŽƵŶƚLJ &ůŽŽĚ ŽŶƚƌŽů ŝƐƚƌŝĐƚ ;K&ͿŽƉĞƌĂƚĞƐĂŶĚŵĂŝŶƚĂŝŶƐƚŚĞĂƌďŽŶ ƌĞĞŬŇŽŽĚĐŽŶƚƌŽůĨĂĐŝůŝƚLJǁŝƚŚŝŶƚŚĞĂƌĞĂ͘ /ŶƐƵŵŵĂƌLJ͕ĂůůƌƵŶŽīĨƌŽŵƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ ĚŝƐĐŚĂƌŐĞƐ ŝŶƚŽ ƚŚĞ ĂƌďŽŶ ƌĞĞŬ ŚĂŶŶĞů ǁŚŝĐŚ ŇŽǁƐĚŝƌĞĐƚůLJŝŶƚŽŽLJŽƚĞƌĞĞŬĂŶĚƵůƟŵĂƚĞůLJŝŶƚŽ ƚŚĞWĂĐŝĮĐKĐĞĂŶǀŝĂƚŚĞ^ĂŶ'ĂďƌŝĞůƐƚƵĂƌLJĂŶĚ>ŽƐ ůĂŵŝƚŽƐĂLJ͘ /ŶĨƌĂƐƚƌƵĐƚƵƌĞƚŽƐƵƉƉŽƌƚƐƚŽƌŵǁĂƚĞƌŵĂŶĂŐĞŵĞŶƚŝƐǀŝƐŝďůĞƚŚƌŽƵŐŚŽƵƚƚŚĞ ^WĂƌĞĂ͘ 110 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚĞ ŝƚLJ͛Ɛ ϮϬϭϬ DĂƐƚĞƌ WůĂŶ ŽĨ ƌĂŝŶĂŐĞ ĨŽƌ ƚŚĞ ĂƌďŽŶƌĞĞŬŚĂŶŶĞůdƌŝďƵƚĂƌLJƌĞĂ;͞DĂƐƚĞƌWůĂŶ ŽĨƌĂŝŶĂŐĞ͟ͿŚŝŐŚůŝŐŚƚƐƉůĂŶƐĨŽƌŝŵƉƌŽǀŝŶŐƚŚĞƐƚŽƌŵ ĚƌĂŝŶƐLJƐƚĞŵĂŶĚƐĞƌǀĞƐĂƐƚŚĞŐƵŝĚŝŶŐĚŽĐƵŵĞŶƚĨŽƌ ĐĂƉŝƚĂůŝŵƉƌŽǀĞŵĞŶƚƐƚŽƚŚĞƐƚŽƌŵĚƌĂŝŶƐLJƐƚĞŵ͘/Ŷ ŽƌĚĞƌƚŽƐĂƟƐĨLJƚŚĞŝƚLJ͛ƐƌĞƋƵŝƌĞŵĞŶƚŽĨĐŽŶǀĞLJŝŶŐ ƚŚĞϭϬͲLJĞĂƌƐƚŽƌŵĞǀĞŶƚŝŶƚŚĞƐƚŽƌŵĚƌĂŝŶƐ͕ĂŶĚĂůƐŽƚŽ ƐĂƟƐĨLJƐƚƌĞĞƚŇŽŽĚŝŶŐĐƌŝƚĞƌŝĂ͕ĐĞƌƚĂŝŶŝŵƉƌŽǀĞŵĞŶƚƐ ŚĂǀĞ ďĞĞŶ ƌĞĐŽŵŵĞŶĚĞĚ ŝŶ ƚŚĞ DĂƐƚĞƌ WůĂŶ ŽĨ ƌĂŝŶĂŐĞ͘ dŚĞ DĂƐƚĞƌ WůĂŶ ŽĨ ƌĂŝŶĂŐĞ ŚŝŐŚůŝŐŚƚƐ ƚŚĂƚƚŚĞƌĞĂƌĞƐĞǀĞŶWƌŝŽƌŝƚLJϭƉƌŽƉŽƐĞĚŶĞǁƐƚŽƌŵ ĚƌĂŝŶ ƐĞŐŵĞŶƚƐůŽĐĂƚĞĚ ĂĚũĂĐĞŶƚƚŽƚŚĞ^WĂƌĞĂ ĂŶĚ ƚŚŝƌƚĞĞŶ ;ϭϯͿ WƌŝŽƌŝƚLJ Ϯ ƉĂƌĂůůĞůͬƌĞƉůĂĐĞŵĞŶƚ ƐƚŽƌŵĚƌĂŝŶůŝŶĞƐ͘EŽŶĞŽĨƚŚĞƐĞƐƚŽƌŵĚƌĂŝŶĨĂĐŝůŝƟĞƐ ŚĂǀĞďĞĞŶďƵŝůƚŽƌƵƉƐŝnjĞĚĚƵĞƚŽĨƵŶĚŝŶŐĐŽŶƐƚƌĂŝŶƚƐ͖ ŚŽǁĞǀĞƌ͕ ŐƌĂŶƚ ŽƉƉŽƌƚƵŶŝƟĞƐ ĂƌĞ ĐƵƌƌĞŶƚůLJ ďĞŝŶŐ ĞdžƉůŽƌĞĚƚŽŚĞůƉƐƵƉƉŽƌƚƚŚĞƐĞƵƉŐƌĂĚĞƐ͘ /ŶĂĚĚŝƟŽŶƚŽƚŚĞŝƚLJƐƚŽƌŵĚƌĂŝŶůŝŶĞƐ͕K& ŽƉĞƌĂƚĞƐ ĂŶĚ ŵĂŝŶƚĂŝŶƐ ƚŚĞ ĂƌďŽŶ ƌĞĞŬ ŇŽŽĚ ĐŽŶƚƌŽůĐŚĂŶŶĞůƚŚĂƚďŝƐĞĐƚƐƚŚĞ^WƐƚƵĚLJĂƌĞĂ͘ůů ŝƚLJƐƚŽƌŵĚƌĂŝŶůŝŶĞƐǁŝƚŚŝŶƚŚĞ^WĂƌĞĂƟĞŝŶƚŽ ƚŚĞĂƌďŽŶƌĞĞŬŇŽŽĚĐŽŶƚƌŽůĐŚĂŶŶĞů͘dŚĞƐĞŐŵĞŶƚ ŽĨĂƌďŽŶƌĞĞŬƚŚĂƚƌƵŶƐƚŚƌŽƵŐŚƚŚĞ^WĂƌĞĂǁĂƐ ďƵŝůƚŝŶƚŚĞůĂƚĞϭϵϱϬƐĂŶĚĚŽĞƐŶŽƚŵĞĞƚK&͛Ɛ ĐƵƌƌĞŶƚ ĚĞƐŝŐŶ ƐƚĂŶĚĂƌĚƐ ŽĨ ĐŽŶǀĞLJŝŶŐ Ă ϭϬϬͲLJĞĂƌ ƐƚŽƌŵ ĞǀĞŶƚ͘ dŚĞƌĞĨŽƌĞ͕ ƚŚĞ ĞdžŝƐƟŶŐ ŇŽŽĚ ĐŽŶƚƌŽů ĨĂĐŝůŝƚLJ ŝƐ ĚĞĮĐŝĞŶƚ ĂŶĚ ĚŽĞƐ ŶŽƚ ƉƌŽǀŝĚĞ ĂĚũĂĐĞŶƚ ƉƌŽƉĞƌƟĞƐƐƵĸĐŝĞŶƚƉƌŽƚĞĐƟŽŶĨƌŽŵŇŽŽĚŝŶŐĚƵƌŝŶŐ ƚŚĞ ϭϬϬͲLJĞĂƌ ƐƚŽƌŵ ĞǀĞŶƚ͘ dŚĞ ĚĞĮĐŝĞŶƚ ƐĞŐŵĞŶƚƐ ŽĨ ƚŚĞ ĂƌďŽŶ ƌĞĞŬ ŚĂŶŶĞů ǁŝƚŚŝŶ ƚŚĞ ^W ĂƌĞ ƚĞŶƚĂƟǀĞůLJ ƐĐŚĞĚƵůĞĚ ƚŽ ďĞ ŝŵƉƌŽǀĞĚ ǁŝƚŚŝŶ ƚŚĞ ŶĞdžƚƚǁŽLJĞĂƌƐ͘&ŝŐƵƌĞϰͲϭϵ͕WƌŽƉŽƐĞĚ^ƚŽƌŵƌĂŝŶ /ŵƉƌŽǀĞŵĞŶƚƐ͕ĚĞƉŝĐƚƐƚŚĞƉƌŝŽƌŝƚLJĂŶĚŝŵƉƌŽǀĞŵĞŶƚ ĂƌĞĂƐĨŽƌŝŵƉůĞŵĞŶƚĂƟŽŶŽĨƚŚĞ^W͘ ĞǀĞůŽƉŵĞŶƚ ŽĨ ƚŚĞ ĞdžŝƐƟŶŐ͕ ŵŽƐƚůLJ ƉĞƌǀŝŽƵƐ ǀĂĐĂŶƚ ůĂŶĚƐ͕ ǁŚŝĐŚ ĐŽŶƐƟƚƵƚĞ ĂƉƉƌŽdžŝŵĂƚĞůLJ Ϯϱ ĂĐƌĞƐ ŽĨ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ ďŽƵŶĚĂƌLJ͕ ǁŝůů ŝŶĐƌĞĂƐĞ ƚŚĞĂŵŽƵŶƚŽĨƐƚŽƌŵǁĂƚĞƌƌƵŶŽīŝŶƚŚĞƉƌŽƉŽƐĞĚ ĐŽŶĚŝƟŽŶ͘ dŚĞ ďƵůŬ ŽĨ ƚŚĞ ĞdžŝƐƟŶŐ ǀĂĐĂŶƚ ĂƌĞĂ ŝƐ ƚŚĞ ƉƌŽƉŽƐĞĚ ϮϱͲĂĐƌĞ tĞƐƚŐĂƚĞ ^ŚŽƉƉŝŶŐ ĞŶƚĞƌ ůŽĐĂƚĞĚĂƚƚŚĞŶŽƌƚŚĞĂƐƚĞƌŶƉŽƌƟŽŶŽĨƚŚĞ^WĂƌĞĂ͘ dŚĞĚĞǀĞůŽƉŵĞŶƚŽĨƚŚŝƐƐŝƚĞŚĂƐďĞĞŶĂŶƟĐŝƉĂƚĞĚ ĨŽƌ ƐĞǀĞƌĂů LJĞĂƌƐ ĂŶĚ ŚĂƐ ƚŚĞ ƉŽƚĞŶƟĂů ƚŽ ŐƌĞĂƚůLJ ŝŶĐƌĞĂƐĞƐƚŽƌŵǁĂƚĞƌƌƵŶŽīŇŽǁƐŝŶƚŽƚŚĞĂĚũĂĐĞŶƚ ƐƚŽƌŵĚƌĂŝŶƐLJƐƚĞŵ͘&ŽƌƚƵŶĂƚĞůLJ͕ĂƐƚŚĞŝƚLJ͛ƐWƵďůŝĐ tŽƌŬƐĞƉĂƌƚŵĞŶƚŚĂƐƉůĂŶŶĞĚĨŽƌƚŚĞĚĞǀĞůŽƉŵĞŶƚ ŽĨƚŚŝƐƉĂƌĐĞů͕ƚŚĞĂĚũĂĐĞŶƚƐƚŽƌŵĚƌĂŝŶƐLJƐƚĞŵǁĂƐ ĚĞƐŝŐŶĞĚƚŽĂĐĐŽŵŵŽĚĂƚĞŇŽǁƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚƚŚĞ ĚĞǀĞůŽƉŵĞŶƚŽĨƚŚĞƉĂƌĐĞů͘ /dzK&E,/DϮϬϭϬD^dZ PLAN OF DRAINAGE PRIORITY AREA DEFINITIONS X WƌŝŽƌŝƚLJϭ͗WƌŽƉŽƐĞĚŶĞǁƐƚŽƌŵĚƌĂŝŶŝŶ ĂƌƚĞƌŝĂů ŚŝŐŚǁĂLJ Žƌ ůŽĐĂů ƐƚƌĞĞƚ ǁŚĞƌĞ ŶŽŶĞĞdžŝƐƚƚŽĚĂLJƚŽĂĐŚŝĞǀĞϭϬͲ͕ϮϱͲ͕ĂŶĚ ϭϬϬͲLJĞĂƌŇŽŽĚƉƌŽƚĞĐƟŽŶůĞǀĞůƐ͘ X WƌŝŽƌŝƚLJ Ϯ͗ WƌŽƉŽƐĞĚ ƉĂƌĂůůĞů Žƌ ƌĞƉůĂĐĞŵĞŶƚ ƐƚŽƌŵ ĚƌĂŝŶ ŝŶ ĂƌƚĞƌŝĂů ŚŝŐŚǁĂLJ Žƌ ůŽĐĂů ƐƚƌĞĞƚ ƚŽ ĂĐŚŝĞǀĞ ϭϬͲ͕ ϮϱͲ͕ĂŶĚϭϬϬͲLJĞĂƌŇŽŽĚƉƌŽƚĞĐƟŽŶůĞǀĞůƐ͘ X WƌŝŽƌŝƚLJϯ͗WƌŽƉŽƐĞĚŶĞǁƐƚŽƌŵĚƌĂŝŶŝŶ ĂůŽĐĂůƐƚƌĞĞƚǁŚĞƌĞϭϬϬͲLJĞĂƌƉƌŽƚĞĐƟŽŶ ůĞǀĞůƐĂƌĞŵĞƚǁŝƚŚŽƵƚƚŚĞƐƚŽƌŵĚƌĂŝŶ ƚŚƌŽƵŐŚ ƐŚĞĞƚ ŇŽǁ ĐŽŶǀĞLJĂŶĐĞ ǁŝƚŚŝŶ ƚŚĞƐƚƌĞĞƚ͕ŚŽǁĞǀĞƌ͕ƚŚĞƐƚŽƌŵĚƌĂŝŶŝƐ ƌĞƋƵŝƌĞĚ ƚŽ ĂĐŚŝĞǀĞ ŇŽŽĚ ƉƌŽƚĞĐƟŽŶ ůĞǀĞůƐĨŽƌƚŚĞϭϬͲLJĞĂƌƐƚŽƌŵ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ111 4 &ŝŐƵƌĞϰͲϭϵWƌŽƉŽƐĞĚ^ƚŽƌŵƌĂŝŶ/ŵƉƌŽǀĞŵĞŶƚƐ ^ŽƵƌĐĞ͗&ƵƐĐŽĞ͕ϮϬϭϳ 112 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ113 4 dŚĞŝƚLJŚĂƐƉŽůŝĐŝĞƐŝŶƉůĂĐĞƚŽĂĚĚƌĞƐƐƚŚĞ ĚĞǀĞůŽƉŵĞŶƚ ŽĨ ǀĂĐĂŶƚ ƉĂƌĐĞůƐ ǁŝƚŚŝŶ ƚŚĞ ^W ĂƌĞĂ͘ dŚĞ ƌĞƋƵŝƌĞŵĞŶƚƐ ƚLJƉŝĐĂůůLJ ůŝŵŝƚ ƚŚĞ ĂŵŽƵŶƚ ŽĨŇŽǁĨƌŽŵĂƉƌŽũĞĐƚƐŝƚĞŝŶĂƉƌŽƉŽƐĞĚĐŽŶĚŝƟŽŶ ƚŽŵĂƚĐŚĞdžŝƐƟŶŐĐŽŶĚŝƟŽŶŇŽǁ͘dŚĞƐĞƉŽůŝĐŝĞƐĂƌĞ ĐŽŶƐŝƐƚĞŶƚǁŝƚŚKWƵďůŝĐtŽƌŬƐƌĞƋƵŝƌĞŵĞŶƚƐǁŝƚŚŝŶ ƚŚŝƐĂƌĞĂ͘DŝƟŐĂƟŽŶŽĨŇŽǁŝƐƚLJƉŝĐĂůůLJĚŽŶĞƚŚƌŽƵŐŚ ƚŚĞŝŵƉůĞŵĞŶƚĂƟŽŶŽĨĚĞƚĞŶƟŽŶƐLJƐƚĞŵƐĂƐƐŽĐŝĂƚĞĚ ǁŝƚŚƉƌŽũĞĐƚƐƚŚĂƚĚĞǀĞůŽƉǀĂĐĂŶƚůĂŶĚ͘ /ŶŽƌĚĞƌƚŽŚĞůƉƉƌĞǀĞŶƚůŽŶŐͲƚĞƌŵǁĂƚĞƌƋƵĂůŝƚLJ ŝŵƉĂĐƚƐ ĂƐƐŽĐŝĂƚĞĚ ǁŝƚŚ ůĂŶĚ ƵƐĞ ĐŚĂŶŐĞƐ ĂŶĚ ƚŽ ĂĚŚĞƌĞƚŽƚŚĞƌĞƋƵŝƌĞŵĞŶƚƐŽĨƚŚĞŝƚLJŽĨŶĂŚĞŝŵ >ŽĐĂů /ŵƉůĞŵĞŶƚĂƟŽŶ WůĂŶ ;>/WͿ͕ K ƌĂŝŶĂŐĞ ƌĞĂ DĂŶĂŐĞŵĞŶƚ WůĂŶ ;DWͿ͕ ĂŶĚ &ŽƵƌƚŚͲ dĞƌŵ DƵŶŝĐŝƉĂů ^ĞƉĂƌĂƚĞ ^ƚŽƌŵ ^ĞǁĞƌ ^LJƐƚĞŵƐ ;D^ϰͿ ƉĞƌŵŝƚ͕ ŶĞǁ ĚĞǀĞůŽƉŵĞŶƚ ĂŶĚ ƐŝŐŶŝĮĐĂŶƚ ƌĞĚĞǀĞůŽƉŵĞŶƚ ƉƌŽũĞĐƚƐ ŵƵƐƚ ŝŶĐŽƌƉŽƌĂƚĞ >Žǁ /ŵƉĂĐƚ ĞǀĞůŽƉŵĞŶƚ ;>/Ϳ ĞƐƚ DĂŶĂŐĞŵĞŶƚ WƌĂĐƟĐĞƐ;DWƐͿƚŽĂĚĚƌĞƐƐƉŽƐƚͲĐŽŶƐƚƌƵĐƟŽŶƐƚŽƌŵ ǁĂƚĞƌƌƵŶŽīŵĂŶĂŐĞŵĞŶƚ͘ƐƐƉĞĐŝĮĞĚŝŶƚŚĞϮϬϭϯ dĞĐŚŶŝĐĂů'ƵŝĚĂŶĐĞŽĐƵŵĞŶƚ;d'Ϳ͕DWƐŵƵƐƚďĞ ĂďůĞƚŽŝŶĮůƚƌĂƚĞ͕ŚĂƌǀĞƐƚĂŶĚƌĞƵƐĞĂŶĚͬŽƌďŝŽƚƌĞĂƚ ƚŚĞǀŽůƵŵĞͬŇŽǁƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚƚŚĞϴϱƚŚƉĞƌĐĞŶƟůĞ ƐƚŽƌŵĞǀĞŶƚ͘/ŶĮůƚƌĂƟŽŶƐLJƐƚĞŵƐĂƌĞƚŚĞĮƌƐƚƉƌŝŽƌŝƚLJ ƚLJƉĞŽĨDWŽƉƟŽŶĂƐƚŚĞLJƉƌŽǀŝĚĞĨŽƌĨƵůůƌĞƚĞŶƟŽŶ ŽĨƚŚĞǁĂƚĞƌƋƵĂůŝƚLJǀŽůƵŵĞĂŶĚĐĂŶĂůƐŽĐŽŶƚƌŝďƵƚĞ ƚŽŐƌŽƵŶĚǁĂƚĞƌƌĞĐŚĂƌŐĞŝŶƐŽŵĞĂƌĞĂƐ͘dŚĞƐĞĐŽŶĚ ƉƌŝŽƌŝƚLJDWŝƐĐĂƉƚƵƌŝŶŐĂŶĚƌĞƵƐŝŶŐ;͞ŚĂƌǀĞƐƚĂŶĚ ƌĞƵƐĞ͟Ϳ ƐƚŽƌŵǁĂƚĞƌ ŽŶͲƐŝƚĞ ĨŽƌ ĞŝƚŚĞƌ ůĂŶĚƐĐĂƉĞ ŝƌƌŝŐĂƟŽŶŽƌƚŽŝůĞƚŇƵƐŚŝŶŐ͘,ĂƌǀĞƐƚĂŶĚƌĞƵƐĞDWƐ ĂƌĞĂůƐŽĨƵůůƌĞƚĞŶƟŽŶDWƐƚŚĂƚƉƌŽǀŝĚĞĂĚĚŝƟŽŶĂů ǁĂƚĞƌ ĐŽŶƐĞƌǀĂƟŽŶ ďĞŶĞĮƚƐ͘ WƌŽũĞĐƚƐ ƚŚĂƚ ŚĂǀĞ ĚĞŵŽŶƐƚƌĂƚĞĚƚŚĞLJĐĂŶŶŽƚŝŶĮůƚƌĂƚĞĂŶĚͬŽƌŚĂƌǀĞƐƚ ĂŶĚƌĞƵƐĞϭϬϬƉĞƌĐĞŶƚŽĨƚŚĞǁĂƚĞƌƋƵĂůŝƚLJǀŽůƵŵĞ ŵĂLJŵĂŶĂŐĞƚŚĞƌĞŵĂŝŶŝŶŐǀŽůƵŵĞƚŚƌŽƵŐŚƚŚĞƵƐĞ ŽĨ ďŝŽĮůƚƌĂƟŽŶ DWƐ ǁŚŝĐŚ ƚƌĞĂƚ ƐƚŽƌŵǁĂƚĞƌ ĂŶĚ ƌĞůĞĂƐĞŝƚďĂĐŬŝŶƚŽƚŚĞƐƚŽƌŵĚƌĂŝŶƐLJƐƚĞŵ͘ ŌĞƌƌĞǀŝĞǁŽĨƐŝƚĞĐŽŶĚŝƟŽŶƐǁŝƚŚŝŶƚŚĞ^WĂƌĞĂ͕ ŶĞǁ ƉƌŽũĞĐƚƐ ĂŶĚ ƌĞĚĞǀĞůŽƉŵĞŶƚƐ ǁŝůů ůŝŬĞůLJ ďĞ ĂďůĞƚŽĨĞĂƐŝďůLJŝŶĮůƚƌĂƚĞƐƚŽƌŵǁĂƚĞƌƌƵŶŽīĂƐƚŚĞ ĞŶƟƌĞ^ƉĞĐŝĮĐWůĂŶďŽƵŶĚĂƌLJŝƐŝŶdLJƉĞƐŽŝůƐǁŚŝĐŚ ƚLJƉŝĐĂůůLJŚĂǀĞŚŝŐŚŝŶĮůƚƌĂƟŽŶƌĂƚĞƐ͘ƉŽƌƟŽŶŽĨƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ ďŽƵŶĚĂƌLJ ŚĂƐ ƐŚĂůůŽǁ ŐƌŽƵŶĚǁĂƚĞƌ ;ϲͲϭϬ ĨĞĞƚ ďĞůŽǁ ŐƌŽƵŶĚ ƐƵƌĨĂĐĞͿ ǁŚŝĐŚ ŵĂLJ ůŝŵŝƚ ƚŚĞŝŵƉůĞŵĞŶƚĂƟŽŶŽĨŝŶĮůƚƌĂƟŽŶDWƐƚŚĂƚŚĂǀĞĂ ĚĞĞƉĞƌĨŽŽƚƉƌŝŶƚ͘/ŶƚŚĞĞǀĞŶƚŝŶĮůƚƌĂƟŽŶŝƐĚĞĞŵĞĚ ŝŶĨĞĂƐŝďůĞďLJƐŝƚĞͲƐƉĞĐŝĮĐƉĞƌĐŽůĂƟŽŶƚĞƐƚƐ͕ŚĂƌǀĞƐƚ ĂŶĚ ƌĞƵƐĞ DWƐ ŵĂLJ ƉƌŽǀĞ ĨĞĂƐŝďůĞ ĨŽƌ ƉƌŽũĞĐƚƐ ǁŝƚŚ ŚŝŐŚ ůĂŶĚƐĐĂƉŝŶŐ ĂŶĚͬŽƌ ƚŽŝůĞƚ ŇƵƐŚŝŶŐ ǁĂƚĞƌ ĚĞŵĂŶĚƐ͘ĞĐĂƵƐĞƚŚĞŝƚLJŝƐĐƵƌƌĞŶƚůLJŶŽƚƌĞĐĞŝǀŝŶŐ ĂŶLJ ƌĞĐLJĐůĞĚ ǁĂƚĞƌ ĨƌŽŵ ƚŚĞ 'ƌĞĞŶ ĐƌĞƐ WƌŽũĞĐƚ ĨƌŽŵ ƚŚĞ 'ƌŽƵŶĚǁĂƚĞƌ ZĞƉůĞŶŝƐŚŵĞŶƚ ^LJƐƚĞŵ ŝŶ &ŽƵŶƚĂŝŶ sĂůůĞLJ ;ƉƵƌƉůĞ ƉŝƉĞ ƐLJƐƚĞŵͿ͕ ŚĂƌǀĞƐƚ ĂŶĚ ƌĞƵƐĞDWƐǁŝůůƉƌŽǀŝĚĞƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂǁŝƚŚ ƚŚĞƉŽƚĞŶƟĂůƚŽƐĂƟƐĨLJďŽƚŚD^ϰƌĞƋƵŝƌĞŵĞŶƚƐĨŽƌ ǁĂƚĞƌ ƋƵĂůŝƚLJ ĂŶĚ ƚŽ ƉƌŽǀŝĚĞ ĂŶ ĂĚĚŝƟŽŶĂů ƐŽƵƌĐĞ ŽĨǁĂƚĞƌƐƵƉƉůLJ͘&ŽƌĂƌĞĂƐƚŚĂƚĐĂŶŶŽƚŝŶĮůƚƌĂƚĞŽƌ ƵƟůŝnjĞ ŚĂƌǀĞƐƚ ĂŶĚ ƌĞƵƐĞ ƐLJƐƚĞŵƐ͕ ƉƌŽũĞĐƚƐ ǁŝůů ďĞ ĂďůĞƚŽƚƌĞĂƚƐƚŽƌŵǁĂƚĞƌƚŚƌŽƵŐŚďŝŽĮůƚƌĂƟŽŶDWƐ ƐƵĐŚĂƐǀĞŐĞƚĂƚĞĚƐǁĂůĞƐ͕ďŝŽƌĞƚĞŶƟŽŶďĂƐŝŶƐ͕ĂŶĚ ƉƌŽƉƌŝĞƚĂƌLJƐLJƐƚĞŵƐ͘ 4.7.2 Sewer System dŚĞŝƚLJŽĨŶĂŚĞŝŵŽǁŶƐ͕ŽƉĞƌĂƚĞƐ͕ĂŶĚŵĂŝŶƚĂŝŶƐ ƚŚĞůŽĐĂůƐĂŶŝƚĂƌLJƐĞǁĞƌĐŽůůĞĐƟŽŶĨĂĐŝůŝƟĞƐǁŝƚŚŝŶƚŚĞ ŝƚLJ͘^ĞǁĂŐĞŝƐĐŽůůĞĐƚĞĚďLJŝƚLJĐŽůůĞĐƚŽƌĨĂĐŝůŝƟĞƐ͕ ƚŚĞŶĐŽŶǀĞLJĞĚƚŽƚƌƵŶŬƐĞǁĞƌƐĂŶĚƌĞŐŝŽŶĂůƚƌĞĂƚŵĞŶƚ ĨĂĐŝůŝƟĞƐǁŚŝĐŚĂƌĞďŽƚŚŽǁŶĞĚĂŶĚŽƉĞƌĂƚĞĚďLJƚŚĞ KƌĂŶŐĞ ŽƵŶƚLJ ^ĂŶŝƚĂƟŽŶ ŝƐƚƌŝĐƚ ;K^Ϳ͘ ^ĞǁĞƌ ůŝŶĞƐ ƌĂŶŐĞ ĨƌŽŵ ϴ͟Ͳϭϴ͟ ŝŶ ĚŝĂŵĞƚĞƌ ƚŚƌŽƵŐŚŽƵƚ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ ďŽƵŶĚĂƌLJ ĂŶĚ ƵůƟŵĂƚĞůLJ ƟĞ ŝŶƚŽ ĚŽǁŶƐƚƌĞĂŵK^ƚƌƵŶŬůŝŶĞƐŽƵƚƐŝĚĞƚŚĞďŽƵŶĚĂƌLJ ĂůŽŶŐtĞƐƚĞƌŶǀĞŶƵĞ͘ ŚĂŶŐĞƐ ŝŶ ůĂŶĚ ƵƐĞƐ ĐŽƵůĚ ƉŽƚĞŶƟĂůůLJ ŝŵƉĂĐƚ ƚŚĞ ĞdžŝƐƟŶŐƐĞǁĞƌƐLJƐƚĞŵ͘dŽĞƐƟŵĂƚĞƐĞǁĞƌŇŽǁƐŝŶƚŚĞ ĞdžŝƐƟŶŐĂŶĚƉƌŽƉŽƐĞĚĐŽŶĚŝƟŽŶ͕ƐĞǁĞƌŐĞŶĞƌĂƟŽŶ ĨĂĐƚŽƌƐǁĞƌĞƉƌŽǀŝĚĞĚŝŶƚŚĞŽŵďŝŶĞĚtĞƐƚŶĂŚĞŝŵ ƌĞĂDĂƐƚĞƌWůĂŶŽĨ^ĂŶŝƚĂƌLJ^ĞǁĞƌƐ;DW^^Ϳ͘hŶĚĞƌ ƚŚĞƉƌŽƉŽƐĞĚĐŽŶĚŝƟŽŶ͕ƐĞǁĞƌŇŽǁƐǁŝůůŝŶĐƌĞĂƐĞĚƵĞ ƚŽƚŚĞŝŶĐƌĞĂƐĞŝŶŵƵůƟͲĨĂŵŝůLJƌĞƐŝĚĞŶƟĂů͕ĐŽŵŵĞƌĐŝĂů ĂŶĚŵŝdžĞĚůĂŶĚƵƐĞƐ͘ƚŽƚĂůŝŶĐƌĞĂƐĞŽĨϯ͕ϰϵϲhƐĂŶĚ ĂƉƉƌŽdžŝŵĂƚĞůLJϵϵϬ͕ϲϭϵƐĨŽĨŶŽŶͲƌĞƐŝĚĞŶƟĂůƵƐĞƐĂƌĞ ƉƌŽƉŽƐĞĚƵŶĚĞƌƚŚĞƵůƟŵĂƚĞďƵŝůĚŽƵƚĐŽŶĚŝƟŽŶ͘dŚĞ ^WĂƌĞĂŚĂƐďĞĞŶďƌŽŬĞŶƵƉŝŶƚŽƚŚĞĂƌĞĂƐŶŽƌƚŚ ĂŶĚƐŽƵƚŚŽĨĂƌďŽŶƌĞĞŬƚŽĚĞƚĞƌŵŝŶĞĂŶLJƉŽƚĞŶƟĂů ŝŵƉĂĐƚƐƚŽƚŚĞŝƚLJĂŶĚK^ƐĞǁĞƌƐLJƐƚĞŵƐ͘ &ƵůůŝŵƉůĞŵĞŶƚĂƟŽŶŽĨƚŚĞůĂŶĚƵƐĞĐŚĂŶŐĞƐŚĂƐƚŚĞ ƉŽƚĞŶƟĂů ƚŽ ŝŶĐƌĞĂƐĞ ƐĞǁĞƌ ŇŽǁƐ ďLJ Ϭ͘ϲϰ ŵŝůůŝŽŶ ŐĂůůŽŶƐƉĞƌĚĂLJ;D'ͿǁŝƚŚŝŶƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͘ ƉƉƌŽdžŝŵĂƚĞůLJϱϴƉĞƌĐĞŶƚŽĨƚŚĞŝŶĐƌĞĂƐĞŝŶƐĞǁĞƌ ŇŽǁƐǁŝůůŽĐĐƵƌŝŶƚŚĞĂƌĞĂƐŶŽƌƚŚŽĨĂƌďŽŶƌĞĞŬ ŚĂŶŶĞů͘^ĞǁĞƌŇŽǁƐǁŝůůƵůƟŵĂƚĞůLJĐŽŶŶĞĐƚŝŶƚŽ K^ƐĞǁĞƌƚƌƵŶŬůŝŶĞƐůŽĐĂƚĞĚƚŽƚŚĞǁĞƐƚĂŶĚ ƐŽƵƚŚŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶďŽƵŶĚĂƌLJ͘dŚĞƉƌŽƉŽƐĞĚ ŝŶĐƌĞĂƐĞƐŝŶƐĞǁĞƌŇŽǁƐĐŽƵůĚĂůƐŽŝŵƉĂĐƚƚŚĞK^ ƐĞǁĞƌƚƌƵŶŬůŝŶĞƐĚŽǁŶƐƚƌĞĂŵŽĨƚŚĞ^ƉĞĐŝĮĐWůĂŶ ďŽƵŶĚĂƌLJ͘ 114 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚĞŝƚLJŽĨŶĂŚĞŝŵĐŽŶƚƌĂĐƚĞĚǁŝƚŚ',ƚŽƐƚƵĚLJ ĂŶLJƉŽƚĞŶƟĂůŝŵƉĂĐƚƐƚŽƚŚĞƐĞǁĞƌƐLJƐƚĞŵƌĞƐƵůƟŶŐ ĨƌŽŵ ƚŚĞ ^W͘ /Ŷ ƚŚĞ ĞdžŝƐƟŶŐ ĐŽŶĚŝƟŽŶ ĂŶĚ ƚŚĞ ďƵŝůĚŽƵƚ ĐŽŶĚŝƟŽŶ ƵŶĚĞƌ ƚŚĞ ϮϬϬϰ 'ĞŶĞƌĂů WůĂŶ͕ ŶŽ ĚĞĮĐŝĞŶĐŝĞƐ ƚŽ ƚŚĞ ƐĞǁĞƌ ƐLJƐƚĞŵ ǁĞƌĞ ĨŽƵŶĚ͘ ŽŵƉĂƌĞĚƚŽƚŚĞ'ĞŶĞƌĂůWůĂŶ͕ƚŚĞƉƌŽƉŽƐĞĚůĂŶĚ ƵƐĞƐƵŶĚĞƌƚŚĞ^ƉĞĐŝĮĐWůĂŶǁŝůůďĞŵŽĚŝĮĞĚĨƌŽŵ ŽŵŵĞƌĐŝĂů͕ KĸĐĞ͕ ĂŶĚ ZĞƐŝĚĞŶƟĂů ;>ŽǁͲDĞĚŝƵŵ Žƌ ŽƌƌŝĚŽƌͿ ƚŽ DŝdžĞĚͲhƐĞ ;DĞĚŝƵŵ Žƌ ,ŝŐŚͿ ĂŶĚ ZĞƐŝĚĞŶƟĂů DĞĚŝƵŵ͘ dŚĞƐĞ ĐŚĂŶŐĞƐ ŝŶ ůĂŶĚ ƵƐĞ ŐĞŶĞƌĂůůLJŝŶĐƌĞĂƐĞƚŚĞĚĞǀĞůŽƉŵĞŶƚĚĞŶƐŝƚLJǁŚŝĐŚ ĐŽƵůĚƌĞƐƵůƚŝŶŵŽƌĞƐĞǁĞƌŇŽǁƐ͘ŌĞƌƌƵŶŶŝŶŐ',͛Ɛ ƐĞǁĞƌŵŽĚĞůƵŶĚĞƌƚŚĞ^ƉĞĐŝĮĐWůĂŶĐŽŶĚŝƟŽŶ͕ƚŚĞ ŵŽĚĞůĞĚƌĞƐƵůƚƐƐŚŽǁƚŚĂƚƚŚĞƌĞĂƌĞƚǁŽĚĞĮĐŝĞŶƚ ĂƌĞĂƐŽĨƚŚĞƐĞǁĞƌƐLJƐƚĞŵǁŝƚŚŝŶƚŚĞ^ƉĞĐŝĮĐWůĂŶ ďŽƵŶĚĂƌLJ͘dŚĞƚǁŽĚĞĮĐŝĞŶƚƐĞŐŵĞŶƚƐĂƌĞƐŝƚƵĂƚĞĚ ďĞƚǁĞĞŶ DĂŶŚŽůĞƐ ^tϭϬϰϮϬ ĂŶĚ ^tϭϬϰϮϭ ĂŶĚ DĂŶŚŽůĞƐ^tϭϬϰϮϭĂŶĚ^tϭϬϰϮϮ͕ǁŚŝĐŚĂƌĞůŽĐĂƚĞĚ ŽŶƚŚĞǁĞƐƚƐŝĚĞŽĨĞĂĐŚŽƵůĞǀĂƌĚŶŽƌƚŚŽĨĂůů ZŽĂĚĂƐƐŚŽǁŶŽŶ&ŝŐƵƌĞϰͲϮϬ͕WƌŽƉŽƐĞĚ ^ĞǁĞƌ /ŵƉƌŽǀĞŵĞŶƚƐ͘ dŚĞŝƚLJŚĂƐĂƉƌŽĐĞĚƵƌĞŝŶƉůĂĐĞƚŽĂĚĚƌĞƐƐĚĞĮĐŝĞŶƚ ƐĞǁĞƌƐĞŐŵĞŶƚƐĚŽǁŶƐƚƌĞĂŵŽĨŶĞǁĚĞǀĞůŽƉŵĞŶƚƐ͘ dŚĞƉƌŽĐĞĚƵƌĞŝŶĐůƵĚĞƐƵƉĚĂƟŶŐƚŚĞDW^^ƚŽŝŶĐůƵĚĞ ƚŚĞ ĚĞĮĐŝĞŶƚ ƐĞǁĞƌ ƐĞŐŵĞŶƚƐ ĂŶĚ ƚŚĞ ĂƐƐŽĐŝĂƚĞĚ ĐŽƐƚƐƚŽŝŵƉƌŽǀĞƚŚĞƐĞŐŵĞŶƚƐ͘KŶĐĞƚŚĞƐĞƐĞŐŵĞŶƚƐ ĂŶĚƚŚĞŝƌƌĞƐƉĞĐƟǀĞĐŽƐƚƐŚĂǀĞďĞĞŶĂĚĚĞĚŝŶƚŽƚŚĞ DW^^͕ƐĞǁĞƌŝŵƉĂĐƚĨĞĞƐĐĂŶďĞĂĚũƵƐƚĞĚƚŽĂĐĐŽƵŶƚ ĨŽƌ ƚŚĞ ŶĞĐĞƐƐĂƌLJ ŝŵƉƌŽǀĞŵĞŶƚƐ͘ dŚĞƐĞ ĂĚũƵƐƚĞĚ ŝŵƉĂĐƚĨĞĞƐǁŝůůƚŚĞŶĂƉƉůLJƚŽĐŽƐƚƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚ ŶĞǁ ĚĞǀĞůŽƉŵĞŶƚƐ ĂŶĚ ƌĞĚĞǀĞůŽƉŵĞŶƚ ƉƌŽũĞĐƚƐ ǁŝƚŚŝŶƚŚĞƐĞǁĞƌƐĞƌǀŝĐĞĂƌĞĂ͕ŝŶĐůƵĚŝŶŐƚŚĞ^W ĂƌĞĂ͕ĂŶĚǁŝůůďĞƉĂŝĚĨŽƌďLJƚŚĞĚĞǀĞůŽƉĞƌƐ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ115 4 &ŝŐƵƌĞϰͲϮϬWƌŽƉŽƐĞĚ^ĞǁĞƌ/ŵƉƌŽǀĞŵĞŶƚƐ ^ŽƵƌĐĞ͗&ƵƐĐŽĞ͕ϮϬϭϳ 116 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ117 4 4.7.3 Water System dŚĞŝƚLJ͛ƐǁĂƚĞƌƐƵƉƉůLJĐŽŵĞƐĨƌŽŵĂĐŽŵďŝŶĂƟŽŶ ŽĨŝŵƉŽƌƚĞĚǁĂƚĞƌ͕ůŽĐĂůŐƌŽƵŶĚǁĂƚĞƌĂŶĚƌĞĐLJĐůĞĚ ǁĂƚĞƌƚŽƐĂƟƐĨLJǁĂƚĞƌĚĞŵĂŶĚƐ͘dŚĞŝƚLJƉƵƌĐŚĂƐĞƐ ƚŚĞƐĞǁĂƚĞƌƐƵƉƉůŝĞƐĨƌŽŵƚŚĞDĞƚƌŽƉŽůŝƚĂŶtĂƚĞƌ ŝƐƚƌŝĐƚ ŽĨ ^ŽƵƚŚĞƌŶ ĂůŝĨŽƌŶŝĂ ;DĞƚƌŽƉŽůŝƚĂŶͿ ĂŶĚ ƚŚĞKƌĂŶŐĞŽƵŶƚLJtĂƚĞƌŝƐƚƌŝĐƚ;KtͿ͘dŚĞŝƚLJ ŝƐ Ă ŵĞŵďĞƌ ĂŐĞŶĐLJ ŽĨ DĞƚƌŽƉŽůŝƚĂŶ ĂŶĚ ƌĞĐĞŝǀĞƐ ŝŵƉŽƌƚĞĚǁĂƚĞƌĨƌŽŵƚŚĞ^ƚĂƚĞtĂƚĞƌWƌŽũĞĐƚĂŶĚƚŚĞ ŽůŽƌĂĚŽZŝǀĞƌƵŶĚĞƌĂŐƌĞĞŵĞŶƚƐǁŝƚŚDĞƚƌŽƉŽůŝƚĂŶ͘ dŚĞKtŵĂŶĂŐĞƐƚŚĞKƌĂŶŐĞŽƵŶƚLJ'ƌŽƵŶĚǁĂƚĞƌ ĂƐŝŶ;KĂƐŝŶͿĂŶĚƉƌŽǀŝĚĞƐŐƌŽƵŶĚǁĂƚĞƌƌĞƐŽƵƌĐĞƐ ƚŽƚŚĞŝƚLJ͘ hŶĚĞƌƚŚĞĞdžŝƐƟŶŐĐŽŶĚŝƟŽŶƐ͕ƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂŝƐ ƐĞƌǀĞĚďLJĂǀĂƌŝĞƚLJŽĨϮ͟ƚŽϭϰ͟ǁĂƚĞƌůŝŶĞƐ;Ğ͘Ő͕͘ĐĂƐƚ ŝƌŽŶ͕ĚƵĐƟůĞŝƌŽŶ͕ĂŶĚĂƐďĞƐƚŽƐĐĞŵĞŶƚͿůŽĐĂƚĞĚŝŶƚŚĞ ƉƵďůŝĐƐƚƌĞĞƚƐ͕ĂůůĞLJǁĂLJƐ͕ƉĂƌŬƐ͕ĂŶĚŝŶƚĞƌŶĂůƐƚƌĞĞƚƐ͘ ŚĂŶŐĞƐŝŶůĂŶĚƵƐĞƐĐŽƵůĚĂůƐŽƉŽƚĞŶƟĂůůLJŝŵƉĂĐƚƚŚĞ ĞdžŝƐƟŶŐǁĂƚĞƌƐLJƐƚĞŵ͘dŽĞƐƟŵĂƚĞǁĂƚĞƌĚĞŵĂŶĚƐŝŶ ƚŚĞĞdžŝƐƟŶŐĂŶĚƉƌŽƉŽƐĞĚĐŽŶĚŝƟŽŶ͕ǁĂƚĞƌĚĞŵĂŶĚ ĨĂĐƚŽƌƐĨƌŽŵƚŚĞŝƚLJŽĨŶĂŚĞŝŵϮϬϬϵĚŵŝŶŝƐƚƌĂƟǀĞ WƌŽĐĞĚƵƌĞƐĂŶĚ'ƵŝĚĞůŝŶĞƐĨŽƌtĂƚĞƌ/ŵƉƌŽǀĞŵĞŶƚƐ WůĂŶƐʹĞǀĞůŽƉŵĞŶƚWƌŽũĞĐƚƐǁĞƌĞƵƟůŝnjĞĚ͘hŶĚĞƌ ƚŚĞƉƌŽƉŽƐĞĚĐŽŶĚŝƟŽŶ͕ǁĂƚĞƌĚĞŵĂŶĚƐǁŝůůŝŶĐƌĞĂƐĞ ĚƵĞƚŽƚŚĞŝŶĐƌĞĂƐĞŝŶŵƵůƟͲĨĂŵŝůLJƌĞƐŝĚĞŶƟĂů͕ ĐŽŵŵĞƌĐŝĂůĂŶĚŵŝdžĞĚůĂŶĚƵƐĞƐ͘ &ƵůůŝŵƉůĞŵĞŶƚĂƟŽŶŽĨƚŚĞůĂŶĚƵƐĞĐŚĂŶŐĞƐŚĂƐƚŚĞ ƉŽƚĞŶƟĂůƚŽŝŶĐƌĞĂƐĞǁĂƚĞƌĚĞŵĂŶĚďLJϭ͘ϬϱD' ǁŝƚŚŝŶƚŚĞ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͘>ŝŬĞŝŶĐƌĞĂƐĞƐŝŶƐĞǁĞƌ ŇŽǁƐ͕ ǁĂƚĞƌ ĚĞŵĂŶĚƐ ĂƌĞ ĂůƐŽ ƉƌŝŵĂƌŝůLJ ĨŽĐƵƐĞĚ ǁŝƚŚŝŶƚŚĞƌĞƐŝĚĞŶƟĂůůĂŶĚƵƐĞƐŝŶĐůƵĚŝŶŐƌĞƐŝĚĞŶƟĂů ůŽǁͲŵĞĚŝƵŵ͕ ŵĞĚŝƵŵ͕ ŵŝdžĞĚͲƵƐĞ ŵĞĚŝƵŵ ĂŶĚ ŵŝdžĞĚͲƵƐĞŚŝŐŚůĂŶĚƵƐĞƐ͘ dŚĞ ŝƚLJ ŽĨ ŶĂŚĞŝŵ WƵďůŝĐ hƟůŝƟĞƐ ĞƉĂƌƚŵĞŶƚ͛Ɛ &ŝǀĞͲzĞĂƌtĂƚĞƌ^LJƐƚĞŵWůĂŶƉƌŽǀŝĚĞƐĂĐŽŽƌĚŝŶĂƚĞĚ ĂƉƉƌŽĂĐŚ ĨŽƌ ŝĚĞŶƟĨLJŝŶŐ ĂŶĚ ƉƌŝŽƌŝƟnjŝŶŐ ƚŚŽƐĞ ƉƌŽũĞĐƚƐ ĂŶĚ ƉƌŽŐƌĂŵƐ ƌĞƋƵŝƌĞĚ ƚŽ ĞŶƐƵƌĞ ŝƚLJ ŽĨ ŶĂŚĞŝŵǁĂƚĞƌƵƟůŝƚLJĐƵƐƚŽŵĞƌƐĐŽŶƟŶƵĂůůLJƌĞĐĞŝǀĞ ĂƌĞůŝĂďůĞƐƵƉƉůLJŽĨŚŝŐŚͲƋƵĂůŝƚLJǁĂƚĞƌĂƚƚŚĞůŽǁĞƐƚ ƉŽƐƐŝďůĞĐŽƐƚ͘dŚĞƌĞĂƌĞĐƵƌƌĞŶƚůLJƚŚƌĞĞƉƌŽũĞĐƚƐůŝƐƚĞĚ ŝŶƚŚĞtĂƚĞƌ^LJƐƚĞŵWůĂŶƚŚĂƚĂƌĞǁŝƚŚŝŶŽƌĂĚũĂĐĞŶƚ ƚŽƚŚĞ^ƉĞĐŝĮĐWůĂŶďŽƵŶĚĂƌLJ͘dŚĞŽŶĞƉƌŽũĞĐƚƚŚĂƚŝƐ ǁŝƚŚŝŶƚŚĞ^ƉĞĐŝĮĐWůĂŶďŽƵŶĚĂƌLJŝƐĂϭϮ͟ǁĂƚĞƌůŝŶĞ ƌĞƉůĂĐĞŵĞŶƚŽŶ>ŝŶĐŽůŶǀĞŶƵĞǁŚŝĐŚŝƐƐĐŚĞĚƵůĞĚƚŽ ďĞĐŽŶƐƚƌƵĐƚĞĚŝŶƚŚĞϮϬϭϳͬϮϬϭϴĐĂůĞŶĚĂƌLJĞĂƌ͘&ŝŐƵƌĞ ϰͲϮϭ͕WƌŽƉŽƐĞĚtĂƚĞƌ^LJƐƚĞŵ/ŵƉƌŽǀĞŵĞŶƚƐ͕ŝĚĞŶƟĮĞƐ ƚŚĞůŝŶĞƐƚŚĂƚƌĞƋƵŝƌĞƵƉͲƐŝnjŝŶŐŽƌŝŵƉƌŽǀĞŵĞŶƚƐƚŽ ĂĐĐŽŵŵŽĚĂƚĞĂĚĚŝƟŽŶĂůǁĂƚĞƌĚĞŵĂŶĚ͘dŚĞůŽŶŐͲ ƌĂŶŐĞǁĂƚĞƌƐLJƐƚĞŵƉůĂŶŶŝŶŐƐƚƵĚLJƉƌŽǀŝĚĞƐƚŚĞďĂƐŝƐ ĨŽƌƚŚĞtĂƚĞƌ^LJƐƚĞŵWůĂŶ͘ĂĐŚLJĞĂƌ͕ǁŝƚŚŝŶƉƵƚĨƌŽŵ ƚŚĞWƵďůŝĐtŽƌŬƐ͕ŶǀŝƌŽŶŵĞŶƚĂů^ĞƌǀŝĐĞƐ͕ĂŶĚtĂƚĞƌ &ŝĞůĚͬKƉĞƌĂƟŽŶƐ ƐƚĂī͕ ŝŵƉƌŽǀĞŵĞŶƚƐ ŝĚĞŶƟĮĞĚ ŝŶ ƚŚĞtĂƚĞƌ^LJƐƚĞŵWůĂŶĂƌĞƌĞͲĞǀĂůƵĂƚĞĚĂŶĚƚŚĞŝƌ ƉƌŝŽƌŝƟĞƐ ĂĚũƵƐƚĞĚ ƚŽ ƚŚĞ ůĂƚĞƐƚ ǁĂƚĞƌ ĚĞŵĂŶĚ ƉƌŽũĞĐƟŽŶƐ͕ ĚĞǀĞůŽƉŵĞŶƚ ƚƌĞŶĚƐ͕ ĂŶĚ ƌĞƉůĂĐĞŵĞŶƚ ŶĞĞĚƐ͘ dŚĞƌĞĨŽƌĞ͕ ƉƌŽƉŽƐĞĚ ŝŶĐƌĞĂƐĞƐ ŝŶ ǁĂƚĞƌ ĚĞŵĂŶĚƐ ĂƐƐŽĐŝĂƚĞĚ ǁŝƚŚ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ ǁŝůů ďĞ ĂĐĐŽƵŶƚĞĚ ĨŽƌ ŝŶ ĨƵƚƵƌĞ ƉůĂŶŶŝŶŐ ƐƚƵĚŝĞƐ͕ ĂŶĚ ĂŶLJ ŝŵƉĂĐƚƐ ĂƐƐŽĐŝĂƚĞĚ ƚŽ ǁĂƚĞƌ ŝŶĨƌĂƐƚƌƵĐƚƵƌĞ ǁŝůů ďĞ ĂĚĚƌĞƐƐĞĚ ĂŶĚƉůĂĐĞĚ ŽŶ ƚŚĞĐĂƉŝƚĂů ŝŵƉƌŽǀĞŵĞŶƚ ƉůĂŶ͘ 118 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞůĞŌŝŶƚĞŶƟŽŶĂůůLJďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ119 4 Figure 4-21 Proposed Water System Improvements ^ŽƵƌĐĞ͗&ƵƐĐŽĞ͕ϮϬϭϳ 120 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞůĞŌŝŶƚĞŶƟŽŶĂůůLJďůĂŶŬ͘ HEARING DRAFT OCTOBER 2018 | d,W>Eͮ121 4 4.8 POLICE AND FIRE SERVICE dŚĞŝƚLJŽĨŶĂŚĞŝŵŝƐĂĨƵůůƐĞƌǀŝĐĞĐŝƚLJ͕ƉƌŽǀŝĚŝŶŐ ďĂƐŝĐƐĞƌǀŝĐĞƐƐƵĐŚĂƐǁĂƚĞƌ͕ƉŽǁĞƌ͕ůŝďƌĂƌLJ͕ƉŽůŝĐĞ ĂŶĚĮƌĞƉƌŽƚĞĐƟŽŶǁŝƚŚŽƵƚĐŽŶƚƌĂĐƟŶŐŽƵƚƚŽƚŚŝƌĚͲ ƉĂƌƚLJĂŐĞŶĐŝĞƐ͘dĂdžĞƐ͕ĨĞĞƐ͕ĂŶĚŐĞŶĞƌĂůĨƵŶĚƐƉĂLJ ĨŽƌƚŚĞƐĞƐĞƌǀŝĐĞƐĂŶĚƐƵƉƉŽƌƟŶŐŝƚLJƐƚĂīƉŽƐŝƟŽŶƐ͘ /ŶĐƌĞĂƐĞĚĐƌŝŵĞĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌŚĂƐŵĂĚĞƉŽůŝĐĞ ĂŶĚĮƌĞƐĞƌǀŝĐĞƐĞƐƉĞĐŝĂůůLJŝŵƉŽƌƚĂŶƚĨŽƌƚŚĞ^W ĂƌĞĂ͘ 4.8.1 Fire ŶĂŚĞŝŵ&ŝƌĞĞƉĂƌƚŵĞŶƚ^ƚĂƟŽŶηϭϭŝƐůŽĐĂƚĞĚĂůŽŶŐ KƌĂŶŐĞǀĞŶƵĞĂĚũĂĐĞŶƚƚŽdǁŝůĂZĞŝĚWĂƌŬǁŝƚŚŝŶƚŚĞ ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͘/ŶĂĚĚŝƟŽŶƚŽĂdLJƉĞϭĞŶŐŝŶĞƚŚŝƐ ƐƚĂƟŽŶ ĂůƐŽ ŚŽƵƐĞƐ ƚǁŽ ƌĞƐĞƌǀĞ ĞŶŐŝŶĞƐ͕ Ă ƚƌĂŝůŽƌ͕ ĂŶĚĂŶĂŵďƵůĂŶĐĞ͘dŚƌŽƵŐŚŽƵƚƚŚĞŽƵƚƌĞĂĐŚƉŚĂƐĞ ŽĨƚŚĞƉƌŽũĞĐƚĐŽŵŵƵŶŝƚLJŵĞŵďĞƌƐͶƌĞƐŝĚĞŶƚƐĂŶĚ ůŽĐĂůďƵƐŝŶĞƐƐŽǁŶĞƌƐͬŽƉĞƌĂƚŽƌƐͶĞdžƉƌĞƐƐĞĚĐŽŶĐĞƌŶ ƌĞŐĂƌĚŝŶŐŚĞĂůƚŚĂŶĚƐĂĨĞƚLJ͕ƚŚĞĮƌĞƐƚĂƟŽŶĂŶĚƚŚĞ ƉƌĞƐĞŶĐĞŽĨƉƵďůŝĐƐĂĨĞƚLJŽĸĐŝĂůƐĂƌĞŝŵƉŽƌƚĂŶƚĨŽƌ ƚŚĞ^WĂƌĞĂ͘ 4.8.2 Police WŽůŝĐĞƉƌĞƐĞŶĐĞŝƐĂůƐŽĐƌŝƟĐĂůĨŽƌŝŵƉƌŽǀŝŶŐŚĞĂůƚŚ ĂŶĚƐĂĨĞƚLJĨŽƌƚŚĞ^WĂƌĞĂ͘dŚĞŶĂŚĞŝŵWŽůŝĐĞ ĞƉĂƌƚŵĞŶƚ;WͿƌĞĐĞŶƚůLJƌĞͲŽƉĞŶĞĚƚŚĞƐƵďƐƚĂƟŽŶ ĂĚũĂĐĞŶƚƚŽƚŚĞtzŽŶĞĂĐŚŽƵůĞǀĂƌĚ͘dŚĞƉŽůŝĐĞ ĐŽƵŶƚĞƌĂƚƚŚĞtzŝƐŽƉĞŶĚƵƌŝŶŐƚŚĞĚĂLJdƵĞƐĚĂLJ ƚŚƌŽƵŐŚ^ĂƚƵƌĚĂLJ͘dŚŝƐůŽĐĂƟŽŶŽīĞƌƐƚŚĞĐŽŵŵƵŶŝƚLJ ĂŶŽƉƉŽƌƚƵŶŝƚLJƚŽŝŶƚĞƌĂĐƚǁŝƚŚWŽĸĐĞƌƐĂŶĚĂůƐŽ ĂīŽƌĚƐƚŚĞĚĞƉĂƌƚŵĞŶƚĂƉĞƌŵĂŶĞŶƚůŽĐĂƟŽŶƚŽǁŽƌŬ ĨƌŽŵƚŽĐŽŵďĂƚƚŚĞĂƌĞĂΖƐŚŝŐŚĐƌŝŵĞƌĂƚĞ͘dŚĞWŝƐ ĂŵĞŵďĞƌŽĨƚŚĞKƌĂŶŐĞŽƵŶƚLJ,ƵŵĂŶdƌĂĸĐŬŝŶŐ dĂƐŬ&ŽƌĐĞǁŚŝĐŚŝƐƉƌŽͲĂĐƟǀĞůLJǁŽƌŬŝŶŐƚŽĂĚĚƌĞƐƐ ƉƌŽƐƟƚƵƟŽŶ ŝŶ ƚŚĞ ĂƌĞĂ͘ W ŝƐ ĂůƐŽ ǁŽƌŬŝŶŐ ǁŝƚŚ ƚŚĞ ŝƚLJΖƐ ŽŵŵƵŶŝƚLJ ^ĞƌǀŝĐĞ ĚĞƉĂƌƚŵĞŶƚ ƚŽ ŽīĞƌ ƐƵƉƉŽƌƚƚŽƚŚĞĂƌĞĂΖƐŚŽŵĞůĞƐƐƉŽƉƵůĂƟŽŶƚŚĂƚŽŌĞŶ ĐŽŶŐƌĞŐĂƚĞƐŝŶdǁŝůĂZĞŝĚĂŶĚ^ĐŚǁĞŝƚnjĞƌƉĂƌŬƐ͘ &ŝƌĞ^ƚĂƟŽŶηϭϭŝƐůŽĐĂƚĞĚĂĚũĂĐĞŶƚƚŽdǁŝůĂZĞŝĚWĂƌŬǁŝƚŚĂĐĐĞƐƐĨƌŽŵ KƌĂŶŐĞǀĞŶƵĞ͘ ŶĂŚĞŝŵWŽůŝĐĞĞƉĂƌƚŵĞŶƚŚĂƐĂƐƵďƐƚĂƟŽŶŝŶƚŚĞtĞƐƚŶĂŚĞŝŵzŽƵƚŚ ĞŶƚĞƌƚŽďĞƩĞƌƐĞƌǀĞƚŚĞůŽĐĂůĐŽŵŵƵŶŝƚLJ͘ 122 ͮd,W>Eͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞůĞŌŝŶƚĞŶƟŽŶĂůůLJďůĂŶŬ͘ CHAPTER 5: ADMINISTRATION + IMPLEMENTATION 124 ͮD/Eн/DW>DEdd/KEͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ ,Z/E'Z&dKdKZϮϬϭϴͮD/Eн/DW>DEdd/KE | 125 5 5.1 SPECIFIC PLAN ADOPTION dŚĞŝƚLJŽƵŶĐŝůĂĚŽƉƚĞĚƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐ WůĂŶ ŝŶ ĂĐĐŽƌĚĂŶĐĞ ǁŝƚŚ ƚŚĞ ƉƌŽǀŝƐŝŽŶƐ ŽĨ ŚĂƉƚĞƌ ϭϴ͘ϳϮ;^ƉĞĐŝĮĐWůĂŶƐͿŽĨƚŚĞŶĂŚĞŝŵDƵŶŝĐŝƉĂůŽĚĞ ;DͿ͘ 5.2 SPECIFIC PLAN AMENDMENTS ^ƉĞĐŝĮĐWůĂŶŵĞŶĚŵĞŶƚŵĂLJďĞŝŶŝƟĂƚĞĚďLJƚŚĞ ŝƚLJ ŽƵŶĐŝů͕ ƚŚĞ WůĂŶŶŝŶŐ ŽŵŵŝƐƐŝŽŶ͕ ŝƚLJ ƐƚĂī͕ Žƌ ƵƉŽŶ ĂƉƉůŝĐĂƟŽŶ ďLJ ĂŶ ŽǁŶĞƌ Žƌ ĚĞƐŝŐŶĂƚĞĚ ƌĞƉƌĞƐĞŶƚĂƟǀĞŽĨƉƌŽƉĞƌƚLJůŽĐĂƚĞĚǁŝƚŚŝŶƚŚĞ^ƉĞĐŝĮĐ WůĂŶĂƌĞĂ͘ŶŵĞŶĚŵĞŶƚƚŽƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ ^ƉĞĐŝĮĐWůĂŶǁŝůůďĞƉƌŽĐĞƐƐĞĚƉƵƌƐƵĂŶƚƚŽŚĂƉƚĞƌ ϭϴ͘ϳϮ;^ƉĞĐŝĮĐWůĂŶƐͿŽĨƚŚĞD͘ŶĂŵĞŶĚŵĞŶƚŝƐ ƌĞƋƵŝƌĞĚŝĨĂŶLJŽĨƚŚĞĨŽůůŽǁŝŶŐĂƉƉůŝĞƐ͗ ͘ƉƌŽƉŽƐĞĚĐŚĂŶŐĞŝŶƚŚĞnjŽŶŝŶŐĚĞƐŝŐŶĂƟŽŶ ŽĨƚŚĞƉƌŽƉĞƌƚLJ͖ĂŶĚͬŽƌ ͘ ƉƌŽƉŽƐĞĚĐŚĂŶŐĞŝŶƚŚĞďŽƵŶĚĂƌLJŽĨƚŚĞ ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͘ 5.3 SPECIFIC PLAN ADJUSTMENTS  ƉƌŽƉŽƐĞĚ ŵŽĚŝĮĐĂƟŽŶ ƚŽ ĂŶLJ njŽŶŝŶŐ ĂŶĚ ĚĞǀĞůŽƉŵĞŶƚƐƚĂŶĚĂƌĚĂĚŽƉƚĞĚŝŶĐŽŶŶĞĐƟŽŶǁŝƚŚ ĂƐƉĞĐŝĮĐƉůĂŶǁŝůůďĞƉƌŽĐĞƐƐĞĚĂƐĂ^ƉĞĐŝĮĐWůĂŶ ĚũƵƐƚŵĞŶƚ͘ ^ƉĞĐŝĮĐ WůĂŶ ĚũƵƐƚŵĞŶƚƐ ŵĂLJ ďĞ ŝŶŝƟĂƚĞĚďLJƚŚĞŝƚLJŽƵŶĐŝů͕ƚŚĞWůĂŶŶŝŶŐŽŵŵŝƐƐŝŽŶ͕ ŝƚLJƐƚĂī͕ŽƌƵƉŽŶĂƉƉůŝĐĂƟŽŶďLJĂƉƌŽƉĞƌƚLJŽǁŶĞƌŽƌ ĚĞƐŝŐŶĂƚĞĚƌĞƉƌĞƐĞŶƚĂƟǀĞŽĨƉƌŽƉĞƌƚLJůŽĐĂƚĞĚǁŝƚŚŝŶ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ ĂƌĞĂ͕ ƉƵƌƐƵĂŶƚ ƚŽ ŚĂƉƚĞƌ ϭϴ͘ϳϮ ;^ƉĞĐŝĮĐWůĂŶƐͿ͘ 5.4 ZONING AND DEVELOPMENT STANDARDS /Ŷ ĂĐĐŽƌĚĂŶĐĞ ǁŝƚŚ ŚĂƉƚĞƌ ϭϴ͘ϳϮ ;^ƉĞĐŝĮĐ WůĂŶƐͿ ƚŚĞ njŽŶŝŶŐ ĂŶĚ ĚĞǀĞůŽƉŵĞŶƚ ƐƚĂŶĚĂƌĚƐ ƉƌĞƉĂƌĞĚ ĨŽƌƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶǁĞƌĞĂĚŽƉƚĞĚ ďLJĂŶŽƌĚŝŶĂŶĐĞƐĞƉĂƌĂƚĞĨƌŽŵĂŶLJĂĐƟŽŶƚĂŬĞŶƚŽ ĂĚŽƉƚƚŚĞ^ƉĞĐŝĮĐWůĂŶ͘dŚĞnjŽŶŝŶŐĂŶĚĚĞǀĞůŽƉŵĞŶƚ ƐƚĂŶĚĂƌĚƐĨŽƌƚŚŝƐ^ƉĞĐŝĮĐWůĂŶĂƌĞĐŽĚŝĮĞĚŝŶŚĂƉƚĞƌ ϭϴ͘ϭϮϮ;ĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶEŽ͘ϮϬϭϳͲϬϭͿŽĨ ƚŚĞD͘&ŽƌƌĞĨĞƌĞŶĐĞ͕ƚŚĞnjŽŶŝŶŐĂŶĚĚĞǀĞůŽƉŵĞŶƚ ƐƚĂŶĚĂƌĚƐ ĂƌĞ ŝŶĐůƵĚĞĚ ĂƐ ĂŶ ĂƉƉĞŶĚŝdž ƚŽ ƚŚŝƐ ĚŽĐƵŵĞŶƚ͘ 5 ADMINISTRATION + IMPLEMENTATION 5.5 ADMINISTRATIVE ADJUSTMENTS ĚŵŝŶŝƐƚƌĂƟǀĞ ĂĚũƵƐƚŵĞŶƚƐ ĂƌĞ ůŝŵŝƚĞĚ ĚĞǀŝĂƟŽŶƐ ĨƌŽŵƐƉĞĐŝĮĞĚƐŝƚĞĚĞǀĞůŽƉŵĞŶƚƐƚĂŶĚĂƌĚƐ͕ƚŚĂƚĚŽ ŶŽƚƌĞƋƵŝƌĞĂ^ƉĞĐŝĮĐWůĂŶŵĞŶĚŵĞŶƚ͘dŚĞWůĂŶŶŝŶŐ ĂŶĚ ƵŝůĚŝŶŐ ŝƌĞĐƚŽƌ ŵĂLJ ŐƌĂŶƚ ĂŶ ĚŵŝŶŝƐƚƌĂƟǀĞ ĚũƵƐƚŵĞŶƚ͕ĂĐĐŽƌĚŝŶŐƚŽƚŚĞƉƌŽĐĞĚƵƌĞƐĐŽŶƚĂŝŶĞĚ ŝŶŚĂƉƚĞƌϭϴ͘ϲϮ͘ϬϰϬ;ĚŵŝŶŝƐƚƌĂƟǀĞĚũƵƐƚŵĞŶƚƐͿ͘ 5.6 INTERPRETATION /Ĩ ĂŵďŝŐƵŝƚLJ ĂƌŝƐĞƐ ĐŽŶĐĞƌŶŝŶŐ ƚŚĞ ŵĞĂŶŝŶŐ Žƌ ĂƉƉƌŽƉƌŝĂƚĞ ĂƉƉůŝĐĂƟŽŶ ŽĨ ƚŚĞ ƉƌŽǀŝƐŝŽŶƐ ŽĨ ƚŚĞ ^ƉĞĐŝĮĐWůĂŶ͕ƚŚĞWůĂŶŶŝŶŐĂŶĚƵŝůĚŝŶŐŝƌĞĐƚŽƌŚĂƐ ƚŚĞĂƵƚŚŽƌŝƚLJƚŽŵĂŬĞĂŶŝŶƚĞƌƉƌĞƚĂƟŽŶ͘/ŶƐŽĚŽŝŶŐ͕ ƚŚĞŝƌĞĐƚŽƌƐŚĂůůĐŽŶƐŝĚĞƌƚŚĞĨŽůůŽǁŝŶŐĨĂĐƚŽƌƐĂŶĚ ĚŽĐƵŵĞŶƚĂƉƉůŝĐĂďůĞĮŶĚŝŶŐƐĂĐĐŽƌĚŝŶŐůLJ͗ ͘dŚĞĐĂƐĞŝƐƐŝŵŝůĂƌƚŽƉƌĞǀŝŽƵƐŝŶƚĞƌƉƌĞƚĂƟŽŶƐ ŽĨƐŝŵŝůĂƌƉƌŽǀŝƐŝŽŶƐ͖ ͘ dŚĞŝŶƚĞƌƉƌĞƚĂƟŽŶƌĞƐƉŽŶĚƐƐĂƟƐĨĂĐƚŽƌŝůLJƚŽ ƚŚĞǀŝƐŝŽŶ͕ŝŶƚĞŶƚĂŶĚƉƵƌƉŽƐĞŽĨƚŚĞ^ƉĞĐŝĮĐ WůĂŶ͖ ͘dŚĞƌĞƐƵůƟŶŐƉƌŽũĞĐƚŝƐĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞ 'ĞŶĞƌĂůWůĂŶ͖ĂŶĚ ͘dŚĞ ĚĞĐŝƐŝŽŶ ĐŽŶƐƟƚƵƚĞƐ ƐŽƵŶĚ ƉƌĞĐĞĚĞŶƚ ĨŽƌŽƚŚĞƌƐŝŵŝůĂƌƐŝƚƵĂƟŽŶƐ͘ 5.7 NONCONFORMITIES ŚĂƉƚĞƌ ϭϴ͘ϱϲ ;EŽŶĐŽŶĨŽƌŵŝƟĞƐͿ ŽĨ ƚŚĞ D ƐŚĂůů ĂƉƉůLJƚŽĂŶLJŶŽŶĐŽŶĨŽƌŵŝŶŐůŽƚƐ͕ďƵŝůĚŝŶŐƐĂŶĚƵƐĞƐ ǁŝƚŚŝŶƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƉĞĐŝĮĐWůĂŶ͘ 126 ͮD/Eн/DW>DEdd/KEͮ,Z/E'Z&dKdKZϮϬϭϴ 5.8 PROJECT APPROVAL PROCESS dŚĞĂĚŵŝŶŝƐƚƌĂƟǀĞĂŶĚĚŝƐĐƌĞƟŽŶĂƌLJƌĞǀŝĞǁƉƌŽĐĞƐƐ ŝƐŝůůƵƐƚƌĂƚĞĚŝŶ&ŝŐƵƌĞϱͲϭ͕WƌŽũĞĐƚƉƉƌŽǀĂůWƌŽĐĞƐƐ ŚĂƌƚ͘ WƌŝŽƌ ƚŽ ƐƵďŵŝƫŶŐ Ă ĨŽƌŵĂů ĂƉƉůŝĐĂƟŽŶ ƚŽ ƚŚĞ WůĂŶŶŝŶŐĂŶĚƵŝůĚŝŶŐĞƉĂƌƚŵĞŶƚ͕ĂŶĂƉƉůŝĐĂŶƚŵĂLJ ĐŚŽŽƐĞƚŽƚĂŬĞĂĚǀĂŶƚĂŐĞŽĨƚŚĞŝƚLJ͛ƐŽŶĐĞƉƚƵĂů ĞǀĞůŽƉŵĞŶƚZĞǀŝĞǁƉƌŽĐĞƐƐǁŚŝĐŚŝƐĚĞƐŝŐŶĞĚƚŽ ŝĚĞŶƟĨLJ ŝƐƐƵĞƐ ŽĨ ĐŽŶĐĞƌŶ ƌĞůĂƚĞĚ ƚŽ Ă ƉƌŽƉŽƐĞĚ ƉƌŽũĞĐƚ͕ƚŽƌĞǀŝĞǁƉƌĞůŝŵŝŶĂƌLJƉůĂŶƐĨŽƌĐŽŵƉůŝĂŶĐĞ ǁŝƚŚ ĂƉƉůŝĐĂďůĞ ŽƌĚŝŶĂŶĐĞƐ ĂŶĚ ƐƚĂŶĚĂƌĚƐ͕ ĂŶĚ ƚŽ ĚĞƚĞƌŵŝŶĞĂŶĂƉƉůŝĐĂƟŽŶ͛ƐĂĚĞƋƵĂĐLJĨŽƌƐƵďŵŝƩĂů͘ 5.8.1 Administrative Review ĞǀĞůŽƉŵĞŶƚĂƉƉůŝĐĂƟŽŶƐĨŽƌƉƌŽũĞĐƚƐƚŚĂƚĐŽŵƉůLJ ǁŝƚŚ ƚŚĞ ĞĂĐŚ ŽƵůĞǀĂƌĚ ^ƉĞĐŝĮĐ WůĂŶ ĂŶĚ ƚŚĞ ŽŶŝŶŐĂŶĚĞǀĞůŽƉŵĞŶƚ^ƚĂŶĚĂƌĚƐ;ŚĂƉƚĞƌϭϴ͘ϭϮϮ ŽĨƚŚĞDͿĂƌĞĞůŝŐŝďůĞĨŽƌĂĚŵŝŶŝƐƚƌĂƟǀĞƌĞǀŝĞǁ͘ ^ƵĐŚ ƉƌŽũĞĐƚƐ ƐŚĂůů ďĞ ƌĞƋƵŝƌĞĚ ƚŽ ƉƌŽĐĞƐƐ Ă &ŝŶĂů WůĂŶ ĂƉƉůŝĐĂƟŽŶ͕ ƉƵƌƐƵĂŶƚ ƚŽ ŚĂƉƚĞƌ ϭϴ͘ϳϬ͘ϬϰϬ ;&ŝŶĂů ^ŝƚĞ WůĂŶ ZĞǀŝĞǁ WƌŽĐĞƐƐͿ͘ dŚĞ WůĂŶŶŝŶŐ ĂŶĚ ƵŝůĚŝŶŐ ŝƌĞĐƚŽƌ ƐŚĂůů ŚĂǀĞ ĂƉƉƌŽǀĂů ĂƵƚŚŽƌŝƚLJ͕ ĂŶĚƚŚĞĚĞĐŝƐŝŽŶŵĂLJďĞĂƉƉĞĂůĞĚƚŽƚŚĞWůĂŶŶŝŶŐ ŽŵŵŝƐƐŝŽŶ͘dŚĞWůĂŶŶŝŶŐĂŶĚƵŝůĚŝŶŐŝƌĞĐƚŽƌĂůƐŽ ŚĂƐƚŚĞĚŝƐĐƌĞƟŽŶƚŽƌĞĨĞƌƚŚĞĂƉƉůŝĐĂƟŽŶƚŽWůĂŶŶŝŶŐ ŽŵŵŝƐƐŝŽŶ͘ 5.8.2 Discretionary Review ZĞƋƵĞƐƚƐĨŽƌĚŝƐĐƌĞƟŽŶĂƌLJƌĞǀŝĞǁŝŶĐůƵĚĞĂƉƉůŝĐĂƟŽŶƐ ƐƵďũĞĐƚƚŽWůĂŶŶŝŶŐŽŵŵŝƐƐŝŽŶĂŶĚͬŽƌŝƚLJŽƵŶĐŝů ƌĞǀŝĞǁ͘ůůƌĞƋƵĞƐƚƐĨŽƌĚŝƐĐƌĞƟŽŶĂƌLJĂƉƉƌŽǀĂůƐŚĂůů ĂůƐŽďĞƐƵďũĞĐƚƚŽĂƉƉƌŽǀĂůĨŽƌĂ&ŝŶĂůWůĂŶĂƉƉůŝĐĂƟŽŶ͕ ƉƵƌƐƵĂŶƚƚŽŚĂƉƚĞƌϭϴ͘ϳϬ͘ϬϰϬ;&ŝŶĂů^ŝƚĞWůĂŶZĞǀŝĞǁ WƌŽĐĞƐƐͿ͘ZĞƋƵĞƐƚƐĨŽƌĂŽŶĚŝƟŽŶĂůhƐĞWĞƌŵŝƚƐŚĂůů ďĞŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚŚĂƉƚĞƌϭϴ͘ϲϲŽĨĂŶĚD͘ ZĞƋƵĞƐƚƐĨŽƌĂsĂƌŝĂŶĐĞƐŚĂůůďĞŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚ ŚĂƉƚĞƌϭϴ͘ϳϰŽĨƚŚĞD͘ZĞƋƵĞƐƚƐĨŽƌĂĞŶƐŝƚLJ ŽŶƵƐƐŚĂůůďĞŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚŚĂƉƚĞƌϭϴ͘ϱϮŽĨ ƚŚĞD͘ 5.9 SEVERABILITY /ĨĂĐŽƵƌƚĚĞƚĞƌŵŝŶĞƐƚŚĂƚĂƉƌŽǀŝƐŝŽŶŽĨƚŚŝƐ^ƉĞĐŝĮĐ WůĂŶŝƐƵŶĐŽŶƐƟƚƵƟŽŶĂůŽƌŝŶǀĂůŝĚ͕ƚŚĂƚĚĞƚĞƌŵŝŶĂƟŽŶ ƐŚĂůů ŶŽƚ ĂīĞĐƚ ƚŚĞ ǀĂůŝĚŝƚLJ ŽĨ ŽƚŚĞƌ ƉĂƌƚƐ ŽĨ ƚŚŝƐ ĚŽĐƵŵĞŶƚ͘ 5.10 SPECIFIC PLAN ENVIRONMENTAL IMPACT REPORT AND MITIGATION MONITORING WƵƌƐƵĂŶƚ ƚŽ WƵďůŝĐ ZĞƐŽƵƌĐĞƐ ŽĚĞ ;WZͿ ^ĞĐƟŽŶ ϮϭϬϴϭ͘ϲ͕ Ă ƐƵŵŵĂƌLJ ŽĨ ƚŚĞ ĐŽŶĚŝƟŽŶƐ ŽĨ ƉƌŽũĞĐƚ ĂƉƉƌŽǀĂů ƐŚĂůů ďĞ ƉƌĞƉĂƌĞĚ ƚŽ ŵŝƟŐĂƚĞ Žƌ ĂǀŽŝĚ ƐŝŐŶŝĮĐĂŶƚ ĞīĞĐƚƐ ŽŶ ƚŚĞ ĞŶǀŝƌŽŶŵĞŶƚ͘ dŚĞ ŶǀŝƌŽŶŵĞŶƚĂů /ŵƉĂĐƚ ZĞƉŽƌƚ ;/ZͿ ĨŽƌ ƚŚĞ ĞĂĐŚ ŽƵůĞǀĂƌĚ ^ƉĞĐŝĮĐ WůĂŶ ŝŶĐůƵĚĞƐ Ă DŝƟŐĂƟŽŶ DŽŶŝƚŽƌŝŶŐ ĂŶĚ ZĞƉŽƌƟŶŐ WƌŽŐƌĂŵ͕ ƉƉĞŶĚŝdž / ŽĨ ƚŚĞ /Z͘ ŚĂƉƚĞƌ ϭ͕ /ŶƚƌŽĚƵĐƟŽŶ͕ ^ĞĐƟŽŶ ϭ͘ϲ͕ ŶǀŝƌŽŶŵĞŶƚĂů ůĞĂƌĂŶĐĞ͕ ĂůƐŽ ĚŝƐĐƵƐƐĞƐ ƚŚĞ Y ĚŽĐƵŵĞŶƚĂƟŽŶ͕ ƟĞƌŝŶŐ ĂŶĚ ƐƚƌĞĂŵůŝŶĞĚ ƌĞǀŝĞǁ ĂƐƐŽĐŝĂƚĞĚǁŝƚŚƚŚĞƉƌŽŐƌĂŵ/ZƚŚĂƚǁĂƐĐŽŵƉůĞƚĞĚ ĨŽƌ ƚŚĞ ^ƉĞĐŝĮĐ WůĂŶ͘ dŝĞƌŝŶŐ ĨŽƌ ĨƵƚƵƌĞ ƉƌŽũĞĐƚƐ ĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞ^WĂŶĚ/ZǁŝůůďĞƐƵďũĞĐƚƚŽƚŚĞ ƌĞƋƵŝƌĞŵĞŶƚƐŽƵƚůŝŶĞĚŝŶƚŚĞϮϬϭϱY'ƵŝĚĞůŝŶĞƐΑ ϭϱϭϴϯ͕ŽƌĞƋƵŝǀĂůĞŶƚƵƉĚĂƚĞĚƐĞĐƟŽŶ͘ ,Z/E'Z&dKdKZϮϬϭϴͮD/Eн/DW>DEdd/KE | 127 5 ADMINISTRATIVE DISCRETIONARY Figure 5-1 Project Approval Process Chart APPLICANT W>EE/E'Θh/>/E'WZdDEd DETERMINES APPLICABLE REVIEW PROCESS X ĞǀĞůŽƉŵĞŶƚ ƉƌŽũĞĐƚŝŶ ĐŽŵƉůŝĂŶĐĞǁŝƚŚ ^ƉĞĐŝĮĐWůĂŶ X ĚŵŝŶŝƐƚƌĂƟǀĞ ĚũƵƐƚŵĞŶƚ X /ŶƚĞƌƉƌĞƚĂƟŽŶ X &ŝŶĂůWůĂŶZĞǀŝĞǁ X sĂƌŝĂŶĐĞ X ŽŶĚŝƟŽŶĂůhƐĞWĞƌŵŝƚ X ĞŶƐŝƚLJŽŶƵƐ X WĂƌĐĞůDĂƉ͕dƌĂĐƚDĂƉ X ^ƉĞĐŝĮĐWůĂŶŵĞŶĚŵĞŶƚ X ŽŶŝŶŐŽĚĞŵĞŶĚŵĞŶƚ X ŽŶŝŶŐZĞĐůĂƐƐŝĮĐĂƟŽŶ X 'ĞŶĞƌĂůWůĂŶŵĞŶĚŵĞŶƚ X &ŝŶĂůWůĂŶZĞǀŝĞǁ WWZKs> AUTHORITY PLANNING Θh/>/E' DIRECTOR WWZKs> AUTHORITY PLANNING Θh/>/E' DIRECTOR WWZKs> AUTHORITY PLANNING COMMISSION W>EE/E' COMMISSION WWZKs> AUTHORITY /dzKhE/> ƉƉĞĂůƚŽ WůĂŶŶŝŶŐ ŽŵŵŝƐƐŝŽŶ ƉƉĞĂůƚŽ ŝƚLJŽƵŶĐŝů 128 ͮD/Eн/DW>DEdd/KEͮ,Z/E'Z&dKdKZϮϬϭϴ 5.11 IMPLEMENTATION dŚĞ ^W ŝĚĞŶƟĮĞƐ ƚŚĞ ůŽĐĂƟŽŶ ĂŶĚ ƚLJƉĞ ŽĨ ĚĞƐŝƌĞĚ ĚĞǀĞůŽƉŵĞŶƚ ĂŶĚ ŝŵƉƌŽǀĞŵĞŶƚƐ ǁŝƚŚŝŶ ƚŚĞ ƐƚƵĚLJ ĂƌĞĂ͘ /ŵƉůĞŵĞŶƚĂƟŽŶ ŽĨ ƚŚĞ WůĂŶ ǁŝůů ƌĞƋƵŝƌĞĂĐŽŶĐĞƌƚĞĚƉƵďůŝĐͬƉƌŝǀĂƚĞĞīŽƌƚƚŽĂĐŚŝĞǀĞ ƚŚĞ ĚĞǀĞůŽƉŵĞŶƚ ĞŶǀŝƐŝŽŶĞĚ͕ ĂŶĚ ƚŚĞ ŶĞĐĞƐƐĂƌLJ ŝŵƉƌŽǀĞŵĞŶƚƐƚŽƚŚĞƉƵďůŝĐƌĞĂůŵĂŶĚŝŶĨƌĂƐƚƌƵĐƚƵƌĞ ƐĞƌǀŝŶŐƚŚĞĂƌĞĂ͘dŚŝƐƐĞĐƟŽŶĂĚĚƌĞƐƐĞƐĂŶĞĐŽŶŽŵŝĐ ĚĞǀĞůŽƉŵĞŶƚƐƚƌĂƚĞŐLJĨŽƌƚŚĞƐƚƵĚLJĂƌĞĂ͕ĞdžƉĞĐƚĞĚ ƉŚĂƐŝŶŐŽĨĚĞǀĞůŽƉŵĞŶƚĂŶĚŝŵƉƌŽǀĞŵĞŶƚƐ͕ĂƐǁĞůů ĂƐ ŽƚŚĞƌ ĂĐƟŽŶƐ ƚŽ ŝŶĐĞŶƟǀŝnjĞ ƋƵĂůŝƚLJ͕ ƐƵƐƚĂŝŶĂďůĞ ĚĞǀĞůŽƉŵĞŶƚ͘ 5.11.1 Economic Development Strategy dŚĞ ƉƵƌƉŽƐĞ ŽĨ ƚŚĞ ^W ĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ ^ƚƌĂƚĞŐLJ ;^Ϳ ŝƐ ƚŽ ŚĞůƉ ƚŚĞ ŝƚLJ ĂŶĚ ůŽĐĂů ƐƚĂŬĞŚŽůĚĞƌƐ ƚŽ ŝŵƉůĞŵĞŶƚ ƐƚƌĂƚĞŐŝĞƐ ƚŚĂƚ ĐĂŶ ĞŶŚĂŶĐĞ ĞĂĐŚ ŽƵůĞǀĂƌĚΖƐ ŽŶŐŽŝŶŐ ĞĐŽŶŽŵŝĐ ǀŝƚĂůŝƚLJ͘dŚĞ^ǁĂƐŝŶĨŽƌŵĞĚďLJƚŚĞĞdžŝƐƟŶŐ ĐŽŶĚŝƟŽŶƐ ĚŝƐĐƵƐƐĞĚ ŝŶ ŚĂƉƚĞƌ Ϯ͕ ŽŶƚĞdžƚ͕ ĂŶĚ ŚĂǀĞ ďĞĞŶ ĚĞƐŝŐŶĞĚ ƚŽ ŚĞůƉ ƚŚĞ ĐŽƌƌŝĚŽƌ ĂĐŚŝĞǀĞ ŝƚƐĨƵůůĞĐŽŶŽŵŝĐĚĞǀĞůŽƉŵĞŶƚƉŽƚĞŶƟĂů͘^ƚƌĂƚĞŐŝĞƐ ŝŶĐůƵĚĞ ƚŚĞ ĐŽŶƟŶƵĞĚ ŝŵƉůĞŵĞŶƚĂƟŽŶ ŽĨ ŬĞLJ ĞĐŽŶŽŵŝĐ ĚĞǀĞůŽƉŵĞŶƚ ƉŽůŝĐŝĞƐ ĂůƌĞĂĚLJ ŝŶ ƉůĂĐĞ͕ ĂŶĚĚĞǀĞůŽƉŝŶŐŶĞǁƐƚƌĂƚĞŐŝĞƐƚĂŝůŽƌĞĚƚŽŵĞĞƚƚŚĞ ƐƉĞĐŝĮĐ ĞŵƉůŽLJŵĞŶƚ ĂŶĚ ŝŶĚƵƐƚƌLJ ŶĞĞĚƐ ŝŶ tĞƐƚ ŶĂŚĞŝŵ͘ ĚĚŝƟŽŶĂůůLJ͕ ƚŚĞ ŝƚLJ ŵĂLJ ĐŽŶƐŝĚĞƌ ŶĞǁ ƐƚƌĂƚĞŐŝĞƐĂŶĚŝŶŝƟĂƟǀĞƐƐƉĞĐŝĮĐĂůůLJƚĂƌŐĞƚĞĚƚŽƚŚĞ ^ƉĞĐŝĮĐWůĂŶĂƌĞĂ͕ƐƵĐŚĂƐŝŵƉƌŽǀŝŶŐƉƵďůŝĐƐĂĨĞƚLJĂŶĚ ĮŶĂŶĐŝŶŐŶĞǁŝŶĨƌĂƐƚƌƵĐƚƵƌĞŝŵƉƌŽǀĞŵĞŶƚƐƚŽĂƩƌĂĐƚ ŶĞǁĚĞǀĞůŽƉŵĞŶƚ͕ƐƉƵƌŶĞǁďƵƐŝŶĞƐƐĨŽƌŵĂƟŽŶ͕ĂŶĚ ƐƚƌĞŶŐƚŚĞŶƚŚĞĞĐŽŶŽŵŝĐǀŝƚĂůŝƚLJŽĨtĞƐƚŶĂŚĞŝŵ͘ ^^ƚƌĂƚĞŐŝĞƐĂŶĚ/ŶŝƟĂƟǀĞƐ  ŶƵŵďĞƌ ŽĨ ĞĐŽŶŽŵŝĐ ĚĞǀĞůŽƉŵĞŶƚ ƉŽůŝĐŝĞƐ ĂŶĚ ƐƚƌĂƚĞŐŝĞƐĂƌĞĂůƌĞĂĚLJŝŶƉůĂĐĞĨŽƌtĞƐƚŶĂŚĞŝŵ͕ ŝŶĐůƵĚŝŶŐ ƚŚĞ ŶĂŚĞŝŵ͛Ɛ tŽƌŬĨŽƌĐĞ ĞǀĞůŽƉŵĞŶƚ ŽĂƌĚ͛Ɛ >ŽĐĂů WůĂŶ͕ ƚŚĞ ĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ ůĞŵĞŶƚŽĨŶĂŚĞŝŵ͛Ɛ'ĞŶĞƌĂůWůĂŶ͕ĂƐǁĞůůĂƐƚŚĞ KƌĂŶŐĞŽƵŶƚLJŽŶƐŽůŝĚĂƚĞĚĐŽŶŽŵŝĐĞǀĞůŽƉŵĞŶƚ ^ƚƌĂƚĞŐLJ͘ ĞĂĐŚŽƵůĞǀĂƌĚ/ŶŝƟĂƟǀĞ dŚĞ ŶĂŚĞŝŵ ŝƚLJ ŽƵŶĐŝů ƉĂƐƐĞĚ Ă ƌĞƐŽůƵƟŽŶ ŝŶ ^ĞƉƚĞŵďĞƌ ϮϬϭϲ ĞƐƚĂďůŝƐŚŝŶŐ ƚŚĞ ĞĂĐŚ ŽƵůĞǀĂƌĚ /ŶŝƟĂƟǀĞ͕ ǁŚŝĐŚ ĂŝŵƐ ƚŽ ĂĐĐĞůĞƌĂƚĞ ƌĞǀŝƚĂůŝnjĂƟŽŶ ďLJ ĞŶĐŽƵƌĂŐŝŶŐ ƚŚĞ ĂƩƌĂĐƟŽŶ ĂŶĚ ƌĞƚĞŶƟŽŶ ŽĨ ͞ƉƌĞĨĞƌƌĞĚƵƐĞƐ͟ĂƐŝĚĞŶƟĮĞĚŝŶƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ ^ƉĞĐŝĮĐWůĂŶ͘ ŽƵŶĐŝů ĂĐƟŽŶƐ ƌĞůĂƚĞĚ ƚŽ ƚŚĞ ĞĂĐŚ ŽƵůĞǀĂƌĚ /ŶŝƟĂƟǀĞŝŶĐůƵĚĞĂƌĂŶŐĞŽĨƚŽŽůƐƚŚĂƚĐŽƵůĚďĞ ĞīĞĐƟǀĞŝŶŚĞůƉŝŶŐtĞƐƚŶĂŚĞŝŵƚĂŬĞƐƚĞƉƐƚŽǁĂƌĚ ƐƚƌĞŶŐƚŚĞŶŝŶŐŝƚƐůŽĐĂůĞĐŽŶŽŵLJ͘dŚĞŽƵŶĐŝůǀŽƚĞĚ ƚŽƐĞůůϮϱͲĂĐƌĞƐŽĨ^ƵĐĐĞƐƐŽƌŐĞŶĐLJͲŽǁŶĞĚ͕ǀĂĐĂŶƚ ůĂŶĚ Ăƚ ĞĂĐŚ ŽƵůĞǀĂƌĚ ĂŶĚ >ŝŶĐŽůŶ ǀĞŶƵĞ ĨŽƌ ĚĞǀĞůŽƉŵĞŶƚĂƐĂŶĞŝŐŚďŽƌŚŽ ŽĚƐŚŽƉƉŝŶŐĐĞŶƚĞƌ͕ǁŝƚŚ ŶĞǁƌĞƚĂŝůĞƌƐ͕ƌĞƐƚĂƵƌĂŶƚƐ͕ĂŶĚĐŽŵŵƵŶŝƚLJĂŵĞŶŝƟĞƐ ;tĞƐƚŐĂƚĞ^ŝƚĞͿ͘dŚĞŽƵŶĐŝůĂůƐŽǀŽƚĞĚƚŽĂĐƋƵŝƌĞϯ͘ϲ ĂĐƌĞƐŽĨůĂŶĚĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚƐŽƵƚŚŽĨ>ŝŶĐŽůŶ ǀĞŶƵĞĨŽƌƚŚĞĨƵƚƵƌĞƐĂůĞĂŶĚĚĞǀĞůŽƉŵĞŶƚĂƐŶĞǁ ŚŽƵƐŝŶŐǁŝƚŚŐƌŽƵŶĚͲŇŽŽƌƌĞƚĂŝůƐƉĂĐĞ͘ ĐŽŶŽŵŝĐĂƐƐŝƐƚĂŶĐĞĨŽƌƉƌĞĨĞƌƌĞĚƉƌŽũĞĐƚƐŝĚĞŶƟĮĞĚ ďLJƚŚĞtĞƐƚŶĂŚĞŝŵĐŽŵŵƵŶŝƚLJŝƐĂŶŽƚŚĞƌŬĞLJ ĂƐƉĞĐƚŽĨƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ/ŶŝƟĂƟǀĞ͘dŚĞĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ&ƵŶĚͶĂƉƌŽƉŽƐĞĚĨƵŶĚŽĨĨƵƚƵƌĞůĂŶĚͲ ƐĂůĞ ƉƌŽĐĞĞĚƐ ĂŶĚ ƉƌŽƉĞƌƚLJ ƚĂdž ŝŶĐƌĞŵĞŶƚͶǁŽƵůĚ ƉƌŽǀŝĚĞŝŶĚĞƉĞŶĚĞŶƚĐŝƚLJĨƵŶĚŝŶŐĨŽƌĞĂĐŚŽƵůĞǀĂƌĚ ŝŵƉƌŽǀĞŵĞŶƚƐ͘ dŚĞ ĞǀĞůŽƉŵĞŶƚ ƐƐŝƐƚĂŶĐĞ ƉƌŽŐƌĂŵ͕ ŵĞĂŶǁŚŝůĞ͕ ǁŽƵůĚ ƉƌŽǀŝĚĞ ŇĞdžŝďŝůŝƚLJ ǁŝƚŚ ƌĞƐƉĞĐƚ ƚŽ ĨĞĞƐ ĂŶĚ ĚĞǀĞůŽƉŵĞŶƚ ƐƚĂŶĚĂƌĚƐ ƚŽ ĞŶĐŽƵƌĂŐĞ ƉƌĞĨĞƌƌĞĚ ĚĞǀĞůŽƉŵĞŶƚĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ͘dŚĞƐĞŝŶĐůƵĚĞ͗ • ĞĨĞƌƌĞĚĚĞǀĞůŽƉĞƌĨĞĞƐƚŚĂƚĂůůŽǁĨŽƌ ƉĂLJŵĞŶƚĂŌĞƌĐŽŶƐƚƌƵĐƟŽŶ • &ůĞdžŝďůĞĚĞǀĞůŽƉŵĞŶƚƐƚĂŶĚĂƌĚƐƚŚĂƚǁŽƵůĚ ĂůůŽǁƉƌŽũĞĐƚƐƚŽǀĂƌLJĨƌŽŵƐĞƚďĂĐŬĂŶĚ ŽƚŚĞƌƌƵůĞƐǁŚĞƌĞƚŚĞƌĞŝƐĞĐŽŶŽŵŝĐĂŶĚ ĐŽŵŵƵŶŝƚLJďĞŶĞĮƚ͘ • ŽŵŵĞƌĐŝĂůƌĞŚĂďŝůŝƚĂƟŽŶůŽĂŶƐĨŽƌĞdžŝƐƟŶŐ͕ ĚĞƐŝƌĞĚĂƌĞĂďƵƐŝŶĞƐƐĞƐ ,Z/E'Z&dKdKZϮϬϭϴͮD/Eн/DW>DEdd/KE | 129 5 tŚŝůĞƐƟůůŝŶƚŚĞĞĂƌůLJƐƚĂŐĞƐ͕ƚŚĞƐĞƚŽŽůƐĐŽƵůĚĂůůďĞ ĞīĞĐƟǀĞŝŶŚĞůƉŝŶŐtĞƐƚŶĂŚĞŝŵƚĂŬĞĂƐƚĞƉĨŽƌǁĂƌĚ ŝŶƐƚƌĞŶŐƚŚĞŶŝŶŐƚŚĞůŽĐĂůĞĐŽŶŽŵLJ͘/ŶĂĚĚŝƟŽŶ͕ƚŚĞ ĞĂĐŚ ŽƵůĞǀĂƌĚ ^ƉĞĐŝĮĐWůĂŶ ŝŶĐůƵĚĞƐ ƉƌŽƉŽƐĞĚ ĞīŽƌƚƐƚŽŝŶĐƌĞĂƐĞŶĞǁďƵƐŝŶĞƐƐĨŽƌŵĂƟŽŶ͘dŚĞŝƚLJ͛Ɛ ƵƐŝŶĞƐƐƐƐŝƐƚĂŶĐĞWƌŽŐƌĂŵ;ŽīĞƌŝŶŐĐŽŵƉĂŶŝĞƐĂ ĚĞĚŝĐĂƚĞĚƵƐŝŶĞƐƐ^ŽůƵƟŽŶƐ^ƉĞĐŝĂůŝƐƚͿĂŶĚĞīŽƌƚƐ ůĞĚďLJƚŚĞŝƚLJΖƐĐŽŶŽŵŝĐĞǀĞůŽƉŵĞŶƚDĂŶĂŐĞƌ;ŝ͘Ğ͕͘ ƚŚĞĨŽƌŵĂƟŽŶŽĨĂŶĞǁĐŽŶŽŵŝĐĞǀĞůŽƉŵĞŶƚdĞĂŵ͕ ďƵƐŝŶĞƐƐǁŽƌŬƐŚŽƉƐ͕ĂŶĚŵĂƌŬĞƟŶŐͿ͕ĐĂŶŚĞůƉŶĞǁ ďƵƐŝŶĞƐƐĞƐĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚůŽĐĂƚĞŝŶŶĂŚĞŝŵ͕ ŐƌŽǁ ĂŶĚ ƉƌŽƐƉĞƌ͘ ĚĚŝƟŽŶĂůůLJ͕ ƚŚĞ ĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ dĞĂŵ ĐĂŶ ĨĂĐŝůŝƚĂƚĞ ďƵƐŝŶĞƐƐ ůŽĐĂƟŽŶ ŽƌĞdžƉĂŶƐŝŽŶƐŝŶƚŽŶĂŚĞŝŵƚŚƌŽƵŐŚĐŽŽƌĚŝŶĂƚĞĚ ŵĞĞƟŶŐƐǁŝƚŚƚŚĞWůĂŶŶŝŶŐĂŶĚƵŝůĚŝŶŐĞƉĂƌƚŵĞŶƚ͕ ƚŚĞ ŽŵŵƵŶŝƚLJ ĂŶĚ ĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ ĞƉĂƌƚŵĞŶƚ͕ ĂŶĚ ŽƚŚĞƌ ŝƚLJ ĚĞƉĂƌƚŵĞŶƚƐ ƚŽ ŐƵŝĚĞ ĂƉƉůŝĐĂŶƚƐƚŚƌŽƵŐŚƚŚĞĂƉƉƌŽǀĂůƉƌŽĐĞƐƐ͘ Workforce Development Board – Local Plan ƵƌƌĞŶƚůLJ͕ ĐŝƚLJǁŝĚĞ ĞĐŽŶŽŵŝĐ ĚĞǀĞůŽƉŵĞŶƚ ĂŶĚ ĞŵƉůŽLJŵĞŶƚ ƐƚƌĂƚĞŐŝĞƐ ĂƌĞ ŐƵŝĚĞĚ ŝŶ ƉĂƌƚ ďLJ ƚŚĞ ŶĂŚĞŝŵ tŽƌŬĨŽƌĐĞ ĞǀĞůŽƉŵĞŶƚ ŽĂƌĚ >ŽĐĂů WůĂŶ;tͿ͘WƵďůŝƐŚĞĚŝŶϮϬϭϳ͕ƚŚŝƐWůĂŶŽƵƚůŝŶĞƐĂ ƐƚƌĂƚĞŐLJϮϬϮϬƚŽĂĐĐŽŵƉůŝƐŚƚŚĞǀŝƐŝŽŶŽĨĂǁŽƌŬĨŽƌĐĞ ĚĞǀĞůŽƉŵĞŶƚ ƐLJƐƚĞŵ ƚŚĂƚ ĂůŝŐŶƐ ũŽď ƐĞĞŬĞƌ ĂŶĚ ŝŶĚƵƐƚƌLJ ŶĞĞĚƐ͘ dŚĞ >ŽĐĂů WůĂŶ ŝƐ ƌĞŇĞĐƟǀĞ ŽĨ ƚŚĞ ůŽĐĂů ĂŶĚ ƌĞŐŝŽŶĂů ĂƌĞĂƐ ƚŚĂƚ ŵĂLJ ďĞ ŝŵƉĂĐƚĞĚ ďLJ ĐŚĂŶŐĞƐŝŶůĂďŽƌŵĂƌŬĞƚ͕ĞĐŽŶŽŵŝĐĐŽŶĚŝƟŽŶƐ͕ĂŶĚ ĚĞŵŽŐƌĂƉŚŝĐƐ͘dŚĞŶĂŚĞŝŵtŽƌŬĨŽƌĐĞĞǀĞůŽƉŵĞŶƚ ŽĂƌĚ;tͿ͕ƚŚƌŽƵŐŚƚŚĞĚĞǀĞůŽƉŵĞŶƚŽĨƌĞŐŝŽŶĂů ĂŶĚ ůŽĐĂů ǁŽƌŬĨŽƌĐĞ ĂŶĚ ĞĐŽŶŽŵŝĐ ĚĞǀĞůŽƉŵĞŶƚ ŶĞƚǁŽƌŬƐ͕ǁŝůůĂĚĚƌĞƐƐƚŚĞǁŽƌŬĨŽƌĐĞĂŶĚĞĚƵĐĂƟŽŶ ƉƌŝŽƌŝƟĞƐ͘ ůŝŶĐŚƉŝŶŽĨƚŚĞt͛Ɛ^ƚƌĂƚĞŐLJŝƐƚŽŝĚĞŶƟĨLJŝŶĚƵƐƚƌLJ ƐĞĐƚŽƌƐĂŶĚŽĐĐƵƉĂƟŽŶĂůĐůƵƐƚĞƌƐŝŶKƌĂŶŐĞŽƵŶƚLJ ĂŶĚŶĂŚĞŝŵƚŚĂƚĚŝƐƉůĂLJŚŝŐŚŐƌŽǁƚŚĂŶĚĚĞŵĂŶĚ͘ ĐĐŽƌĚŝŶŐƚŽƚŚĞƌĞƉŽƌƚ͕ŶĂŚĞŝŵ͛ƐĨĂƐƚĞƐƚŐƌŽǁŝŶŐ ŝŶĚƵƐƚƌLJƐĞĐƚŽƌƐďLJũŽďŐƌŽǁƚŚďĞƚǁĞĞŶϮϬϭϮĂŶĚ ϮϬϭϰ ǁĞƌĞ ƌƚƐ ĂŶĚ ŶƚĞƌƚĂŝŶŵĞŶƚ ;ϭϭ͘ϴ ƉĞƌĐĞŶƚͿ͕ ĐĐŽŵŵŽĚĂƟŽŶĂŶĚ&ŽŽĚ^ĞƌǀŝĐĞƐϳ͘ϭƉĞƌĐĞŶƚͿ͕ĂŶĚ ZĞĂůƐƚĂƚĞ;ϲ͘ϵƉĞƌĐĞŶƚͿ͘LJƚŚŝƐŵĞƚŚŽĚŽůŽŐLJ͕ƚŚĞƐĞ ƚŚƌĞĞƐĞĐƚŽƌƐǁŽƵůĚďĞƚĂƌŐĞƚĞĚĂŶĚƉƌŝŽƌŝƟnjĞĚďLJ ƚŚĞt͘dŚĞtŝŵƉůĞŵĞŶƚƐǀĂƌŝŽƵƐƐƚƌĂƚĞŐŝĞƐ ƚŽ ĞŶƐƵƌĞ ƚŚĂƚ Ă ĨƵůů ƌĂŶŐĞ ŽĨ ĞŵƉůŽLJŵĞŶƚ ĂŶĚ ƚƌĂŝŶŝŶŐƐĞƌǀŝĐĞƐĚĞůŝǀĞƌĞĚƚŚƌŽƵŐŚƚŚĞŵĞƌŝĐĂΖƐ:Žď ĞŶƚĞƌƐŽĨĂůŝĨŽƌŶŝĂ͕ĂƌĞĂĐĐĞƐƐŝďůĞƚŽ͕ĂŶĚǁŝůůŵĞĞƚ ƚŚĞŶĞĞĚƐŽĨĂĚƵůƚ͕ĚŝƐůŽĐĂƚĞĚĂŶĚLJŽƵƚŚǁŽƌŬĞƌƐŝŶ tĞƐƚŶĂŚĞŝŵ͘ /ŶϮϬϭϳ>LJŶĚLJΖƐDŽƚĞů͕ĂƚƚŚĞĐŽƌŶĞƌŽĨĞĂĐŚŽƵůĞǀĂƌĚĂŶĚĂůůZŽĂĚ͕ ǁĂƐĚĞŵŽůŝƐŚĞĚƚŽŵĂŬĞǁĂLJĨŽƌƚŚĞŶĂŚĞŝŵdžƉƌĞƐƐĂƌtĂƐŚ͘dŚŝƐ ŵŽĚĞƌŶĐĂƌǁĂƐŚĨĂĐŝůŝƚLJǁŝůůďĞŽŶĞŽĨƚŚĞĮƌƐƚŶĞǁĚĞǀĞůŽƉŵĞŶƚ ƉƌŽũĞĐƚƐƐŝŶĐĞƚŚĞĞĂƌůLJϮϬϬϬΖƐ͘ WŚŽƚŽƌĞĚŝƚ͗KƌĂŶŐĞŽƵŶƚLJZĞŐŝƐƚĞƌ 130 ͮD/Eн/DW>DEdd/KEͮ,Z/E'Z&dKdKZϮϬϭϴ Emphasize Clean and Safe tŚŝůĞ ƚŚĞ ŵĂũŽƌŝƚLJ ŽĨ tĞƐƚ ŶĂŚĞŝŵ ĂŶĚ ƚŚĞ ƐƵƌƌŽƵŶĚŝŶŐĂƌĞĂŝƐĐŽŵƉƌŝƐĞĚŽĨƐƚĂďůĞƌĞƐŝĚĞŶƟĂů ƵƐĞƐ͕ĞĂĐŚŽƵůĞǀĂƌĚ͛ƐŶƵŵĞƌŽƵƐŽůĚĞƌŵŽƚĞůƐƐƵīĞƌ ĨƌŽŵŚŝŐŚƌĂƚĞƐŽĨĐƌŝŵŝŶĂůĂĐƟǀŝƚLJ͘ĐĐŽƌĚŝŶŐƚŽƚŚĞ ŝƚLJ͕ĐƌŝŵĞĂůŽŶŐƚŚŝƐƉŽƌƟŽŶŽĨĞĂĐŚŽƵůĞǀĂƌĚŝƐƵƉ ƚŽƐŝdžƟŵĞƐŚŝŐŚĞƌƚŚĂŶĂǀĞƌĂŐĞǁŚĞŶĐŽŵƉĂƌĞĚƚŽ ƚŚĞĐŝƚLJĂƐĂǁŚŽůĞ͘^ŽŵĞůŽĚŐŝŶŐƐĂǀĞƌĂŐĞĚĚŽnjĞŶƐ ŽĨ ƉŽůŝĐĞ ĐĂůůƐ ƉĞƌ ƌŽŽŵ ĚƵƌŝŶŐ ƚŚĞ ƉĞƌŝŽĚ ĨƌŽŵ ĞĐĞŵďĞƌϮϬϬϱƚŚƌŽƵŐŚ:ĂŶƵĂƌLJϮϬϭϲ͘ KǀĞƌ ƟŵĞ͕ ƚŚĞƐĞ ƚƌĞŶĚƐ ŚĂǀĞ ƐĞƌǀĞĚ ƚŽ ƚŚǁĂƌƚ ƚŚĞ ĐŽŵŵƵŶŝƚLJ͛Ɛ ĂƩĞŵƉƚƐ ƚŽ ĂƩƌĂĐƚ ŚŝŐŚͲƋƵĂůŝƚLJ͕ ŶĞŝŐŚďŽƌŚŽŽĚͲƐĞƌǀŝŶŐƌĞƚĂŝů͘ĞĂĐŚŽƵůĞǀĂƌĚ ^ƉĞĐŝĮĐWůĂŶŽŵŵƵŶŝƚLJKƵƚƌĞĂĐŚZĞƉŽƌƚƉƵďůŝƐŚĞĚ ŝŶ ϮϬϭϰ ŝŶĚŝĐĂƚĞĚ ƚŚĂƚ ϳϮ ƉĞƌĐĞŶƚ ŽĨ ƐƵƌǀĞLJ ƉĂƌƟĐŝƉĂŶƚƐͶĐŽŵƉƌŝƐĞĚŽĨtĞƐƚŶĂŚĞŝŵƌĞƐŝĚĞŶƚƐ͕ ďƵƐŝŶĞƐƐ͕ĂŶĚƉƌŽƉĞƌƚLJŽǁŶĞƌƐͶĚŽŶŽƚĨĞĞů͞ƐĂĨĞĂŶĚ ĐŽŵĨŽƌƚĂďůĞ͟ǁĂůŬŝŶŐƚŚƌŽƵŐŚƚŚĞŝƌŶĞŝŐŚďŽƌŚŽŽĚ͘ WĞƌĐĞƉƟŽŶƐ ŽĨ ƐĂĨĞƚLJ ĐĂŶ ĚƌĂŵĂƟĐĂůůLJ ŝŵƉĂĐƚ ƚŚĞ ůŝŬĞůŝŚŽŽĚ ƚŚĂƚ ŶĞǁ ĚĞǀĞůŽƉŵĞŶƚ ǁŝůů ƚĂŬĞ ƉůĂĐĞ͘ dŚĞƌĞĨŽƌĞ͕ ĞĐŽŶŽŵŝĐ ĚĞǀĞůŽƉŵĞŶƚ ƐƚƌĂƚĞŐŝĞƐ ŵƵƐƚ ŝŶĐůƵĚĞ ŝŵƉƌŽǀĞŵĞŶƚƐ ƚŚĂƚ ĞŶƐƵƌĞ ƚŚĞ ƐĂĨĞƚLJ ŽĨ ǀŝƐŝƚŽƌƐ͕ĞŵƉůŽLJĞĞƐ͕ĂŶĚƌĞƐŝĚĞŶƚƐ͘ dŚĞŝƚLJŚĂƐďĞĞŶǁŽƌŬŝŶŐƚŽĂĚĚƌĞƐƐƚŚĞƐĞŝƐƐƵĞƐŽŶ ƐĞǀĞƌĂůĨƌŽŶƚƐ͘dŚĞKƌĂŶŐĞŽƵŶƚLJ,ƵŵĂŶdƌĂĸĐŬŝŶŐ dĂƐŬ &ŽƌĐĞ͕ Ă ĐŽůůĂďŽƌĂƟŽŶ ďĞƚǁĞĞŶ ƚŚĞ ŶĂŚĞŝŵ WŽůŝĐĞĞƉĂƌƚŵĞŶƚ͕,W͕&/͕ĂŶĚKƌĂŶŐĞŽƵŶƚLJ ^ŚĞƌŝīΖƐĚĞƉĂƌƚŵĞŶƚ͕ĂŵŽŶŐŽƚŚĞƌƐ͕ŝƐĂĐƟǀĞůLJǁŽƌŬŝŶŐ ƚŽ ĂĚĚƌĞƐƐ ƉƌŽƐƟƚƵƟŽŶ ŝŶ ƚŚĞ ĂƌĞĂ͘ DĞĂŶǁŚŝůĞ͕ ŝŶ KĐƚŽďĞƌ ϮϬϭϰ ƚŚĞ ŶĂŚĞŝŵ ŝƚLJ ŽƵŶĐŝů ĂĚŽƉƚĞĚ KƌĚŝŶĂŶĐĞEŽ͘ϲϯϬϲ͕ǁŚŝĐŚĞŶĂďůĞƐƚŚĞŝƚLJƚŽďĞƩĞƌ ĞŶĨŽƌĐĞ ƐƵďƐƚĂŶĚĂƌĚ ŚŽƵƐŝŶŐ ǀŝŽůĂƟŽŶƐ ŽƵƚůŝŶĞĚ ŝŶ ĂůŝĨŽƌŶŝĂƐƚĂƚĞůĂǁ͘dŚŝƐŽƌĚŝŶĂŶĐĞŚĞůƉƐĂĚĚƌĞƐƐƚŚĞ ůŝǀŝŶŐĐŽŶĚŝƟŽŶƐĨŽƵŶĚŝŶƐŽŵĞŵŽƚĞůƐĂůŽŶŐĞĂĐŚ ŽƵůĞǀĂƌĚ͘/ŶĂĚĚŝƟŽŶ͕ĂŶĞǁŽƌĚŝŶĂŶĐĞĂĚŽƉƚĞĚďLJ ƚŚĞŽƵŶĐŝůŝŶƉƌŝůϮϬϭϳĂĚĚĞĚĂŝƚLJǁŝĚĞƋƵĂůŝƚLJ ŵŽƚĞůŝŶƐƉĞĐƟŽŶƉƌŽŐƌĂŵ͕ǁŚŝĐŚĂůůŽǁƐŝŶƐƉĞĐƟŽŶƐ ŽĨŵŽƚĞůƌŽŽŵƐďĞŝŶŐƵƐĞĚĨŽƌŚŽƵƐŝŶŐƉƵƌƉŽƐĞƐƚŽ ĞŶƐƵƌĞĚĞĐĞŶƚ͕ƐĂĨĞ͕ĂŶĚƐĂŶŝƚĂƌLJŚŽƵƐŝŶŐĐŽŶĚŝƟŽŶƐ͘ džƉĂŶĚWĂƌƚŶĞƌƐŚŝƉƐĂŶĚǁŝƚŚŽƚŚĞƌ:ƵƌŝƐĚŝĐƟŽŶƐ tĞƐƚŶĂŚĞŝŵŚĂƐĂƵŶŝƋƵĞĂĚǀĂŶƚĂŐĞŽĨƉƌŽdžŝŵŝƚLJ ƚŽŽƚŚĞƌůŽĐĂůŝƟĞƐƚŚĂƚĂƌĞĐŽŵƉĂƌĂƟǀĞůLJŚĞĂůƚŚLJ͘ ŵƉůŽLJŵĞŶƚ ŽƉƉŽƌƚƵŶŝƟĞƐ ĨŽƌ tĞƐƚ ŶĂŚĞŝŵ ƌĞƐŝĚĞŶƚƐ͕ ƚŚĞƌĞĨŽƌĞ͕ ŶĞĞĚ ŶŽƚ ďĞ ůŝŵŝƚĞĚ ƚŽ ůŽĐĂů ŝŶĚƵƐƚƌŝĞƐ ŝŶ tĞƐƚ ŶĂŚĞŝŵ͘ >ŝŶŬŝŶŐ ƌĞƐŝĚĞŶƚƐ ƚŽ ĞŵƉůŽLJŵĞŶƚŝŶƚŚĞŐĞŶĞƌĂůĂƌĞĂĂŶĚǁŝƚŚĂĐĐĞƐƐŝďůĞ ƚƌĂŶƐƉŽƌƚĂƟŽŶĐĂŶƉƌŽŵŽƚĞĂŚŝŐŚƋƵĂůŝƚLJŽĨůŝĨĞĨŽƌ tĞƐƚŶĂŚĞŝŵ͘ dŚĞ ŝƚLJ ŽĨ ƵĞŶĂ WĂƌŬ͕ ĨŽƌ ĞdžĂŵƉůĞ͕ ŚĂƐ ƐĞĞŶ Ă ŶƵŵďĞƌ ŽĨ ŶĞǁ ƌĞƚĂŝů ĚĞǀĞůŽƉŵĞŶƚƐ ƌŝƐĞ ĂůŽŶŐ Ă ƌĞǀŝƚĂůŝnjĞĚĞĂĐŚŽƵůĞǀĂƌĚ͘/ƚƐ<ŶŽƩ͛ƐĞƌƌLJ&Ăƌŵ ĂƩƌĂĐƟŽŶ͕ ŵĞĂŶǁŚŝůĞ͕ ĂƩƌĂĐƚĞĚ ŽǀĞƌ Ɛŝdž ŵŝůůŝŽŶ ǀŝƐŝƚŽƌƐŝŶϮϬϭϲ͘ĞLJŽŶĚƚŚĞŐĂƚĞƐŽĨ<ŶŽƩ͛ƐĞƌƌLJ &Ăƌŵ͕ƐĞǀĞƌĂůŶĞǁĂƩƌĂĐƟŽŶƐĂƌĞƐĐŚĞĚƵůĞĚƚŽŽƉĞŶ ƐŽŽŶ͗ƵƩĞƌŇLJtŽŶĚĞƌůĂŶĚƉĂǀŝůŝŽŶǁŝůůŽĐĐƵƉLJĂŶ ϴ͘ϳͲĂĐƌĞĞĂĐŚŽƵůĞǀĂƌĚƉƌŽƉĞƌƚLJŽŶĐĞŚŽŵĞƚŽƚŚĞ DŽǀŝĞůĂŶĚtĂdžDƵƐĞƵŵ͘dŚĞƉĂǀŝůŝŽŶŝƐĞdžƉĞĐƚĞĚƚŽ ĚƌĂǁĂƐŵĂŶLJĂƐŽŶĞŵŝůůŝŽŶǀŝƐŝƚŽƌƐƉĞƌLJĞĂƌ͕ĂŶĚǁŝůů ĨĞĂƚƵƌĞĂϮϬ͕ϬϬϬͲƋƵĂƌĞĨŽŽƚĂƚƌŝƵŵ͕ĂƋƵĂƌŝƵŵ͕ĂŶĚ ŵĞĞƟŶŐƐƉĂĐĞ͘DĞĂŶǁŚŝůĞ͕dŚĞ^ŽƵƌĐĞǁŝůůďĞĂŶĞǁ ƵƌďĂŶͲƐƚLJůĞƐŚŽƉƉŝŶŐĚĞƐƟŶĂƟŽŶǁŝƚŚŝŶƚĞƌŶĂƟŽŶĂů ĚŝŶŝŶŐŽƉƟŽŶƐ͕ĂϮ͕ϬϬϬͲƐĞĂƚƉĞƌĨŽƌŵĂŶĐĞǀĞŶƵĞ͕ĂŶĚ ĂϭϱϬͲƌŽŽŵďŽƵƟƋƵĞŚŽƚĞů͘ tĞƐƚ ŶĂŚĞŝŵ ŝƐ ƵŶŝƋƵĞůLJ ƉŽƐŝƟŽŶĞĚ ƚŽ ďƵŝůĚ Žī ĚĞǀĞůŽƉŵĞŶƚ ƚƌĞŶĚƐ ŚĂƉƉĞŶŝŶŐ ƚŽ ƚŚĞ ŶŽƌƚŚ͘ LJ ǁŽƌŬŝŶŐĐůŽƐĞůLJǁŝƚŚŶĞŝŐŚďŽƌŝŶŐũƵƌŝƐĚŝĐƟŽŶƐ͕ƚŚĞŝƚLJ ĐĂŶŚĞůƉŐƵŝĚĞĨƵƚƵƌĞŐƌŽǁƚŚĂŶĚůĞǀĞƌĂŐĞƚŽƵƌŝƐŵ ƌĞǀĞŶƵĞƐ ƚŚĂƚ ďĞŶĞĮƚ ŶĂŚĞŝŵ ĂŶĚ ƐƵƌƌŽƵŶĚŝŶŐ ƌĞŐŝŽŶĂůĂƌĞĂ͘ŐƌĞĂƚĞdžĂŵƉůĞŝƐƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ ŽĂůŝƟŽŶ͕ǁŚŝĐŚŝƐĂƌĞŐŝŽŶĂůďƌĂŶĚŝŶŐĂŶĚŵĂƌŬĞƟŶŐ ĞīŽƌƚĂŵŽŶŐĐŝƟĞƐƐŝƚƵĂƚĞĚĂůŽŶŐĞĂĐŚůǀĚ͘ ,Z/E'Z&dKdKZϮϬϭϴͮD/Eн/DW>DEdd/KE | 131 5 5.11.2 Phasing dŚĞƉŚĂƐŝŶŐŽĨŶĞǁĚĞǀĞůŽƉŵĞŶƚĂŶĚƌĞǀŝƚĂůŝnjĂƟŽŶ ŽĨ ĞdžŝƐƟŶŐ ďƵŝůĚŝŶŐƐ ŽŶ ƉƌŝǀĂƚĞ ƉƌŽƉĞƌƟĞƐ ǁŝůů ŽĐĐƵƌ ŝŶĐƌĞŵĞŶƚĂůůLJ ŽǀĞƌƟŵĞ͕ ĂƐ ůĂŶĚŽǁŶĞƌƐ ĂŶĚ ĚĞǀĞůŽƉĞƌƐ ƌĞƐƉŽŶĚ ƚŽ ŶĞǁ ŵĂƌŬĞƚ ŽƉƉŽƌƚƵŶŝƟĞƐ͘ ĞǀĞůŽƉŵĞŶƚŽĨƚŚĞtĞƐƚŐĂƚĞƐŝƚĞ͕ǁŚŝĐŚŝƐĐƵƌƌĞŶƚůLJ ŽǁŶĞĚ ďLJ ƚŚĞ ŝƚLJ ŽĨ ŶĂŚĞŝŵ͕ ŝƐ ĞdžƉĞĐƚĞĚ ƚŽ ŽĐĐƵƌŝŶƚŚĞƐŚŽƌƚͲƚĞƌŵ;ϭƚŽϱLJĞĂƌͿƟŵĞŚŽƌŝnjŽŶ͘ ĞǀĞůŽƉŵĞŶƚŽĨŽƚŚĞƌĐŝƚLJͲŽǁŶĞĚƐŝƚĞƐďLJƚŚĞŝƚLJ ŽĨŶĂŚĞŝŵ,ŽƵƐŝŶŐƵƚŚŽƌŝƚLJǁŝůůŽĐĐƵƌĂƐĨƵŶĚŝŶŐ ĂůůŽǁƐŽƌũŽŝŶƚƉĂƌƚŶĞƌƐŚŝƉƐĂƌĞĨŽƌŵĞĚ͘/ŶĂĚĚŝƟŽŶ ƚŽ ŝŶǀĞƐƚŵĞŶƚ ŝŶ ƉƌŽƉĞƌƟĞƐ ĂůŽŶŐ ƚŚĞ ŽƵůĞǀĂƌĚ͕ ƚŚĞƌĞĂƌĞĂůƐŽŝŵƉƌŽǀĞŵĞŶƚƐŶĞĞĚĞĚĨŽƌĞŶŚĂŶĐĞĚ ŵŽďŝůŝƚLJĂŶĚŝŶĨƌĂƐƚƌƵĐƚƵƌĞ͘dŚĞƐĞŝŵƉƌŽǀĞŵĞŶƚƐĂƌĞ ŝĚĞŶƟĮĞĚŝŶdĂďůĞϱͲϭ͕/ŵƉůĞŵĞŶƚĂƟŽŶĐƟŽŶWůĂŶ͕ ĂůŽŶŐǁŝƚŚĂŐĞŶĞƌĂůƟŵĞĨƌĂŵĞĨŽƌǁŚĞŶƚŚĞLJĂƌĞ ĞdžƉĞĐƚĞĚƚŽŽĐĐƵƌďĂƐĞĚŽŶĨƵŶĚŝŶŐ͘ 5.11.3 Implementation Action Plan dŚĞĨŽůůŽǁŝŶŐ/ŵƉůĞŵĞŶƚĂƟŽŶĐƟŽŶWůĂŶůŝƐƚƐƚŚĞ ƐƉĞĐŝĮĐ ĂĐƟŽŶƐ Žƌ ƐƚƌĂƚĞŐŝĞƐ ƚŚĂƚ ƐŚŽƵůĚ ďĞ ƚĂŬĞŶ ďLJƚŚĞŝƚLJŽĨŶĂŚĞŝŵ͕ŝŶĐŽŽƌĚŝŶĂƟŽŶǁŝƚŚůŽĐĂů ďƵƐŝŶĞƐƐĞƐ͕ ĨƵƚƵƌĞ ĚĞǀĞůŽƉĞƌƐ͕ ĂŶĚ ŽƚŚĞƌ ĂŐĞŶĐŝĞƐ ǁŚĞƌĞ ĂƉƉƌŽƉƌŝĂƚĞ͘ WƌŽŐƌĂŵƐ ĂŶĚ ƉŽůŝĐŝĞƐ ĨŽƌ ƐŽŵĞŽĨƚŚĞƐĞŝƚĞŵƐĂƌĞĂůƌĞĂĚLJŝŶƉůĂĐĞ͕ĂŶĚĂƌĞ ƌĞĐŽŵŵĞŶĚĞĚƚŽďĞĐŽŶƟŶƵĞĚǁŝƚŚŝŶƚŚŝƐ^ƚƵĚLJƌĞĂ͘ dĂďůĞϱͲϭ͕/ŵƉůĞŵĞŶƚĂƟŽŶĐƟŽŶWůĂŶ͕ŝƐŽƌŐĂŶŝnjĞĚďLJ ƚŚĞĨŽůůŽǁŝŶŐƚŽƉŝĐĂƌĞĂƐ͗ • ĐŽŶŽŵŝĐĞǀĞůŽƉŵĞŶƚ^ƚƌĂƚĞŐŝĞƐ • DŽďŝůŝƚLJĂŶĚ^ƚƌĞĞƚƐĐĂƉĞĐƟŽŶƐ • /ŶĨƌĂƐƚƌƵĐƚƵƌĞĐƟŽŶƐ • ^ƵƐƚĂŝŶĂďŝůŝƚLJĐƟŽŶƐ • /ĚĞŶƟƚLJĂŶĚƌĂŶĚŝŶŐĐƟŽŶƐ &ŽƌĞĂĐŚĂĐƟŽŶƚŚĞƌĞŝƐĂƌĞĐŽŵŵĞŶĚĞĚƟŵĞĨƌĂŵĞ ĨŽƌĐŽŵƉůĞƟŽŶ͕ƚŚĞƌĞƐƉŽŶƐŝďůĞĚĞƉĂƌƚŵĞŶƚŽƌĞŶƟƚLJ͕ ĂŶĚƉŽƚĞŶƟĂůĨƵŶĚŝŶŐƐŽƵƌĐĞ;ƐͿ͘dŚĞƟŵĞĨƌĂŵĞƐĂƌĞ ŝĚĞŶƟĮĞĚĂƐĨŽůůŽǁƐ͗ • ^ŚŽƌƚ;ϭͲϱLJĞĂƌƐͿ • DĞĚŝƵŵ;ϱƚŽϭϬLJĞĂƌƐͿ • >ŽŶŐ;ϭϬLJĞĂƌƐŽƌŵŽƌĞͿ KŶŐŽŝŶŐ ĂĐƟŽŶƐ ŚĂǀĞ ĂůƐŽ ďĞĞŶ ŝĚĞŶƟĮĞĚ͘ ĐƚƵĂů ŝŵƉůĞŵĞŶƚĂƟŽŶǁŝůůďĞĚĞƉĞŶĚĞŶƚŽŶĚĞǀĞůŽƉŵĞŶƚ ĂĐƟǀŝƚLJ͕ĨƵŶĚŝŶŐĂǀĂŝůĂďŝůŝƚLJ͕ĂŶĚƐƚĂīƌĞƐŽƵƌĐĞƐ͘dŚĞ /ŵƉůĞŵĞŶƚĂƟŽŶĐƟŽŶWůĂŶǁŝůůďĞƵƐĞĚďLJƚŚĞŝƚLJ ƚŚƌŽƵŐŚŽƵƚƚŚĞůŝĨĞŽĨƚŚĞ^WƚŽƚƌĂĐŬƉƌŽŐƌĞƐƐ͘ 132 ͮD/Eн/DW>DEdd/KEͮ,Z/E'Z&dKdKZϮϬϭϴ d>ϱͳϭ/DW>DEdd/KEd/KEW>E SPECIFIC ACTIONS TIMEFRAME PRIMARY RESPONSIBILITY POTENTIAL &hE/E' ^KhZ^ ĐŽŶŽŵŝĐĞǀĞůŽƉŵĞŶƚĐƟŽŶƐ ĐƟŽŶ͘ϭ͗&ĂĐŝůŝƚĂƚĞĂŶĚ^ƚƌĞĂŵůŝŶĞWƌŽĐĞƐƐƚŽƐƚĂďůŝƐŚĂƵƐŝŶĞƐƐŝŶtĞƐƚŶĂŚĞŝŵ E.1.1 KďƚĂŝŶĚĂƚĂƌĞŇĞĐƟŶŐĐƵƌƌĞŶƚďƵƐŝŶĞƐƐĞƐŝŶtĞƐƚŶĂŚĞŝŵ ĂŶĚƉƌŽŵŽƚĞĂǀĂŝůĂďůĞďƵƐŝŶĞƐƐĚĞǀĞůŽƉŵĞŶƚƌĞƐŽƵƌĐĞƐ;Ğ͘Ő͕͘ĨƌĞĞ ďƵƐŝŶĞƐƐĐŽƵŶƐĞůŝŶŐ͕ƐĞŵŝŶĂƌƐ͕ĂŶĚƚƌĂŝŶŝŶŐƐͿŽīĞƌĞĚƚŚƌŽƵŐŚƚŚĞ ŝƚLJŝŶƉĂƌƚŶĞƌƐŚŝƉǁŝƚŚŐŽǀĞƌŶŵĞŶƚƌĞƐŽƵƌĐĞĂŐĞŶĐŝĞƐ͘ ^ŚŽƌƚ ŽŵŵƵŶŝƚLJ ΘĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ ŝƚLJ E.1.2 WƌŽŵŽƚĞďƵƐŝŶĞƐƐĞŶƚƌĞƉƌĞŶĞƵƌƐŚŝƉƚŚƌŽƵŐŚǁŽƌŬƐŚŽƉƐ͕ ƚƌĂŝŶŝŶŐƐ͕ĂŶĚΗŝŶƚĞŶƐŝǀĞƐΗŽīĞƌĞĚƚŚƌŽƵŐŚ^͕^h&ĞŶƚĞƌĨŽƌ ŶƚƌĞƉƌĞŶĞƵƌƐŚŝƉ͕ĂŶĚǀĂƌŝŽƵƐƌĞƐŽƵƌĐĞƉĂƌƚŶĞƌƐ͘ KŶŐŽŝŶŐ ŽŵŵƵŶŝƚLJ ΘĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ ŝƚLJĂŶĚ &ĞĚĞƌĂů E.1.3 KƵƚƌĞĂĐŚƚŽĐŽŵŵĞƌĐŝĂůďƌŽŬĞƌƐĂŶĚƉƌŽƉĞƌƚLJŵĂŶĂŐĞƌƐ ŝŶtĞƐƚŶĂŚĞŝŵĂŶĚĚŝƐĐƵƐƐƉƌĞĨĞƌƌĞĚďƵƐŝŶĞƐƐƵƐĞƐ͕ƉĞƌĐĞŝǀĞĚ ŽďƐƚĂĐůĞƐƚŽĚŽŝŶŐďƵƐŝŶĞƐƐŝŶŶĂŚĞŝŵ͕ŶĂŚĞŝŵΖƐ:ƵŵƉ^ƚĂƌƚ ŵĞĞƟŶŐƐĂŶĚƵƐŝŶĞƐƐƐƐŝƐƚĂŶĐĞWƌŽŐƌĂŵ͕ĂŶĚƉƌŽŵŽƚĞďƌŽŬĞƌƐΖ ĂǀĂŝůĂďůĞĐŽŵŵĞƌĐŝĂůƐƉĂĐĞƐŽŶͲůŝŶĞ͘ KŶŐŽŝŶŐ ŽŵŵƵŶŝƚLJ ΘĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ ŝƚLJ E.1.4 ,ŽƐƚƵƐŝŶĞƐƐ^ƚĂƌƚͲƵƉĂŶĚdžƉĂŶƐŝŽŶtŽƌŬƐŚŽƉƐŝŶ ƉĂƌƚŶĞƌƐŚŝƉǁŝƚŚŐŽǀĞƌŶŵĞŶƚƌĞƐŽƵƌĐĞĂŐĞŶĐŝĞƐ͘ KŶŐŽŝŶŐ ŽŵŵƵŶŝƚLJ ΘĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ͖ WůĂŶŶŝŶŐΘƵŝůĚŝŶŐ͖ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ ĐƟŽŶ͘Ϯ͗ůŝŐŶ^ŬŝůůƐŽĨtŽƌŬŝŶŐZĞƐŝĚĞŶƚƐǁŝƚŚ'ƌŽǁŝŶŐ/ŶĚƵƐƚƌŝĞƐŝŶtĞƐƚŶĂŚĞŝŵ E.2.1 WƌŽŵŽƚĞĂŶĚĞŶŚĂŶĐĞĐŽƵŶƐĞůŝŶŐƐĞƌǀŝĐĞƐŽīĞƌĞĚĂƚŶĂŚĞŝŵ :ŽďƐƚŚƌŽƵŐŚƚŚĞŶĂŚĞŝŵ:ŽďƐǁĞďƐŝƚĞĂŶĚƉƌŝŶƚŵĂƚĞƌŝĂůƐ ĚŝƐƚƌŝďƵƚĞĚƚŽtĞƐƚŶĂŚĞŝŵŚŽŵĞƐ͘ KŶŐŽŝŶŐ tŽƌŬĨŽƌĐĞ ĞǀĞůŽƉŵĞŶƚ ŽĂƌĚ͖ŽŵŵƵŶŝƚLJ ΘĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ ŝƚLJĂŶĚ &ĞĚĞƌĂů E.2.2 WĂƌƚŶĞƌǁŝƚŚƚŚĞtĞƐƚŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌ͕ĐŽŵŵƵŶŝƚLJ ĐŽůůĞŐĞƐ͕ĂŶĚƌĞƐŽƵƌĐĞƉĂƌƚŶĞƌƐŽŶũŽďƐŬŝůůƐĂŶĚĞĚƵĐĂƟŽŶ ŐĂƉŵŝƟŐĂƟŽŶĞīŽƌƚƐ;ŝ͘Ğ͘ŽĐĐƵƉĂƟŽŶĂůƚƌĂŝŶŝŶŐƐ͕ŝŶƚĞƌŶƐŚŝƉƐ͕ ĂƉƉƌĞŶƟĐĞƐŚŝƉƐ͕ĂŶĚĐĂƌĞĞƌǁŽƌŬƐŚŽƉƐͿ͘ KŶŐŽŝŶŐ tŽƌŬĨŽƌĐĞ ĞǀĞůŽƉŵĞŶƚŽĂƌĚ ŝƚLJĂŶĚ &ĞĚĞƌĂů E.2.3 ŽŶǀĞŶĞĂũŽďƐŬŝůůƐŶĞĞĚƐĂƐƐĞƐƐŵĞŶƚĚŝƐĐƵƐƐŝŽŶǁŝƚŚŚƵŵĂŶ ƌĞƐŽƵƌĐĞƐƌĞƉƌĞƐĞŶƚĂƟǀĞƐĨƌŽŵƚĂƌŐĞƚŝŶĚƵƐƚƌŝĞƐ͕ĐŽŵŵƵŶŝƚLJ ĐŽůůĞŐĞƐ͕ĂŶĚŐŽǀĞƌŶŵĞŶƚƌĞƐŽƵƌĐĞƉĂƌƚŶĞƌƐĂŶĚƉĂƌƚŶĞƌŽŶĂ^ŬŝůůƐ ĞǀĞůŽƉŵĞŶƚĂŶĚdƌĂŝŶŝŶŐZĞƐŽƵƌĐĞ&ĂŝƌͬtŽƌŬƐŚŽƉ͘ ^ŚŽƌƚ tŽƌŬĨŽƌĐĞ ĞǀĞůŽƉŵĞŶƚŽĂƌĚ͖ ŽŵŵƵŶŝƚLJ ΘĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ ŝƚLJĂŶĚ &ĞĚĞƌĂů E.2.4 WƌŽǀŝĚĞĞŵƉůŽLJĞƌƐǁŝƚŚĂĐĐĞƐƐƚŽΗKŶƚŚĞ:ŽďdƌĂŝŶŝŶŐΗĨƵŶĚƐ ƚŚĂƚĐĂŶƌĞŝŵďƵƌƐĞƚŚĞŝƌĞŵƉůŽLJĞĞƚƌĂŝŶŝŶŐƐďLJϱϬйĂŶĚŚŝƌŝŶŐ ĐƌĞĚŝƚƐŽīĞƌĞĚƚŚƌŽƵŐŚƌĞƐŽƵƌĐĞƉĂƌƚŶĞƌƐ͘ KŶŐŽŝŶŐ tŽƌŬĨŽƌĐĞ ĞǀĞůŽƉŵĞŶƚŽĂƌĚ͖ ŽŵŵƵŶŝƚLJ ΘĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ ŝƚLJĂŶĚ &ĞĚĞƌĂů ĐƟŽŶ͘ϯ͗WƌŽŵŽƚĞtĞƐƚŶĂŚĞŝŵĂƐĂ^ĂĨĞWůĂĐĞƚŽ>ŝǀĞĂŶĚtŽƌŬ E.3.1 WĂƌƚŶĞƌǁŝƚŚƚŚĞtĞƐƚŶĂŚĞŝŵWŽůŝĐĞ^ƵďƐƚĂƟŽŶ͕ŽĚĞ ŶĨŽƌĐĞŵĞŶƚ͕ĂŶĚŶĞŝŐŚďŽƌŚŽŽĚĂŶĚďƵƐŝŶĞƐƐĂƐƐŽĐŝĂƟŽŶƐƚŽ ĞŶŚĂŶĐĞĞīŽƌƚƐƚŽƌĞĚƵĐĞƉƵďůŝĐƐĂĨĞƚLJĂŶĚƐƵďƐƚĂŶĚĂƌĚŚŽƵƐŝŶŐ ǀŝŽůĂƟŽŶƐ͘ KŶŐŽŝŶŐ WŽůŝĐĞ͖ WůĂŶŶŝŶŐΘƵŝůĚŝŶŐ͖ ŽŵŵƵŶŝƚLJ ΘĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ ŝƚLJ ,Z/E'Z&dKdKZϮϬϭϴͮD/Eн/DW>DEdd/KE | 133 5 d>ϱͳϭ/DW>DEdd/KEd/KEW>E SPECIFIC ACTIONS TIMEFRAME PRIMARY RESPONSIBILITY POTENTIAL &hE/E' ^KhZ^ ĐƟŽŶ͘ϰ͗ZĞǀŝƚĂůŝnjĞŽŵŵĞƌĐŝĂůƌĞĂƐůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ E.4.1 ^ƚƌĂƚĞŐŝĐĂůůLJƉƌŽŵŽƚĞƚŚĞtĞƐƚŐĂƚĞƌĞĚĞǀĞůŽƉŵĞŶƚĂŵŽŶŐ ĚĞǀĞůŽƉĞƌƐ͕ĐŽŵŵĞƌĐŝĂůďƌŽŬĞƌƐ͕ĂŶĚƚŚĞďƵƐŝŶĞƐƐĐŽŵŵƵŶŝƚLJƚŽ ƐƉƵƌĂĚĚŝƟŽŶĂůŝŶǀĞƐƚŵĞŶƚŝŶĚŝůĂƉŝĚĂƚĞĚĐŽŵŵĞƌĐŝĂůƐƚƌƵĐƚƵƌĞƐŝŶ ƚŚĞĂƌĞĂĂŶĚƉƌŽŵŽƚĞǁĂůŬĂďůĞŶĞŝŐŚďŽƌŚŽŽĚĚĞƐƟŶĂƟŽŶĐĞŶƚĞƌƐ͘ DĞĚŝƵŵ ŽŵŵƵŶŝƚLJ ΘĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ͖ WůĂŶŶŝŶŐΘƵŝůĚŝŶŐ ŝƚLJ E.4.2 ĞǀĞůŽƉĂŽŵŵĞƌĐŝĂů&ĂĕĂĚĞZĞŚĂďŝůŝƚĂƟŽŶ>ŽĂŶWƌŽŐƌĂŵ ƚŚĂƚĂƐƐŝƐƚƐƉƌŽƉĞƌƚLJŽǁŶĞƌƐǁŝƚŚĞdžƚĞƌŝŽƌŝŵƉƌŽǀĞŵĞŶƚƐƚŽƚŚĞŝƌ ĐŽŵŵĞƌĐŝĂůĐĞŶƚĞƌƐ͘ DĞĚŝƵŵ ŽŵŵƵŶŝƚLJ ΘĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ͖ WůĂŶŶŝŶŐΘƵŝůĚŝŶŐ͖ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ E.4.3 ŶĐŽƵƌĂŐĞĂŶĚĨĂĐŝůŝƚĂƚĞŶĞŝŐŚďŽƌŚŽŽĚͲĚĞƐŝƌĞĚƌĞƚĂŝů ĂŶĚĚŝŶŝŶŐŽƉƟŽŶƐƚŚƌŽƵŐŚĨĞĞĚĞĨĞƌƌĂůƐĂŶĚĨĂƐƚͲƚƌĂĐŬƌĞǀŝĞǁ ŵĞĞƟŶŐƐ͘ KŶŐŽŝŶŐ ŽŵŵƵŶŝƚLJ ΘĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ͖ WůĂŶŶŝŶŐΘƵŝůĚŝŶŐ͖ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ E.4.4 &ĂĐŝůŝƚĂƚĞƚŚĞƚƌĂŶƐŝƟŽŶŽĨŵŝĚͲďůŽĐŬƐƚƌŝƉĐŽŵŵĞƌĐŝĂů ĚĞǀĞůŽƉŵĞŶƚƚŽŚŝŐŚͲƋƵĂůŝƚLJƌĞƐŝĚĞŶƟĂůƵƐĞƐ͘ KŶŐŽŝŶŐ ŽŵŵƵŶŝƚLJ ΘĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ͖ WůĂŶŶŝŶŐΘƵŝůĚŝŶŐ͖ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ DŽďŝůŝƚLJĂŶĚ^ƚƌĞĞƚƐĐĂƉĞĐƟŽŶƐ D͘ϭdƌĂŶƐƉŽƌƚĂƟŽŶĞŵĂŶĚDĂŶĂŐĞŵĞŶƚWƌŽŐƌĂŵ;dDͿ͘ EŽŶͲƌĞƐŝĚĞŶƟĂůƉƌŽũĞĐƚƉƌŽƉĞƌƚLJŽǁŶĞƌͬĚĞǀĞůŽƉĞƌƐĂƌĞƌĞƋƵŝƌĞĚ ƚŽĞƐƚĂďůŝƐŚĂĐŽŵƉƌĞŚĞŶƐŝǀĞdDƉƌŽŐƌĂŵǁŝƚŚĂŵĞŶƵŽĨ ĐŽŵŵƵƚĞŽƉƟŽŶƐĂŶĚŝŶĐĞŶƟǀĞƐĨŽƌĞdžŝƐƟŶŐĂŶĚĨƵƚƵƌĞĞŵƉůŽLJĞĞƐ͘ ^ƚƌĂƚĞŐŝĞƐƐŚĂůůŝŶĐůƵĚĞƉĂƌƟĐŝƉĂƟŽŶŝŶĂĐůĞĂŶĨƵĞůƐŚƵƩůĞƉƌŽŐƌĂŵ ĂŶĚƉĂƌƟĐŝƉĂƟŽŶŝŶƚŚĞŶĂŚĞŝŵdƌĂŶƐƉŽƌƚĂƟŽŶEĞƚǁŽƌŬͬ dƌĂŶƐƉŽƌƚĂƟŽŶDĂŶĂŐĞŵĞŶƚƐƐŽĐŝĂƟŽŶ͘ KŶŐŽŝŶŐ WƵďůŝĐtŽƌŬƐ ŵƉůŽLJĞƌͬ Developer D͘ϮdƌĂŶƐƉŽƌƚĂƟŽŶ^ƚƵĚŝĞƐ͘ZĞƋƵŝƌĞƐŝƚĞƐƉĞĐŝĮĐƚƌĂŶƐƉŽƌƚĂƟŽŶ ƐƚƵĚŝĞƐĨŽƌŶĞǁĚĞǀĞůŽƉŵĞŶƚƉƌŽƉŽƐĂůƐƚŽĂĚĚƌĞƐƐĂĐĐĞƐƐǁŚĞŶ ĚĞƚĞƌŵŝŶĞĚŶĞĐĞƐƐĂƌLJďLJƚŚĞdƌĂĸĐĂŶĚdƌĂŶƐƉŽƌƚĂƟŽŶDĂŶĂŐĞƌ͘ KŶŐŽŝŶŐ WƵďůŝĐtŽƌŬƐ͖ ĂůƚƌĂŶƐ Developer M.3 Beach Boulevard and Lincoln Avenue Improvements. ŽŽƌĚŝŶĂƚĞǁŝƚŚĂůƚƌĂŶƐŽŶƌĞͲƟŵŝŶŐƚŚĞŝŶƚĞƌƐĞĐƟŽŶ͕ǁŚŝĐŚ ǁŽƵůĚŝŵƉƌŽǀĞŝŶƚĞƌƐĞĐƟŽŶŽƉĞƌĂƟŽŶƐƚŽďĞƩĞƌƚŚĂŶƉƌĞͲƉƌŽũĞĐƚ ĐŽŶĚŝƟŽŶƐ͘ ^ŚŽƌƚʹƐƟŵĂƚĞĚ ŶĞĞĚŝƐĂƚϭϬйŽĨ ƉƌŽũĞĐƚďƵŝůĚŽƵƚ ĂůƚƌĂŶƐ ĂůƚƌĂŶƐ M.4 Beach Boulevard and Orange Avenue Improvements. ĚĚĂĚĞĚŝĐĂƚĞĚƌŝŐŚƚͲƚƵƌŶůĂŶĞŽŶƚŚĞŶŽƌƚŚďŽƵŶĚĂƉƉƌŽĂĐŚ͕ ĂŶĚĂĚĞĚŝĐĂƚĞĚƌŝŐŚƚͲƚƵƌŶůĂŶĞĂŶĚĂĚĚŝƟŽŶĂůůĞŌͲƚƵƌŶůĂŶĞŽŶ ƚŚĞĞĂƐƚďŽƵŶĚĂƉƉƌŽĂĐŚ͕ŝĨĨĞĂƐŝďůĞǁŚĞŶŶĞǁĚĞǀĞůŽƉŵĞŶƚŝƐ ƉƌŽƉŽƐĞĚŽŶĂĚũĂĐĞŶƚƉƌŽƉĞƌƟĞƐ͘ >ŽŶŐ WƵďůŝĐtŽƌŬƐ ŝƚLJ͕ĂůƚƌĂŶƐ͕ Kd͕^ƚĂƚĞ ĂŶĚ&ĞĚĞƌĂů &ƵŶĚƐ͕WƌŝǀĂƚĞ ĞǀĞůŽƉŵĞŶƚ M.5 Beach Boulevard and Ball Road Improvements.ĚĚ ĂĚĚŝƟŽŶĂůůĞŌƚƵƌŶůĂŶĞƐĂƚƚŚĞĞĂƐƚďŽƵŶĚĂŶĚǁĞƐƚďŽƵŶĚ ĂƉƉƌŽĂĐŚĞƐ͕ŝĨĨĞĂƐŝďůĞǁŚĞŶŶĞǁĚĞǀĞůŽƉŵĞŶƚŝƐƉƌŽƉŽƐĞĚĂƚƚŚĞ ŝŶƚĞƌƐĞĐƟŽŶ͘ >ŽŶŐ WƵďůŝĐtŽƌŬƐ ŝƚLJ͕ĂůƚƌĂŶƐ͕ Kd͕^ƚĂƚĞ ĂŶĚ&ĞĚĞƌĂů &ƵŶĚƐ͕WƌŝǀĂƚĞ ĞǀĞůŽƉŵĞŶƚ 134 ͮD/Eн/DW>DEdd/KEͮ,Z/E'Z&dKdKZϮϬϭϴ d>ϱͳϭ/DW>DEdd/KEd/KEW>E SPECIFIC ACTIONS TIMEFRAME PRIMARY RESPONSIBILITY POTENTIAL &hE/E' ^KhZ^ D͘ϲĞĂĐŚŽƵůĞǀĂƌĚĂŶĚĞƌƌŝƚŽƐǀĞŶƵĞ͘WĂLJĂĨĂŝƌͲƐŚĂƌĞ ĐŽŶƚƌŝďƵƟŽŶƚŽǁĂƌĚĂĚĚŝŶŐĂŶĂĚĚŝƟŽŶĂůůĞŌͲƚƵƌŶůĂŶĞĂƚƚŚĞ ŶŽƌƚŚďŽƵŶĚĂƉƉƌŽĂĐŚĂŶĚĂĚĞĚŝĐĂƚĞĚƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚƚŚĞ ĞĂƐƚďŽƵŶĚĂƉƉƌŽĂĐŚ͕ŝĨƌŝŐŚƚͲŽĨͲǁĂLJĐĂŶďĞĂĐƋƵŝƌĞĚ͘ >ŽŶŐ WƵďůŝĐtŽƌŬƐ ŝƚLJ͕ĂůƚƌĂŶƐ͕ Kd͕^ƚĂƚĞ ĂŶĚ&ĞĚĞƌĂů &ƵŶĚƐ͕WƌŝǀĂƚĞ ĞǀĞůŽƉŵĞŶƚ M.7 Beach Boulevard and Katella Avenue.WĂLJĂĨĂŝƌͲƐŚĂƌĞ ĐŽŶƚƌŝďƵƟŽŶƚŽǁĂƌĚĂĚĚŝŶŐĂŶĂĚĞĚŝĐĂƚĞĚƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚƚŚĞ ŶŽƌƚŚďŽƵŶĚĂƉƉƌŽĂĐŚ͕ŝĨƌŝŐŚƚͲŽĨͲǁĂLJĐĂŶďĞĂĐƋƵŝƌĞĚ͘ >ŽŶŐ WƵďůŝĐtŽƌŬƐ ŝƚLJ͕ĂůƚƌĂŶƐ͕ Kd͕^ƚĂƚĞ ĂŶĚ&ĞĚĞƌĂů &ƵŶĚƐ͕WƌŝǀĂƚĞ ĞǀĞůŽƉŵĞŶƚ D͘ϴ<ŶŽƩǀĞŶƵĞĂŶĚ>ŝŶĐŽůŶǀĞŶƵĞ/ŶƚĞƌƐĞĐƟŽŶ Improvements.WĂLJĂĨĂŝƌƐŚĂƌĞĐŽŶƚƌŝďƵƟŽŶƚŽǁĂƌĚĂĚĚŝŶŐ ĂŶĂĚĚŝƟŽŶĂůůĞŌͲƚƵƌŶůĂŶĞĂƚƚŚĞŶŽƌƚŚďŽƵŶĚĂƉƉƌŽĂĐŚĂŶĚĂ ĚĞĚŝĐĂƚĞĚƌŝŐŚƚͲƚƵƌŶůĂŶĞĂƚƚŚĞĞĂƐƚďŽƵŶĚĂƉƉƌŽĂĐŚ͘ >ŽŶŐ WƵďůŝĐtŽƌŬƐ ŝƚLJ͕ĂůƚƌĂŶƐ͕ Kd͕^ƚĂƚĞ ĂŶĚ&ĞĚĞƌĂů &ƵŶĚƐ͕WƌŝǀĂƚĞ ĞǀĞůŽƉŵĞŶƚ D͘ϵdƌĂŝů/ŵƉƌŽǀĞŵĞŶƚƐůŽŶŐĂƌďŽŶƌĞĞŬŚĂŶŶĞů͘/ŵƉƌŽǀĞ ĂŶĚĐŽŶŶĞĐƚƚŚĞƚƌĂŝůĂůŽŶŐƚŚĞĂƌďŽŶƌĞĞŬŚĂŶŶĞůĐŽŶƐŝƐƚĞŶƚ ǁŝƚŚƚŚĞŝƚLJŽĨŶĂŚĞŝŵŝĐLJĐůĞDĂƐƚĞƌWůĂŶ͘ ^ŚŽƌƚ ŽŵŵƵŶŝƚLJ^ĞƌǀŝĐĞƐ͖ WƵďůŝĐtŽƌŬƐ ŝƚLJ D͘ϭϬƌŽƐƐǁĂůŬŶŚĂŶĐĞŵĞŶƚƐ͘ŽŽƌĚŝŶĂƚĞǁŝƚŚĂůƚƌĂŶƐƚŽ ŝŵƉůĞŵĞŶƚŚŝŐŚǀŝƐŝďŝůŝƚLJĐƌŽƐƐǁĂůŬƐĂƚĞĂĐŚŽƵůĞǀĂƌĚĂŶĚĂůů ZŽĂĚ͕KƌĂŶŐĞǀĞŶƵĞ͕ĂŶĚ>ŝŶĐŽůŶǀĞŶƵĞ͘ ^ŚŽƌƚ WƵďůŝĐtŽƌŬƐ ŝƚLJ͕ĂůƚƌĂŶƐ͕ Kd͕^ƚĂƚĞ ĂŶĚ&ĞĚĞƌĂů &ƵŶĚƐ M.11 Sidewalk and Streetscape Improvements.ŽŽƌĚŝŶĂƚĞ ƐŝĚĞǁĂůŬĂŶĚƐƚƌĞĞƚƐĐĂƉĞŝŵƉƌŽǀĞŵĞŶƚƐǁŝƚŚƚŚĞƵŶĚĞƌŐƌŽƵŶĚŝŶŐ ŽĨƵƟůŝƟĞƐĂƐĚĞƐĐƌŝďĞĚŝŶĂĐƟŽŶ/͘ϴhŶĚĞƌŐƌŽƵŶĚhƟůŝƟĞƐ͘ DĞĚŝƵŵ WƵďůŝĐhƟůŝƟĞƐ͖ WƵďůŝĐtŽƌŬƐ ŝƚLJ /ĚĞŶƟƚLJĂŶĚƌĂŶĚŝŶŐĐƟŽŶƐ B.1 Beach Boulevard Brand.WĂƌƚŶĞƌǁŝƚŚƐƵƌƌŽƵŶĚŝŶŐĐŝƟĞƐŽŶ ďƌĂŶĚŝŶŐĂŶĚŵĂƌŬĞƟŶŐƋƵĂůŝĨLJŽĨůŝĨĞ͕ƚŽƵƌŝƐŵ͕ĂŶĚďƵƐŝŶĞƐƐ ĂŵĞŶŝƟĞƐĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ͘ ^ŚŽƌƚ ŽŵŵƵŶŝƚLJ ΘĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ͖ WůĂŶŶŝŶŐΘƵŝůĚŝŶŐ ŝƚLJ /ŶĨƌĂƐƚƌƵĐƚƵƌĞĐƟŽŶƐ I.1 Gray Water Systems.WƌŽŵŽƚĞƚŚĞƵƐĞŽĨŐƌĂLJǁĂƚĞƌƐLJƐƚĞŵƐ͕Ă ƉƌŽĐĞƐƐƚŚĂƚƚLJƉŝĐĂůůLJŝŶĐůƵĚĞƐƌŽƵƟŶŐǁĂƚĞƌĨƌŽŵƐŚŽǁĞƌƐ͕ƐŝŶŬƐ ĂŶĚǁĂƐŚŝŶŐŵĂĐŚŝŶĞƐ͕ƚƌĞĂƟŶŐƚŚĞǁĂƚĞƌƚŽE^&ϯϱϬƐƚĂŶĚĂƌĚƐ ;ŽƌĞƋƵŝǀĂůĞŶƚͿĂŶĚƌĞƵƐŝŶŐƚŚĞƚƌĞĂƚĞĚŐƌĂLJǁĂƚĞƌǁŝƚŚŝŶƚŚĞ ďƵŝůĚŝŶŐĨŽƌƚŽŝůĞƚŇƵƐŚŝŶŐŽƌĞdžƚĞƌŝŽƌůĂŶĚƐĐĂƉŝŶŐ͘'ƌĂLJǁĂƚĞƌ ƐLJƐƚĞŵƐĂƌĞĞƐƉĞĐŝĂůůLJŽƉƉŽƌƚƵŶĞĂŶĚĐŽƐƚĞīĞĐƟǀĞǁŝƚŚŝŶŶĞǁ ŚŽƚĞůĚĞǀĞůŽƉŵĞŶƚƐĂŶĚŵƵůƟͲĨĂŵŝůLJƌĞƐŝĚĞŶƟĂůĚĞǀĞůŽƉŵĞŶƚƐ ǁŚĞƌĞƚŚĞĐŽŶƐƚĂŶƚƵƐĞŽĨǁĂƚĞƌĨƌŽŵƐŚŽǁĞƌƐ͕ƐŝŶŬƐĂŶĚǁĂƐŚŝŶŐ ŵĂĐŚŝŶĞƐĐĂŶďĞƌĞƵƐĞĚĨŽƌƚŽŝůĞƚŇƵƐŚŝŶŐĂŶĚͬŽƌůĂŶĚƐĐĂƉĞ ŝƌƌŝŐĂƟŽŶ͘ >ŽŶŐ WƌŝǀĂƚĞĞǀĞůŽƉŵĞŶƚ͖ WƵďůŝĐhƟůŝƟĞƐ͖ WƵďůŝĐtŽƌŬƐ͖ WůĂŶŶŝŶŐΘƵŝůĚŝŶŐ ĞǀĞůŽƉĞƌͬŝƚLJ ,Z/E'Z&dKdKZϮϬϭϴͮD/Eн/DW>DEdd/KE | 135 5 d>ϱͳϭ/DW>DEdd/KEd/KEW>E SPECIFIC ACTIONS TIMEFRAME PRIMARY RESPONSIBILITY POTENTIAL &hE/E' ^KhZ^ I.2 Small-scale and Large-scale Cistern and Reuse Systems. WƌŽŵŽƚĞƚŚĞŝŵƉůĞŵĞŶƚĂƟŽŶŽĨĂŚĂƌǀĞƐƚĞĚƌĂŝŶǁĂƚĞƌDWƚŽ ƉƌŽǀŝĚĞĂŵƵůƟͲďĞŶĞĮƚƐŽůƵƟŽŶƚŚĂƚĐŽƵůĚƐĂƟƐĨLJďŽƚŚǁĂƚĞƌ ƋƵĂůŝƚLJƌĞŐƵůĂƟŽŶƐĂŶĚƉƌŽǀŝĚĞĨŽƌĂƐƵƐƚĂŝŶĂďůĞǁĂƚĞƌƋƵĂŶƟƚLJ ƐŽůƵƟŽŶƚŚĂƚǁŽƵůĚŽīƐĞƚƉŽƚĂďůĞǁĂƚĞƌĐŽƐƚƐ͘dŚĞĞĸĐŝĞŶĐLJĂŶĚ ĐŽƐƚͲĞīĞĐƟǀĞŶĞƐƐĨŽƌŚĂƌǀĞƐƚĂŶĚƌĞƵƐĞƐLJƐƚĞŵƐŝŶĐƌĞĂƐĞƐǁŚĞŶ ĐŽŵďŝŶĞĚǁŝƚŚŽŶͲƐŝƚĞŐƌĂLJǁĂƚĞƌƌĞĐLJĐůŝŶŐƐLJƐƚĞŵƐ͘ >ŽŶŐ WƌŝǀĂƚĞĞǀĞůŽƉŵĞŶƚ͖ WƵďůŝĐhƟůŝƟĞƐ͖ WƵďůŝĐtŽƌŬƐ͖ ŝƚLJ I.3 Green Street Features.ŶĐŽƵƌĂŐĞŐƌĞĞŶƐƚƌĞĞƚĚĞƐŝŐŶ ĐŽŵƉŽŶĞŶƚƐƚŚĂƚŵĂLJďĞĨĞĂƐŝďůĞĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ͕ŝŶĐůƵĚŝŶŐ ƐƚŽƌŵǁĂƚĞƌŝŶĮůƚƌĂƟŽŶƉůĂŶƚĞƌƐǁŝƚŚŝŶƉĂƌŬǁĂLJƐƚŽƚƌĞĂƚůŽƚƌƵŶŽī ĂŶĚƌŽĂĚǁĂLJƌƵŶŽīĂƐǁĞůůĂƐƚƌĞĞďŽdžĞƐĂŶĚůŝŐŚƚƌĞŇĞĐƟǀĞƉĂǀŝŶŐ ƐƵƌĨĂĐĞƐǁŚŝĐŚƌĞĚƵĐĞŚĞĂƚŝƐůĂŶĚĞīĞĐƚƐ͘ DĞĚŝƵŵ WƵďůŝĐtŽƌŬƐ ŝƚLJ /͘ϰ>Žǁ/ŵƉĂĐƚĞǀĞůŽƉŵĞŶƚ;>/Ϳ͘/ŶĐŽƌƉŽƌĂƚĞ>/ƐƚƌĂƚĞŐŝĞƐĂŶĚ ƐŽƵƌĐĞĐŽŶƚƌŽůŵĞĂƐƵƌĞƐŝŶƚŽĞdžŝƐƟŶŐƐŝƚĞƐĂŶĚĨƵƚƵƌĞĚĞǀĞůŽƉŵĞŶƚ ǁŚĞƌĞĂƉƉƌŽƉƌŝĂƚĞ͘>/ƐŚŽƵůĚďĞŝŵƉůĞŵĞŶƚĞĚŝŶĂƐLJƐƚĞŵĂƟĐ ŵĂŶŶĞƌƚŚĂƚŵĂdžŝŵŝnjĞƐƚŚĞƵƐĞŽĨ>/ĨĞĂƚƵƌĞƐƚŽƉƌŽǀŝĚĞ ƚƌĞĂƚŵĞŶƚŽĨƐƚŽƌŵǁĂƚĞƌĂŶĚƌĞĚƵĐĞƌƵŶŽīŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞ D^ϰWĞƌŵŝƚ͘ KŶŐŽŝŶŐ WƌŝǀĂƚĞĞǀĞůŽƉŵĞŶƚ͖ WƵďůŝĐtŽƌŬƐ WƌŝǀĂƚĞ ĞǀĞůŽƉŵĞŶƚͬ ŝƚLJ I.5 Green Roofs and Green Walls.WƌŽŵŽƚĞƚŚĞƵƐĞŽĨŐƌĞĞŶƌŽŽĨƐ ĂŶĚŐƌĞĞŶǁĂůůƐǁŚĞƌĞĂƉƉƌŽƉƌŝĂƚĞĨŽƌĂƉƌŽũĞĐƚ͘dŚĞLJŽīĞƌƵƉ ƐŽŵĞŽĨƚŚĞŵŽƐƚĂĚǀĂŶĐĞĚǁĂLJƐƚŽƌĞĚƵĐĞƐƚŽƌŵǁĂƚĞƌƌƵŶŽī ǀŽůƵŵĞƐĂŶĚĐŽŵŵŽŶƉŽůůƵƚĂŶƚƐ͘ƐŽƉĞŶƐƉĂĐĞďĞĐŽŵĞƐŵŽƌĞ ůŝŵŝƚĞĚǁŝƚŚŝŶŚŝŐŚĚĞŶƐŝƚLJĂƌĞĂƐ͕ŐƌĞĞŶƌŽŽĨƐƉƌŽǀŝĚĞĂƐŽůƵƟŽŶ ǁŝƚŚŵĂŶLJĂĚĚŝƟŽŶĂůďĞŶĞĮƚƐŝŶĐůƵĚŝŶŐƐƚŽƌŵǁĂƚĞƌƚƌĞĂƚŵĞŶƚ͕ ŝŶƚĞƌŶĂůĂŶĚĞdžƚĞƌŶĂůĐŽŽůŝŶŐĞīĞĐƚƐĨŽƌƚŚĞďƵŝůĚŝŶŐĂŶĚĂĞƐƚŚĞƟĐ ďĞŶĞĮƚƐ͕ĂůůǁŝƚŚŝŶĂƐŚĂƌĞĚĨŽŽƚƉƌŝŶƚ͘ 'ƌĞĞŶƌŽŽĨƐĂƌĞŵŽƐƚĨĞĂƐŝďůĞǁŚĞŶƚŚĞƌĞŝƐĂƐƚƵƌĚLJďƵŝůĚŝŶŐ ƐƚƌƵĐƚƵƌĞŝŶĐůƵĚĞĚŝŶĂƉƌŽũĞĐƚ͘KŶƚŚĞŽƚŚĞƌŚĂŶĚ͕ŐƌĞĞŶǁĂůůƐ ƌĞƋƵŝƌĞůĞƐƐƐƚƌƵĐƚƵƌĂůƐƚĂďŝůŝƚLJĂŶĚĐĂŶďĞŝŵƉůĞŵĞŶƚĞĚŽŶĂůŵŽƐƚ ĂŶLJǀĞƌƟĐĂůƐƵƌĨĂĐĞ͘^ŽŵĞŽƉƉŽƌƚƵŶŝƟĞƐŝŶĐůƵĚĞŝŵƉůĞŵĞŶƟŶŐ ŐƌĞĞŶǁĂůůƐŽŶƚŚĞƐŝĚĞƐŽĨůĂƌŐĞ͕ĂďŽǀĞͲŐƌŽƵŶĚƉĂƌŬŝŶŐƐƚƌƵĐƚƵƌĞƐ͘ 'ƌĞĞŶƌŽŽĨͬǁĂůůĚĞƐŝŐŶĐĂŶďĞĐŽŵďŝŶĞĚǁŝƚŚŚĂƌǀĞƐƚĂŶĚƌĞƵƐĞ ĐŝƐƚĞƌŶƐĂŶĚŐƌĂLJǁĂƚĞƌƐLJƐƚĞŵƐƚŽƉƌŽǀŝĚĞĂĐŽŶƐƚĂŶƚƐŽƵƌĐĞŽĨ ƚƌĞĂƚĞĚǁĂƚĞƌĨŽƌŝƌƌŝŐĂƟŽŶǁŝƚŚŽƵƚŝŶĐƌĞĂƐŝŶŐĚĞŵĂŶĚƐŽŶůŽĐĂů ĂŶĚƌĞŐŝŽŶĂůƉŽƚĂďůĞǁĂƚĞƌƐƵƉƉůŝĞƐ͘ >ŽŶŐ WƌŝǀĂƚĞĞǀĞůŽƉŵĞŶƚ͖ WƵďůŝĐtŽƌŬƐ͖ WůĂŶŶŝŶŐΘƵŝůĚŝŶŐ WƌŝǀĂƚĞ ĞǀĞůŽƉŵĞŶƚͬ ŝƚLJ /͘ϲ^ĞǁĞƌ^LJƐƚĞŵ/ŵƉƌŽǀĞŵĞŶƚƐ͘hƉͲƐŝnjĞĨŽƵƌƐĞǁĞƌƐĞŐŵĞŶƚƐŽŶ ƚŚĞǁĞƐƚƐŝĚĞŽĨĞĂĐŚŽƵůĞǀĂƌĚ͕ŶŽƌƚŚŽĨĂůůZŽĂĚ;ƐĞĞŚĂƉƚĞƌ ϰ͕dŚĞWůĂŶͿ DĞĚŝƵŵͬ>ŽŶŐ WƵďůŝĐtŽƌŬƐ ŝƚLJ I.7 Water System Improvements.ZĞƉůĂĐĞǁĂƚĞƌůŝŶĞƐĂƐŝĚĞŶƟĮĞĚ ŝŶƚŚĞŝƚLJΖƐtĂƚĞƌ^LJƐƚĞŵWůĂŶĨŽƌůŝŶĞƐǁŝƚŚŝŶŽƌĂĚũĂĐĞŶƚƚŽƚŚĞ ^ƉĞĐŝĮĐWůĂŶďŽƵŶĚĂƌLJ͕ŝŶĐůƵĚŝŶŐƚŚĞƌĞƉůĂĐĞŵĞŶƚŽĨĂǁĂƚĞƌŵĂŝŶ ŽŶ>ŝŶĐŽůŶǀĞŶƵĞ;ƐĞĞŚĂƉƚĞƌϰ͕dŚĞWůĂŶͿ ^ŚŽƌƚͬDĞĚŝƵŵ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ /͘ϴhŶĚĞƌŐƌŽƵŶĚhƟůŝƟĞƐ͘ŽŽƌĚŝŶĂƚĞǁŝƚŚ^ŽŶƚŚĞƵŶĚĞƌ ŐƌŽƵŶĚŝŶŐŽĨĞůĞĐƚƌŝĐĂůůŝŶĞƐĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ͘ŽŶƟŶƵĞƚŽ ƐĞĞŬĨƵŶĚŝŶŐĨŽƌƚŚĞŝŵƉƌŽǀĞŵĞŶƚƐ͘ DĞĚŝƵŵ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ 136 ͮD/Eн/DW>DEdd/KEͮ,Z/E'Z&dKdKZϮϬϭϴ d>ϱͳϭ/DW>DEdd/KEd/KEW>E SPECIFIC ACTIONS TIMEFRAME PRIMARY RESPONSIBILITY POTENTIAL &hE/E' ^KhZ^ ^ƵƐƚĂŝŶĂďŝůŝƚLJĐƟŽŶƐ ^͘ϭWƵďůŝĐhƟůŝƟĞƐ/ŶĐĞŶƟǀĞƐWƌŽŐƌĂŵƐ͘ŽŶƟŶƵĞƚŽŽīĞƌ ƉƵďůŝĐƵƟůŝƚLJƌĞďĂƚĞƐĂŶĚŝŶĐĞŶƟǀĞƐƉƌŽŐƌĂŵƐƚŽ^WƌĞƐŝĚĞŶƚƐ͕ ďƵƐŝŶĞƐƐĞƐĂŶĚƉƌŽƉĞƌƚLJŽǁŶĞƌƐ͘ KŶŐŽŝŶŐ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ S.2 City Green Building.ŽŶƟŶƵĞƚŽŽīĞƌ'ƌĞĞŶƵŝůĚŝŶŐ/ŶĐĞŶƟǀĞƐ ƚŽ^WƌĞƐŝĚĞŶƚƐ͕ďƵƐŝŶĞƐƐĞƐĂŶĚƉƌŽƉĞƌƚLJŽǁŶĞƌƐ͘ KŶŐŽŝŶŐ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ S.3 Youth Center Solar.ĚĚƐŽůĂƌƉĂŶĞůƐŽŶƚŚĞƌŽŽŌŽƉĂŶĚ ƉĂƌŬŝŶŐƐŚĂĚĞƐƚƌƵĐƚƵƌĞƐŽĨƚŚĞtĞƐƚŶĂŚĞŝŵzŽƵƚŚĞŶƚĞƌ͘ DĞĚŝƵŵ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ S.4 Twila Reid Park.ĚĚƐŽůĂƌƐŚĂĚĞƐƚƌƵĐƚƵƌĞƐƚŽƉƌŽǀŝĚĞ ĞůĞĐƚƌŝĐŝƚLJĨŽƌůŝŐŚƟŶŐƚŽŝŶĐƌĞĂƐĞƐĂĨĞƚLJŝŶƚŚĞƉĂƌŬ͘ DĞĚŝƵŵ ŽŵŵƵŶŝƚLJ^ĞƌǀŝĐĞƐ ŝƚLJ S.5 Schweitzer Park.ĚĚƐŽůĂƌƐŚĂĚĞƐƚƌƵĐƚƵƌĞƐĂŶĚƐŽůĂƌƚƌĞĞƐ ƚŽƉƌŽǀŝĚĞĞůĞĐƚƌŝĐŝƚLJĨŽƌĂĚĂƉƟǀĞůŝŐŚƟŶŐ͕ĂŶĚŽƚŚĞƌĂĚǀĂŶĐĞĚ ůŝŐŚƟŶŐƐŽůƵƟŽŶƐƚŽŝŶĐƌĞĂƐĞƐĂĨĞƚLJŝŶƚŚĞƉĂƌŬ͘ DĞĚŝƵŵ ŽŵŵƵŶŝƚLJ^ĞƌǀŝĐĞƐ͖ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ ^͘ϲWĂƌŬŝŶŐ^ƚƌƵĐƚƵƌĞĂƚƚŚĞĐŽƌŶĞƌŽĨKƌĂŶŐĞĂŶĚĞĂĐŚ͘tŽƌŬ ǁŝƚŚƚŚĞƉƌŽƉĞƌƚLJŽǁŶĞƌƚŽĂĚĚƐŽůĂƌƉĂŶĞůƐƚŽƌŽŽŌŽƉŽĨƉĂƌŬŝŶŐ ƐƚƌƵĐƚƵƌĞ͘ DĞĚŝƵŵ WƌŽƉĞƌƚLJKǁŶĞƌ͖ WůĂŶŶŝŶŐΘƵŝůĚŝŶŐ͖ WƵďůŝĐhƟůŝƟĞƐ WƌŽƉĞƌƚLJ KǁŶĞƌ S.7 Sustainable Development.tŽƌŬǁŝƚŚĚĞǀĞůŽƉĞƌƐƚŽ ŝŶĐŽƌƉŽƌĂƚĞƌĞŶĞǁĂďůĞƉŽǁĞƌƐƵƉƉůLJŝŶƐƚĂůůĂƟŽŶƐŝŶƚŽŶĞǁ ƉƌŽũĞĐƚƐ͘ KŶŐŽŝŶŐ WƌŽƉĞƌƚLJKǁŶĞƌ͖ WůĂŶŶŝŶŐΘƵŝůĚŝŶŐ͖ WƵďůŝĐhƟůŝƟĞƐ WƌŽƉĞƌƚLJ KǁŶĞƌ ^͘ϴhƟůŝƚLJĞŵĂŶĚ^ŝĚĞDĂŶĂŐĞŵĞŶƚWƌŽŐƌĂŵ͘ĞǀĞůŽƉĂĚĞŵĂŶĚ ƐŝĚĞŵĂŶĂŐĞŵĞŶƚƉƌŽŐƌĂŵƚŚĂƚĚĞƐĐƌŝďĞƐƚŚĞĞdžŝƐƟŶŐĐŝƚLJͲǁŝĚĞ ƉƌŽŐƌĂŵƐƚŚĂƚĂƌĞĂǀĂŝůĂďůĞŝŶƚŚĞ^WĂƌĞĂ͕ĂŶĚĚĞƚĂŝůƐŚŽǁƚŚĞLJ ĐĂŶďĞĂƉƉůŝĞĚƐƉĞĐŝĮĐĂůůLJƚŽƚŚĞ^WĂƌĞĂ͘ ^ŚŽƌƚ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ ^͘ϵĞŵĂŶĚZĞƐƉŽŶƐĞƉƌŽŐƌĂŵ͘ĞǀĞůŽƉĂĚĞŵĂŶĚƉƌŽŐƌĂŵƚŚĂƚ ĞŶĐŽƵƌĂŐĞƐĞŶĚͲƵƐĞƌƐƚŽŵĂŬĞƐŚŽƌƚͲƚĞƌŵƌĞĚƵĐƟŽŶƐŝŶĞŶĞƌŐLJƵƐĞ ĚƵƌŝŶŐƐƉĞĐŝĮĐŚŽƵƌƐ͘ DĞĚŝƵŵ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ ^͘ϭϬEĞƚĞƌŽŶĞƌŐLJ͘ŽŶƐŝĚĞƌĂĚŽƉƟŶŐƚŚĞǀŽůƵŶƚĂƌLJƌĞƐŝĚĞŶƟĂů ŶĞƚnjĞƌŽĞŶĞƌŐLJ;EͿƟĞƌŽĨƚŚĞϮϬϭϲ>'ƌĞĞŶƵŝůĚŝŶŐŽĚĞĨŽƌ ƚŚĞ^WĂƌĞĂ͕ǁŚŝĐŚĐĂŶďĞĂƉƉůŝĞĚƚŽďŽƚŚƚƌĂĚŝƟŽŶĂůƌĞƐŝĚĞŶƟĂů ĚĞǀĞůŽƉŵĞŶƚĂƐǁĞůůĂƐŚŽƚĞůƐͬŵŽƚĞůƐ͘ ^ŚŽƌƚ WůĂŶŶŝŶŐΘƵŝůĚŝŶŐ EŽŽƐƚ ^͘ϭϭŝͲ>ĞǀĞůĚĂƉƟǀĞ>ŝŐŚƟŶŐ͘/ŶƐƚĂůůŝͲůĞǀĞůĂĚĂƉƟǀĞĞdžƚĞƌŝŽƌ ůŝŐŚƟŶŐŝŶƉƵďůŝĐĂƌĞĂƐƐƵĐŚĂƐƉĂƌŬƐĂŶĚƚŚĞtĞƐƚŶĂŚĞŝŵzŽƵƚŚ ĞŶƚĞƌŝŶƚŚĞ^WĂƌĞĂƚŽĚĞĐƌĞĂƐĞĞŶĞƌŐLJĐŽŶƐƵŵƉƟŽŶĂŶĚ ŝŶĐƌĞĂƐĞƐĂĨĞƚLJ͘ >ŽŶŐ ŽŵŵƵŶŝƚLJ^ĞƌǀŝĐĞƐ͖ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ ^͘ϭϮĚǀĂŶĐĞĚ>ŝŐŚƟŶŐƉƉůŝĐĂƟŽŶ/ŶĐĞŶƟǀĞƐ͘ĞǀĞůŽƉŝŶĐĞŶƟǀĞƐ ƚŽŝŶĐŽƌƉŽƌĂƚĞŶĞǁŽƌƌĞƚƌŽĮƚůŝŐŚƟŶŐĂƚƚŚĞŚŽƐƉŝƚĂů͕ŚŽƚĞůͬ ŵŽƚĞůƐ͕ĂŶĚŽƚŚĞƌĐŽŵŵĞƌĐŝĂůďƵŝůĚŝŶŐƐƚŽĐŽŶƐĞƌǀĞĞŶĞƌŐLJ͕ƌĞĚƵĐĞ ŐƌĞĞŶŚŽƵƐĞŐĂƐĞŵŝƐƐŝŽŶƐ͕ĂŶĚĞŶŚĂŶĐĞŚĞĂůƚŚĂŶĚƐĂĨĞƚLJĨŽƌƚŚĞ ĐŽŵŵƵŶŝƚLJ͘ DĞĚŝƵŵ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ S.13 CALSTART Partnership.tŽƌŬǁŝƚŚKƌĂŶŐĞŽƵŶƚLJdƌĂŶƐŝƚ ƵƚŚŽƌŝƚLJ;KdͿƚŽďĞĐŽŵĞĂŵĞŵďĞƌŽĨ>^dZd͕ĂŶŽŶƉƌŽĮƚ ƐƚƌĂƚĞŐŝĐďƌŽŬĞƌĨŽƌĐůĞĂŶƚƌĂŶƐƉŽƌƚĂƟŽŶ͘ŽŶƟŶƵĞƚŽƐƵƉƉŽƌƚ ŶĂŚĞŝŵZĞƐŽƌƚdƌĂŶƐƉŽƌƚĂƟŽŶΖƐ;ZdΖƐͿŵĞŵďĞƌƐŚŝƉŝŶ>^dZd͘ ^ŚŽƌƚ WƵďůŝĐtŽƌŬƐ ŝƚLJ ,Z/E'Z&dKdKZϮϬϭϴͮD/Eн/DW>DEdd/KE | 137 5 d>ϱͳϭ/DW>DEdd/KEd/KEW>E SPECIFIC ACTIONS TIMEFRAME PRIMARY RESPONSIBILITY POTENTIAL &hE/E' ^KhZ^ ^͘ϭϰůĞĐƚƌŝĐsĞŚŝĐůĞŚĂƌŐŝŶŐ^ƚĂƟŽŶƐ;s^Ϳ͘WƌŽŵŽƚĞĞdžŝƐƟŶŐ ŶĂŚĞŝŵWƵďůŝĐhƟůŝƟĞƐ;WhͿŝŶĐĞŶƟǀĞƐƚŽŝŶƐƚĂůůs^ŝŶŶĞǁĂŶĚ ƌĞƚƌŽĮƚƉƌŽũĞĐƚƐ͘ KŶŐŽŝŶŐ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ ^͘ϭϱ,LJĚƌŽŐĞŶ&ƵĞůŝŶŐ^ƚĂƟŽŶ͘ŽŶĚƵĐƚĂƐƚƵĚLJǁŝƚŚŝŶƚŚĞ^W ĂƌĞĂƚŽĚĞƚĞƌŵŝŶĞƚŚĞĨĞĂƐŝďŝůŝƚLJŽĨŝŶƐƚĂůůŝŶŐĂŚLJĚƌŽŐĞŶĨƵĞůŝŶŐ ƐƚĂƟŽŶǁŝƚŚŝŶƚŚĞWůĂŶŶŝŶŐƌĞĂƚŽŚĞůƉĞdžƉĂŶĚƚŚĞ͞ŚLJĚƌŽŐĞŶ ŚŝŐŚǁĂLJ͘͟ >ŽŶŐ WƌŝǀĂƚĞĞǀĞůŽƉŵĞŶƚ ŝƚLJ ^͘ϭϲŽŵƉƌĞƐƐĞĚEĂƚƵƌĂů'ĂƐ;E'Ϳ&ƵĞůŝŶŐ^ƚĂƟŽŶƐ͘tŽƌŬǁŝƚŚ ĞdžŝƐƟŶŐŐĂƐƐƚĂƟŽŶƐǁŝƚŚŝŶƚŚĞ^WĂƌĞĂƚŽŝŶƐƚĂůůE'ĨƵĞůŝŶŐ ƐƚĂƟŽŶƐƚŽĂĚǀĂŶĐĞĂůƚĞƌŶĂƟǀĞĐůĞĂŶŵŽĚĞƐŽĨƚƌĂŶƐƉŽƌƚĂƟŽŶĂŶĚ ƌĞĚƵĐĞ','ĞŵŝƐƐŝŽŶƐ͘ ^ŚŽƌƚ WƌŝǀĂƚĞĞǀĞůŽƉŵĞŶƚ ŝƚLJ ^͘ϭϳhƉŐƌĂĚĞtĂƚĞƌDĞƚĞƌƐ͘hƉŐƌĂĚĞǁĂƚĞƌŵĞƚĞƌƐŽŶĂůůƉƵďůŝĐůLJͲ ŽǁŶĞĚůĂŶĚŝŶƚŚĞ^WĂƌĞĂƚŽǁĞĂƚŚĞƌďĂƐĞĚŽƌƐŽŝůƐƐĞŶƐŝŶŐ ŵĞƚĞƌƐ͕ĂŶĚǁŽƌŬǁŝƚŚƉƌŝǀĂƚĞƉƌŽƉĞƌƚLJŽǁŶĞƌƐƚŽĚŽƚŚĞƐĂŵĞ͘ dŚĞƌĞĂƌĞƐƵďƐƚĂŶƟĂůǁĂƚĞƌĐŽŶƐĞƌǀĂƟŽŶ͕ĞŶĞƌŐLJƐĂǀŝŶŐƐ͕ĂŶĚ ŐƌĞĞŶŚŽƵƐĞŐĂƐƌĞĚƵĐƟŽŶŽƉƉŽƌƚƵŶŝƟĞƐĂƐƐŽĐŝĂƚĞĚǁŝƚŚŝŶƐƚĂůůŝŶŐ ǁĞĂƚŚĞƌͲďĂƐĞĚŝƌƌŝŐĂƟŽŶĐŽŶƚƌŽůůĞƌƐ͘ dŚĞŝƚLJĐŽƵůĚĞdžƉůŽƌĞĂƉŝůŽƚƉƌŽũĞĐƚƐŝŵŝůĂƌƚŽƚŚĞDĞƚƌŽƉŽůŝƚĂŶ tĂƚĞƌŝƐƚƌŝĐƚ;DtͿĨƵŶĚĞĚƉƌŽŐƌĂŵǁŝƚŚƚŚĞhĂǀŝƐŶĞƌŐLJ ĸĐŝĞŶĐLJĞŶƚĞƌͬtĂƚĞƌŶĞƌŐLJĸĐŝĞŶĐLJĞŶƚĞƌ͘dŚŝƐƉƌŽŐƌĂŵ ŝŵƉůĞŵĞŶƚƐǁĞĂƚŚĞƌͲďĂƐĞĚŵĞƚĞƌƌĞƚƌŽĮƚƐŝŶƚĞƐƚĂƌĞĂƐŝŶ ĞdžĐŚĂŶŐĞĨŽƌƌĞĐĞŝǀŝŶŐĚĂƚĂƚŚĂƚŵĞĂƐƵƌĞƐƚŚĞĞīĞĐƟǀĞŶĞƐƐŽĨƚŚĞ ƌĞƚƌŽĮƚƵƉŐƌĂĚĞƐ͘ ^ŚŽƌƚ WƵďůŝĐhƟůŝƟĞƐ ŝƚLJ ^͘ϭϴƌŝŵĞWƌĞǀĞŶƟŽŶdŚƌŽƵŐŚŶǀŝƌŽŶŵĞŶƚĂůĞƐŝŐŶ;WdͿ͘ /ŶĐůƵĚĞĂƵĚŝďůĞĨƵŶĐƟŽŶƐĂŶĚĐĂŵĞƌĂƐŽŶůŽĐĂůƉĂƌŬůŝŐŚƟŶŐ͘ ^ƚĂŶĚĂƌĚƐĂŶĚŐƵŝĚĞůŝŶĞƐĨŽƌĚĞǀĞůŽƉŵĞŶƚ͕ƐŝƚĞĚĞƐŝŐŶ͕ĂŶĚ ůĂŶĚƐĐĂƉŝŶŐƐŚŽƵůĚĂůƐŽĐŽŶƐŝĚĞƌWdƉƌŝŶĐŝƉůĞƐ͘ DĞĚŝƵŵ WůĂŶŶŝŶŐΘƵŝůĚŝŶŐ WŽůŝĐĞ ŝƚLJ 138 ͮD/Eн/DW>DEdd/KEͮ,Z/E'Z&dKdKZϮϬϭϴ 1ĂƐĞĚŽŶŽŶĮĚĞŶƟĂůDŽƚĞů^ƚƵĚLJĂƚĂ͕ǁŚŝĐŚĨŽƵŶĚƚŽƚĂůĂŶŶƵĂů ƌĞǀĞŶƵĞŽĨΨϳ͘ϬϲŵŝůůŝŽŶĨŽƌƐĞůĞĐƚĞĚĞĂĐŚŽƵůĞǀĂƌĚƉƌŽƉĞƌƟĞƐ͘ 2 ŚƩƉ͗ͬͬǁǁǁ͘ĂŶĂŚĞŝŵ͘ŶĞƚͬŽĐƵŵĞŶƚĞŶƚĞƌͬ,ŽŵĞͬsŝĞǁͬϱϮϳ 5.11.4 Potential Funding Mechanisms /ŶĂĚĚŝƟŽŶƚŽŝƚLJĨƵŶĚŝŶŐĂŶĚŽƚŚĞƌƐŽƵƌĐĞƐŶŽƚĞĚŝŶ dĂďůĞϱͲϭ͕ƚŚĞƌĞĂƌĞĂŶƵŵďĞƌŽĨŐƌĂŶƚ͕ůŽĂŶ͕ĂŶĚǀĂůƵĞ ĐĂƉƚƵƌĞĨƵŶĚŝŶŐŵĞĐŚĂŶŝƐŵƐƚŚĂƚĐŽƵůĚďĞƵƟůŝnjĞĚƚŽ ŝŵƉůĞŵĞŶƚƐĞǀĞƌĂůŽĨƚŚĞŝŵƉůĞŵĞŶƚĂƟŽŶĂĐƟŽŶƐŽĨ ƚŚŝƐ^ƉĞĐŝĮĐWůĂŶ͘ >ŽĐĂůdĂdž/ŶĐƌĞŵĞŶƚĂŶĚƐƐĞƐƐŵĞŶƚŝƐƚƌŝĐƚƐ Taxing Agencies Economic Development Fund dŚĞŝƚLJŝƐĐƵƌƌĞŶƚůLJŶĞŐŽƟĂƟŶŐǁŝƚŚŽƚŚĞƌƌĞůĞǀĂŶƚ ƚĂdžŝŶŐĂŐĞŶĐŝĞƐƚŽĐƌĞĂƚĞĂŶĞĐŽŶŽŵŝĐĚĞǀĞůŽƉŵĞŶƚ ĨƵŶĚĨŽƌƵƐĞĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ͘dŚŝƐƵŶŝƋƵĞǀĂůƵĞ ĐĂƉƚƵƌĞĂŐƌĞĞŵĞŶƚǁŽƵůĚƉƌŽǀŝĚĞƚŚĞŝƚLJǁŝƚŚƚŚĞ ŶĞĐĞƐƐĂƌLJĨƵŶĚƐƚŽďƵLJĂŐŝŶŐŵŽƚĞůƐŽƌŝŵƉůĞŵĞŶƚĂ ǀĂƌŝĞƚLJŽĨŽƚŚĞƌŝŵƉƌŽǀĞŵĞŶƚƐ͘ ƵƐŝŶĞƐƐ/ŵƉƌŽǀĞŵĞŶƚŝƐƚƌŝĐƚ;/Ϳ  ƵƐŝŶĞƐƐ /ŵƉƌŽǀĞŵĞŶƚ ŝƐƚƌŝĐƚ ;/Ϳ ŝƐ Ă ĐŽŵŵŽŶ ƚLJƉĞ ŽĨ ^ƉĞĐŝĂů ƐƐĞƐƐŵĞŶƚ ŝƐƚƌŝĐƚ ƚŚĂƚ ĂƐƐĞƐƐĞƐ ďƵƐŝŶĞƐƐ ĂŶĚͬŽƌ ƉƌŽƉĞƌƚLJ ŽǁŶĞƌƐ ƚŽ ĨƵŶĚ ŵĂŝŶƚĞŶĂŶĐĞ͕ŵĂƌŬĞƟŶŐ͕ĂŶĚŽƚŚĞƌƉƵďůŝĐƐĞƌǀŝĐĞƐŽƌ ŝŵƉƌŽǀĞŵĞŶƚƐ͘/ĨƐƵĐŚĂŝƐƚƌŝĐƚǁĞƌĞƚŽďĞĨŽƌŵĞĚŝŶ tĞƐƚŶĂŚĞŝŵĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚ͕ĨƵŶĚŝŶŐĐŽƵůĚ ďĞƵƐĞĚƚŽĞŶŚĂŶĐĞƐĂŶŝƚĂƟŽŶĂŶĚĐůĞĂŶŝŶŐ͕ĂƐǁĞůůĂƐ ŝŵƉƌŽǀĞƚŚĞƐƚƌĞĞƚƐĐĂƉĞĂŶĚƉĞĚĞƐƚƌŝĂŶĞdžƉĞƌŝĞŶĐĞ͘  ƐŝŵŝůĂƌ ŶĂŚĞŝŵ dŽƵƌŝƐŵ /ŵƉƌŽǀĞŵĞŶƚ ŝƐƚƌŝĐƚ ;d/Ϳ ǁĂƐ ĞƐƚĂďůŝƐŚĞĚ ďLJ ƚŚĞ ŝƚLJ ŽƵŶĐŝů ŝŶ ^ĞƉƚĞŵďĞƌϮϬϭϬ͕ĞƐƚĂďůŝƐŚŝŶŐĂϮƉĞƌĐĞŶƚĂƐƐĞƐƐŵĞŶƚ ŽŶŚŽƚĞůƌŽŽŵ͞ƌĞŶƚƐ͟ĨŽƌĂůůůŽĚŐŝŶŐƐůŽĐĂƚĞĚǁŝƚŚŝŶ dŚĞ ŶĂŚĞŝŵ ZĞƐŽƌƚΡ ĂŶĚ ƚŚĞ WůĂƟŶƵŵ dƌŝĂŶŐůĞ ďŽƵŶĚĂƌŝĞƐ͘ LJ ůĂǁ͕ ĂƐƐĞƐƐŵĞŶƚƐ ŝŶ ƚŚĞƐĞ ĚŝƐƚƌŝĐƚƐ ĂƌĞŶŽƚƚĂdžĞƐĨŽƌƚŚĞŐĞŶĞƌĂůďĞŶĞĮƚŽĨƚŚĞŝƚLJ͕ďƵƚ ƌĂƚŚĞƌ ĂŶ ĂƐƐĞƐƐŵĞŶƚ ĨŽƌ ŝŵƉƌŽǀĞŵĞŶƚƐ͕ ƐĞƌǀŝĐĞƐ͕ ĂŶĚƉƌŽŐƌĂŵƐƚŚĂƚǁŝůůĚŝƌĞĐƚůLJďĞŶĞĮƚƚŚĞĂƐƐĞƐƐĞĚ ĨĂĐŝůŝƟĞƐǁŝƚŚŝŶƚŚĞĚŝƐƚƌŝĐƚ͘ ĚŝƐƚƌŝĐƚĐĂŶďĞĞƐƚĂďůŝƐŚĞĚĂŶĚĂŶĂĚǀŝƐŽƌLJďŽĂƌĚ ĂƉƉŽŝŶƚĞĚĂƐůŽŶŐĂƐŝƚŝƐŶŽƚƉƌŽƚĞƐƚĞĚďLJĂŵĂũŽƌŝƚLJŽĨ ƉƌŽƉĞƌƚLJŽǁŶĞƌƐ͘ĂƐĞĚŽŶƚŽƚĂů'ƌŽƐƐZŽŽŵZĞĐĞŝƉƚƐ ĨŽƌŵŽƚĞůƉƌŽƉĞƌƟĞƐŝŶϮϬϭϰ͕ĂĞĂĐŚŽƵůĞǀĂƌĚ dŽƵƌŝƐŵ/ŵƉƌŽǀĞŵĞŶƚŝƐƚƌŝĐƚǁŝƚŚĂƐŝŵŝůĂƌϮƉĞƌĐĞŶƚ ĂƐƐĞƐƐŵĞŶƚĐŽƵůĚƌĂŝƐĞŽǀĞƌΨϭϰϬ͕ϬϬϬƉĞƌLJĞĂƌĨŽƌ ĞdžƚƌĂƐĂŶŝƚĂƟŽŶĂŶĚƐƚƌĞĞƚƐĐĂƉĞŝŵƉƌŽǀĞŵĞŶƚƐ͘1 >ĂŶĚƐĐĂƉĞĂŶĚ>ŝŐŚƟŶŐŝƐƚƌŝĐƚ  >ĂŶĚƐĐĂƉĞ ĂŶĚ >ŝŐŚƟŶŐ ŝƐƚƌŝĐƚ ĂůŽŶŐ ĞĂĐŚ ŽƵůĞǀĂƌĚĐŽƵůĚĂůƐŽŚĞůƉƚŽŝŵƉƌŽǀĞƚŚĞƐƚƌĞĞƚƐĐĂƉĞ ďLJĨƵŶĚŝŶŐƚŚĞŶĞǁƐƚƌĞĞƚůŝŐŚƚƐĂŶĚƚƌĂĸĐƐŝŐŶĂůƐ͕ ůĂŶĚƐĐĂƉŝŶŐ͕ƉĂƌŬǁĂLJƐ͕ŵĞĚŝĂŶƐ͕ĚƌĂŝŶĂŐĞĨĂĐŝůŝƟĞƐ͕ ĂŶĚŐƌĂĸƟƌĞŵŽǀĂů͘dŽĨŽƌŵƐƵĐŚĂĚŝƐƚƌŝĐƚŝŶtĞƐƚ ŶĂŚĞŝŵ͕ƚŚĞƐƉŽŶƐŽƌŝŶŐĂŐĞŶĐLJ;Ğ͘Ő͕͘ŝƚLJŽĨŶĂŚĞŝŵͿ ǁŽƵůĚĐŽŶĚƵĐƚĂƐƚƵĚLJ͕ƉƌĞƉĂƌĞĂŶĞŶŐŝŶĞĞƌ͛ƐƌĞƉŽƌƚ ĂŶĚƉƌŽƉŽƐĞƚŚĞĨŽƌŵĂƟŽŶŽĨĂĚŝƐƚƌŝĐƚĂŶĚƚŚĞůĞǀLJŽĨ ĂƐƐĞƐƐŵĞŶƚƐ͘īĞĐƚĞĚƉƌŽƉĞƌƚLJŽǁŶĞƌƐǁŽƵůĚƚŚĞŶ ďĞŶŽƟĮĞĚŽĨĂƉƵďůŝĐŚĞĂƌŝŶŐƚŽĂĚĚƌĞƐƐĐŽŶĐĞƌŶƐ͘ &Žƌ ĐŽŵŵĞƌĐŝĂů ƉƌŽƉĞƌƟĞƐ ƐŝŵŝůĂƌ ƚŽ ƚŚŽƐĞ ĂůŽŶŐ ĞĂĐŚ ŽƵůĞǀĂƌĚ͕ ĨƵŶĚŝŶŐ ŝƐ ƚLJƉŝĐĂůůLJ ĂƐƐĞƐƐĞĚ ďLJ ͞&ƌŽŶƚ&ŽŽƚĂŐĞ͕͟ŽƌŽŶĂůŽƚĨƌŽŶƚĨŽŽƚďĂƐŝƐ͘ ŽŵŵƵŶŝƚLJ&ĂĐŝůŝƟĞƐŝƐƚƌŝĐƚƐ;&ƐͿ ^ŝŵŝůĂƌ ƚŽ ĂƐƐĞƐƐŵĞŶƚ ĚŝƐƚƌŝĐƚƐ͕ DĞůůŽͲZŽŽƐ ďŽŶĚƐ ĂƌĞ ƵƐĞĚ ƚŽ ĮŶĂŶĐĞ ƚŚĞ ĐŽŶƐƚƌƵĐƟŽŶ ŽĨ ŶĞĞĚĞĚ ĐŽŵŵƵŶŝƚLJŝŶĨƌĂƐƚƌƵĐƚƵƌĞƚŚƌŽƵŐŚƚŚĞĐƌĞĂƟŽŶŽĨĂ ŽŵŵƵŶŝƚLJ&ĂĐŝůŝƟĞƐŝƐƚƌŝĐƚ͘&ŝƐĨŽƌŵĞĚǁŚĞŶ ƚŚĞ ƉƌŽƉĞƌƚLJ ŽǁŶĞƌƐ ŝŶ Ă ŐĞŽŐƌĂƉŚŝĐĂů ĂƌĞĂ ĂŐƌĞĞ ƚŽŝŵƉŽƐĞĂƚĂdžŽŶƚŚĞůĂŶĚƚŽĨƵŶĚŝŶĨƌĂƐƚƌƵĐƚƵƌĞ ŝŵƉƌŽǀĞŵĞŶƚƐ͘hŶůŝŬĞĂƐƐĞƐƐŵĞŶƚĚŝƐƚƌŝĐƚƐ͕ŚŽǁĞǀĞƌ͕ &ƐĂƌĞŵŽƐƚĐŽŵŵŽŶůLJĨŽƌŵĞĚŝŶĐĂƐĞƐŝŶǁŚŝĐŚ ƚŚĞŐĞŽŐƌĂƉŚŝĐĂƌĞĂĞŶĐŽŵƉĂƐƐĞƐĂƐŵĂůůŶƵŵďĞƌŽĨ ƉƌŽƉĞƌƚLJŽǁŶĞƌƐǁŚŽŝŶƚĞŶĚƚŽƐƵďĚŝǀŝĚĞƚŚĞůĂŶĚĨŽƌ ƐĂůĞ͘dŽďĞĞŶĂĐƚĞĚ͕&ƐƌĞƋƵŝƌĞĂƉƵďůŝĐǀŽƚĞǁŝƚŚĂ ƚǁŽͲƚŚŝƌĚƐŵĂũŽƌŝƚLJ͕ǁŚŝĐŚĐĂŶďĞĂĚŝĸĐƵůƚŚƵƌĚůĞ͘ DĞůůŽͲZŽŽƐůĂǁĂůůŽǁƐƚŚĞƚĂdžĞƐƚŽďĞƉƌŽƉŽƌƟŽŶĂůůLJ ƐƵďĚŝǀŝĚĞĚĂŶĚƉĂƐƐĞĚŽŶƚŽĨƵƚƵƌĞůĂŶĚŽǁŶĞƌƐ͘dŚĞ ƌĞǀĞŶƵĞ ĐĂŶ ƚŚĞŶ ďĞ ƵƐĞĚ ĞŝƚŚĞƌ ĨŽƌ ƉĂLJͲĂƐͲLJŽƵͲ ŐŽ ĨƵŶĚŝŶŐ Žƌ ƚŽ ƉĂLJ Žī ďŽŶĚƐ ŝƐƐƵĞĚ ĂŐĂŝŶƐƚ ƚŚĞ ĂŶƟĐŝƉĂƚĞĚƌĞǀĞŶƵĞĨƌŽŵƚŚĞ&͘ KƚŚĞƌ>ŽĐĂů^ŽƵƌĐĞƐŽĨ&ƵŶĚƐ Development Impact Fees ĞǀĞůŽƉŵĞŶƚ ŝŵƉĂĐƚ ĨĞĞƐ ĂƌĞ ĂŶŽƚŚĞƌ ƉŽƚĞŶƟĂů ĨƵŶĚŝŶŐ ƐŽƵƌĐĞ ĨŽƌ ĂīŽƌĚĂďůĞ ŚŽƵƐŝŶŐ͕ ƉĂƌŬƐ͕ ĂŶĚ ŽƚŚĞƌĂŵĞŶŝƟĞƐ͘dŚĞƐĞĨĞĞƐ͕ƉĂŝĚďLJŶĞǁƌĞƐŝĚĞŶƟĂů ĂŶĚ ĐŽŵŵĞƌĐŝĂů ĚĞǀĞůŽƉŵĞŶƚ ƉƌŽũĞĐƚƐ͕ ŵƵƐƚ ŽŶůLJ ďĞƵƐĞĚƚŽƉĂLJĨŽƌŝŵƉƌŽǀĞŵĞŶƚƐƚŚĂƚĐĂŶďĞ ĚĞŵŽŶƐƚƌĂƚĞĚƚŽƐĞƌǀĞŶĞǁƌĞƐŝĚĞŶƚƐĂŶĚďƵƐŝŶĞƐƐĞƐ͘ ŶĞdžƵƐƐƚƵĚLJ͕ǁŚŝĐŚĐĂůĐƵůĂƚĞƐƚŚĞŶĞǁŝŶĐƌĞŵĞŶƚ 3 ŚƩƉ͗ͬͬǁǁǁ͘ƐŐĐ͘ĐĂ͘ŐŽǀͬƌĞƐŽƵƌĐĞйϮϬ ĮůĞƐͬϭϬϭϭϮϬϭϲ,^&zϭϱϭϲƉƉĞŶĚŝdž͘ƉĚĨ 4ŚƩƉ͗ͬͬǁǁǁ͘ƐŐĐ͘ĐĂ͘ŐŽǀͬ'ƌĂŶƚͲWƌŽŐƌĂŵƐͬ,^Ͳ'ƵŝĚĞůŝŶĞƐ͘Śƚŵů 5ŚƩƉ͗ͬͬĞĐϮͲϱϮͲϯϵͲϮϮϮͲϳϳ͘ƵƐͲǁĞƐƚͲϮ͘ĐŽŵƉƵƚĞ͘ĂŵĂnjŽŶĂǁƐ͘ĐŽŵͬŝďĂŶŬͬ programs/isrf ,Z/E'Z&dKdKZϮϬϭϴͮD/Eн/DW>DEdd/KE | 139 5 ŽĨ ĚĞǀĞůŽƉŵĞŶƚ͕ ĞƐƟŵĂƚĞƐ ƚŚĞ ƉŽƌƟŽŶ ŽĨ ĂŶ ŝŵƉƌŽǀĞŵĞŶƚƉƌŽũĞĐƚĂƩƌŝďƵƚĂďůĞƚŽƚŚĂƚŝŶĐƌĞŵĞŶƚ ŽĨ ŐƌŽǁƚŚ͕ ĂŶĚ ĂůůŽĐĂƚĞƐ ƚŚĞ ĨĞĞ ĂŵŽŶŐ ƚŚĞ ŶĞǁ ĚĞǀĞůŽƉŵĞŶƚ ƉƌŽũĞĐƚƐ ďLJ ůĂŶĚ ƵƐĞ͕ ŝƐ ƌĞƋƵŝƌĞĚ ďLJ ƐƚĂƚĞůĂǁĨŽƌŝŵƉůĞŵĞŶƚĂƟŽŶ͘ dŚĞ ŝƚLJ ŽĨ ŶĂŚĞŝŵ ĂůƌĞĂĚLJ ĐŽůůĞĐƚƐ ŝŵƉĂĐƚ ĨĞĞƐ ŽŶŶĞǁĐŽŶƐƚƌƵĐƟŽŶĨŽƌŝŶĨƌĂƐƚƌƵĐƚƵƌĞĂŶĚŽƚŚĞƌ ŝŵƉƌŽǀĞŵĞŶƚƐ͕ ƌĞŐĂƌĚůĞƐƐ ŽĨ ŐĞŽŐƌĂƉŚLJ ǁŝƚŚŝŶ ƚŚĞ ŝƚLJ͘ϮWĂƌŬĂŶĚZĞĐƌĞĂƟŽŶĨĞĞŝƐĂůƐŽĂƉƉůŝĞĚƚŽŶĞǁ ƌĞƐŝĚĞŶƟĂůĐŽŶƐƚƌƵĐƟŽŶŽŶĂƉĞƌƵŶŝƚďĂƐŝƐ͘'ŝǀĞŶƚŚĞ ůĂĐŬŽĨŶĞǁĚĞǀĞůŽƉŵĞŶƚĂůŽŶŐĞĂĐŚŽƵůĞǀĂƌĚŽǀĞƌ ƚŚĞƉĂƐƚƐĞǀĞƌĂůĚĞĐĂĚĞƐ͕ŚŽǁĞǀĞƌ͕ŝŶƐƟƚƵƟŶŐŶĞǁ ŝŵƉĂĐƚĨĞĞƐĂďŽǀĞĂŶĚďĞLJŽŶĚƚŚŽƐĞĞdžŝƐƟŶŐŵŝŐŚƚ ƐĞƌǀĞƚŽŚŝŶĚĞƌŐƌŽǁƚŚŝŶƚŚĞĂƌĞĂĞǀĞŶĨƵƌƚŚĞƌ͘ ZĞŐŝŽŶĂůĂŶĚ^ƚĂƚĞ^ŽƵƌĐĞƐŽĨ&ƵŶĚƐ īŽƌĚĂďůĞ ,ŽƵƐŝŶŐ ĂŶĚ ^ƵƐƚĂŝŶĂďůĞ ŽŵŵƵŶŝƟĞƐ ;,^Ϳ dŚĞ'ůŽďĂůtĂƌŵŝŶŐ^ŽůƵƟŽŶƐĐƚƐ;ϯϮͿĞƐƚĂďůŝƐŚĞĚ ĂĐĂƉĂŶĚƚƌĂĚĞƐLJƐƚĞŵŝŶĂůŝĨŽƌŶŝĂ͕ǁŚŽƐĞƉƌŽĐĞĞĚƐ ĂƌĞĚĞƉŽƐŝƚĞĚŝŶƚŽĂ'ƌĞĞŶŚŽƵƐĞ'ĂƐZĞĚƵĐƟŽŶ&ƵŶĚ ;''Z&Ϳ͘hƐŝŶŐƌĞǀĞŶƵĞĨƌŽŵƚŚĞ''Z&͕ƚŚĞīŽƌĚĂďůĞ ,ŽƵƐŝŶŐ ĂŶĚ ^ƵƐƚĂŝŶĂďůĞ ŽŵŵƵŶŝƟĞƐ ;,^Ϳ ƉƌŽŐƌĂŵĨƵŶĚƐůĂŶĚͲƵƐĞ͕ŚŽƵƐŝŶŐ͕ĂŶĚƚƌĂŶƐƉŽƌƚĂƟŽŶ ƉƌŽũĞĐƚƐƚŚĂƚƐƵƉƉŽƌƚŝŶĮůůĂŶĚĐŽŵƉĂĐƚĚĞǀĞůŽƉŵĞŶƚ ƚŽƌĞĚƵĐĞŐƌĞĞŶŚŽƵƐĞŐĂƐ;Η','ΗͿĞŵŝƐƐŝŽŶƐ͘ ƉƉƌŽdžŝŵĂƚĞůLJ ΨϯϮϬ ŵŝůůŝŽŶ ŝŶ ,^ ĨƵŶĚŝŶŐ ǁĂƐ ĂŶŶŽƵŶĐĞĚŝŶ&zϮϬϭϱͲϭϲ͖ƌĞĐŝƉŝĞŶƚƐǁĞƌĞĂŶŶŽƵŶĐĞĚ ŝŶ KĐƚŽďĞƌ ϮϬϭϲ͘ ϯ ƵƌŝŶŐ ƐƵďƐĞƋƵĞŶƚ ĨƵŶĚŝŶŐ ƌŽƵŶĚƐ͕ ƉŽƚĞŶƟĂů ƉƌŽũĞĐƚƐ ĂůŽŶŐ ĞĂĐŚ ŽƵůĞǀĂƌĚ ĐŽƵůĚ ŝŶĐůƵĚĞ ƚŚĞ ĂĐƋƵŝƐŝƟŽŶ ĂŶĚ ƌĞŚĂďŝůŝƚĂƟŽŶ ŽĨ ĂīŽƌĚĂďůĞ ŚŽƵƐŝŶŐ͘ īŽƌĚĂďůĞ ŚŽƵƐŝŶŐ ĚĞǀĞůŽƉĞƌƐ͕ ƚŚĞŶĂŚĞŝŵ,ŽƵƐŝŶŐƵƚŚŽƌŝƚLJ͕ĂŶĚͬŽƌƚŚĞŝƚLJĂƌĞ Ăůů ĞůŝŐŝďůĞ ĂƉƉůŝĐĂŶƚƐ͘ dŚĞ ƌĞůĞĂƐĞ ŽĨ Ă ϮϬϭϲͲϮϬϭϳ ,^EK&ĂŶĚĂƉƉůŝĐĂƟŽŶĂƌĞĞdžƉĞĐƚĞĚƚŽŽĐĐƵƌŝŶ ƚŚĞĨĂůůŽĨϮϬϭϳ͘ϰ /ŶĨƌĂƐƚƌƵĐƚƵƌĞ^ƚĂƚĞZĞǀŽůǀŝŶŐ>ŽĂŶ&ƵŶĚ;/^Z&Ϳ dŚĞ ĂůŝĨŽƌŶŝĂ /ŶĨƌĂƐƚƌƵĐƚƵƌĞ ĂŶĚ ĐŽŶŽŵŝĐ ĞǀĞůŽƉŵĞŶƚ ĂŶŬ ;/ͲĂŶŬͿ ůŽĂŶƐ ŵŽŶĞLJ ;ƌĂŶŐŝŶŐ ĨƌŽŵΨϱϬ͕ϬϬϬƚŽΨϮϱŵŝůůŝŽŶͿƚŽƉƵďůŝĐĂŐĞŶĐŝĞƐĂŶĚ ŶŽŶͲƉƌŽĮƚƐ ĨŽƌ ŝŶĨƌĂƐƚƌƵĐƚƵƌĞ ƉƌŽũĞĐƚƐ ĂƌŽƵŶĚ ƚŚĞ ƐƚĂƚĞ͘ϱ dŚĞ /ͲĂŶŬ ŝƐ ƚŚĞ ƐƚĂƚĞ͛Ɛ ŐĞŶĞƌĂů ƉƵƌƉŽƐĞ 6 ŚƩƉ͗ͬͬǁǁǁ͘ŝďĂŶŬ͘ĐĂ͘ŐŽǀͬWŽƌƚĂůƐͬϭͬŽĂƌĚйϮϬDĞĞƟŶŐƐͬϮϬϭϱͬ^ĂŶйϮϬ 'ĂďƌŝĞůйϮϬ^ƚĂīйϮϬZĞƉŽƌƚ͘ƉĚĨ 7 ŚƩƉ͗ͬͬǁǁǁ͘ǁĂƚĞƌ͘ĐĂ͘ŐŽǀͬŝƌǁŵͬŐƌĂŶƚƐͬƉƌŽƉϭŝŶĚĞdž͘ĐĨŵ dŚĞtĞƐƚŐĂƚĞ;ƚŽƉͿĂŶĚĨŽƌŵĞƌ^ŝůǀĞƌDŽŽŶDŽƚĞů;ďŽƩŽŵͿƐŝƚĞƐŚĂǀĞ ƚŚĞŐƌĞĂƚĞƐƚƐŚŽƌƚͲƚĞƌŵĚĞǀĞůŽƉŵĞŶƚƉŽƚĞŶƟĂů͕ĚĞǀĞůŽƉŵĞŶƚŽĨƚŚŽĞƐ ƐŝƚĞƐĐŽƵůĚĂůƐŽƐƉƵƌĂĚĚŝƟŽŶĂůĞĐŽŶŽŵŝĐŝŶǀĞƐƚŵĞŶƚĂůŽŶŐƚŚĞĐŽƌƌŝĚŽƌ ĂŶĚƚŚƌŽƵŐŚŽƵƚtĞƐƚŶĂŚĞŝŵ͘ 140 ͮD/Eн/DW>DEdd/KEͮ,Z/E'Z&dKdKZϮϬϭϴ 8ŚƩƉ͗ͬͬǁǁǁ͘ĐĂƚĐ͘ĐĂ͘ŐŽǀͬƉƌŽŐƌĂŵƐͬdWͬϮϬϭϳͬdWͺϭϬϮϴϭϲͬϮϬϭϳͺdWͺ ^ƚĂƚĞǁŝĚĞͺ^ŵĂůůͺhƌďĂŶͺZƵƌĂůͺŽŵďŝŶĞĚ͘ƉĚĨ ĮŶĂŶĐŝŶŐĂƵƚŚŽƌŝƚLJƚŚĂƚĮŶĂŶĐĞƐƉƵďůŝĐŝŶĨƌĂƐƚƌƵĐƚƵƌĞ ĂŶĚ ƉƌŝǀĂƚĞ ĚĞǀĞůŽƉŵĞŶƚ ƉƌŽũĞĐƚƐ ƚŚĂƚ ƉƌŽŵŽƚĞ ĞĐŽŶŽŵŝĐĚĞǀĞůŽƉŵĞŶƚĂŶĚƌĞǀŝƚĂůŝnjĞĐŽŵŵƵŶŝƟĞƐ͘ ůŝŐŝďůĞ ƉƌŽũĞĐƚ ĐĂƚĞŐŽƌŝĞƐ ĂůŽŶŐ ĞĂĐŚ ŽƵůĞǀĂƌĚ ĐŽƵůĚ ŝŶĐůƵĚĞ ƌĞŚĂďŝůŝƚĂƟŽŶ ŽĨ ĐŝƚLJ ƐƚƌĞĞƚƐ ĂŶĚ ƐƚĂƚĞ ŚŝŐŚǁĂLJƐ͕ ǁĂƚĞƌ ƐƵƉƉůLJ ĂŶĚ ŇŽŽĚ ĐŽŶƚƌŽů͕ ĞŶǀŝƌŽŶŵĞŶƚĂů ŵŝƟŐĂƟŽŶ ŵĞĂƐƵƌĞƐ ;Ğ͘Ő͕͘ tĞƐƚŐĂƚĞ WĂƌĐĞůͿ͕ ŶĞǁ ƉĂƌŬƐ ĂŶĚ ƌĞĐƌĞĂƟŽŶĂů ĨĂĐŝůŝƟĞƐ͕ ĞdžƉĂŶĚĞĚƉƵďůŝĐƚƌĂŶƐŝƚ͕ƉƵďůŝĐƐĂĨĞƚLJĨĂĐŝůŝƟĞƐ͕ĂŶĚ ƉŽǁĞƌ ĂŶĚ ĐŽŵŵƵŶŝĐĂƟŽŶƐ ĨĂĐŝůŝƟĞƐ͘ ZĞĐĞŶƚ ůŽĂŶ ƌĞĐŝƉŝĞŶƚƐŝŶ^ŽƵƚŚĞƌŶĂůŝĨŽƌŶŝĂŚĂǀĞŝŶĐůƵĚĞĚƚŚĞ ŝƚLJŽĨ^ĂŶ'ĂďƌŝĞů͕ǁŚŝĐŚďŽƌƌŽǁĞĚΨϯ͘ϴŵŝůůŝŽŶĂƚ ϯ͘ϱ ƉĞƌĐĞŶƚ ŝŶƚĞƌĞƐƚ ƚŽ ƵƉŐƌĂĚĞ͕ ƌĞĐŽŶƐƚƌƵĐƚ͕ ĂŶĚ ƌĞŚĂďŝůŝƚĂƚĞ ŝƚƐ ƉƵďůŝĐ ƐƚƌĞĞƚƐ͘ ϲ ƉƉůŝĐĂƟŽŶƐ ĂƌĞ ĂĐĐĞƉƚĞĚŽŶĂĐŽŶƟŶƵĂůďĂƐŝƐ͘ 'ŽůĚĞŶ^ƚĂƚĞĐƋƵŝƐŝƟŽŶ&ƵŶĚ ĂůŝĨŽƌŶŝĂ͛Ɛ ,ŽƵƐŝŶŐ ĂŶĚ ŽŵŵƵŶŝƚLJ ĞǀĞůŽƉŵĞŶƚ ;,Ϳ ĚĞƉĂƌƚŵĞŶƚ ĂĚŵŝŶŝƐƚĞƌƐ ŽǀĞƌ ϮϬ ƉƌŽŐƌĂŵƐ ƚŚĂƚƉƌŽǀŝĚĞůŽĂŶƐĂŶĚŐƌĂŶƚƐƚŽĂĐƋƵŝƌĞ͕ĐŽŶƐƚƌƵĐƚ͕ ƌĞŚĂďŝůŝƚĂƚĞ͕ ĂŶĚ ƉƌĞƐĞƌǀĞ ĂīŽƌĚĂďůĞ ŚŽƵƐŝŶŐ͘ dŚĞ 'ŽůĚĞŶ ^ƚĂƚĞ ĐƋƵŝƐŝƟŽŶ &ƵŶĚ ;'^&Ϳ ǁĂƐ ƐĞĞĚĞĚ ǁŝƚŚΨϮϯŵŝůůŝŽŶĨƌŽŵƚŚĞĞƉĂƌƚŵĞŶƚ͛ƐīŽƌĚĂďůĞ ,ŽƵƐŝŶŐ/ŶŶŽǀĂƟŽŶ&ƵŶĚ͘>ĞǀĞƌĂŐĞĚǁŝƚŚŵĂƚĐŚŝŶŐ ĨƵŶĚƐ ĨƌŽŵ ŽƌŝŐŝŶĂƟŶŐ ůĞŶĚĞƌƐ͕ '^& ŵĂŬĞƐ ƵƉ ƚŽ ĮǀĞͲLJĞĂƌ ůŽĂŶƐ ƚŽ ĚĞǀĞůŽƉĞƌƐ ĨŽƌ ĂĐƋƵŝƐŝƟŽŶ Žƌ ƉƌĞƐĞƌǀĂƟŽŶ ŽĨ ĂīŽƌĚĂďůĞ ŚŽƵƐŝŶŐ͘ >ŽĂŶƐ ĂƌĞ Ă ŵĂdžŝŵƵŵ ŽĨ Ψϭϯ͕ϵϱϬ͕ϬϬϬ͕ ǁŝƚŚ ĮdžĞĚ Žƌ ǀĂƌŝĂďůĞ ƉƌŝĐŝŶŐĚĞƉĞŶĚŝŶŐŽŶŵĂƌŬĞƚĐŽŶĚŝƟŽŶƐ͘ Integrated Regional Water Management Grant ;tZͿ WƌŽƉŽƐŝƟŽŶ ϭ͕ Ă ǁĂƚĞƌ ďŽŶĚ ƉĂƐƐĞĚ ďLJ ĂůŝĨŽƌŶŝĂ ǀŽƚĞƌƐŝŶϮϬϭϰ͕ǁŝůůŚĞůƉĨƵŶĚŽǀĞƌΨϱϭϬŵŝůůŝŽŶŝŶ /ŶƚĞŐƌĂƚĞĚ ZĞŐŝŽŶĂů tĂƚĞƌ DĂŶĂŐĞŵĞŶƚ ;/ZtDͿͲ ƌĞůĂƚĞĚ ƉůĂŶŶŝŶŐ ĂŶĚ ŝŵƉůĞŵĞŶƚĂƟŽŶ ƉƌŽũĞĐƚƐ ƚŚƌŽƵŐŚŽƵƚ ƚŚĞ ^ƚĂƚĞ͕ ǁŝƚŚ Ψϲϯ ŵŝůůŝŽŶ ĚĞĚŝĐĂƚĞĚ ƚŽƚŚĞ^ĂŶƚĂŶĂƉůĂŶŶŝŶŐƌĞŐŝŽŶ;ĞŶĐŽŵƉĂƐƐŝŶŐ ŶĂŚĞŝŵͿ͘ϳ/ŵƉůĞŵĞŶƚĂƟŽŶ'ƌĂŶƚƐǁŝůůďĞƐŽůŝĐŝƚĞĚĂƚ ĂĨƵƚƵƌĞĚĂƚĞ͖ĞůŝŐŝďůĞƉƌŽũĞĐƚƐĨŽƌĞĂĐŚŽƵůĞǀĂƌĚ ĐŽƵůĚ ŝŶĐůƵĚĞ ƐƚŽƌŵǁĂƚĞƌ ĐĂƉƚƵƌĞ͕ ǁĂƚĞƌ ƌĞƵƐĞ͕ ƉƌŽǀŝĚŝŶŐŶĞǁŽƉĞŶƐƉĂĐĞ͕ĂŶĚŽƚŚĞƌŐƌĞĞŶƐƚƌĞĞƚƐ ŵĞĂƐƵƌĞƐ͘ ĂůdƌĂŶƐĐƟǀĞdƌĂŶƐƉŽƌƚĂƟŽŶWƌŽŐƌĂŵ;dWͿ ĂůƚƌĂŶƐ͛ ĐƟǀĞ dƌĂŶƐƉŽƌƚĂƟŽŶ WƌŽŐƌĂŵ ;dWͿ ĐŽŶƐŽůŝĚĂƚĞƐ ǀĂƌŝŽƵƐ ƚƌĂŶƐƉŽƌƚĂƟŽŶ ƉƌŽŐƌĂŵƐ Ăƚ ďŽƚŚ ƚŚĞ ƐƚĂƚĞ ĂŶĚ ĨĞĚĞƌĂů ůĞǀĞů͕ ŝŶĐůƵĚŝŶŐ ƚŚĞ ĨĞĚĞƌĂů dƌĂŶƐƉŽƌƚĂƟŽŶ ůƚĞƌŶĂƟǀĞƐ WƌŽŐƌĂŵ ;dWͿ͕ ŝĐLJĐůĞdƌĂŶƐƉŽƌƚĂƟŽŶĐĐŽƵŶƚ;dͿ͕ĂŶĚ^ƚĂƚĞ^ĂĨĞ ZŽƵƚĞƐƚŽ^ĐŚŽŽů͘ƉƉƌŽdžŝŵĂƚĞůLJΨϮϰϬŵŝůůŝŽŶǁŝůůďĞ ĂǁĂƌĚĞĚƚŚƌŽƵŐŚƚŚĞϮϬϮϬͲϮϬϮϭƐƚĂƚĞĨƵŶĚŝŶŐLJĞĂƌƐ ĂŶĚ ĚŝƐƚƌŝďƵƚĞĚ ŝŶƚŽ ƚŚƌĞĞ ĐĂƚĞŐŽƌŝĞƐ͗ ^ƚĂƚĞǁŝĚĞ ĐŽŵƉĞƟƟŽŶ ;ϱϬ ƉĞƌĐĞŶƚͿ͕ DĞƚƌŽƉŽůŝƚĂŶ WůĂŶŶŝŶŐ KƌŐĂŶŝnjĂƟŽŶ ;Ğ͘Ő͕͘ ^'Ϳ ƉƌŽũĞĐƚƐ ĨŽƌ ƌĞŐŝŽŶƐ ǁŝƚŚ ϮϬϬ͕ϬϬϬŽƌŵŽƌĞƌĞƐŝĚĞŶƚƐ;ϰϬƉĞƌĐĞŶƚͿ͕ĂŶĚƐŵĂůů ƵƌďĂŶĂŶĚƌƵƌĂůƌĞŐŝŽŶƐǁŝƚŚƉŽƉƵůĂƟŽŶƐŽĨůĞƐƐƚŚĂŶ ϮϬϬ͕ϬϬϬ;ϭϬƉĞƌĐĞŶƚͿ͘ dŚĞ ŐŽĂů ŽĨ dW ŝƐ ƚŽ ĞŶĐŽƵƌĂŐĞ ŝŶĐƌĞĂƐĞĚ ƵƐĞ ŽĨ ĂĐƟǀĞ ŵŽĚĞƐ ŽĨ ƚƌĂŶƐƉŽƌƚĂƟŽŶ͕ ŝŶĐůƵĚŝŶŐ ǁĂůŬŝŶŐ ĂŶĚ ďŝŬŝŶŐ͕ ĂƐ ǁĞůů ĂƐ ƚŚĞ ƐĂĨĞƚLJ ĂŶĚ ŵŽďŝůŝƚLJ ŽĨ ŶŽŶͲŵŽƚŽƌŝnjĞĚ ƵƐĞƌƐ͘ ůŝŐŝďůĞ ƉƌŽũĞĐƚƐ ĂůŽŶŐ ĞĂĐŚ ŽƵůĞǀĂƌĚ ĐŽƵůĚ ŝŶĐůƵĚĞ ĚĞǀĞůŽƉŝŶŐ ŶĞǁ ďŝŬĞ ĂŶĚ ǁĂůŬǁĂLJƐ͕ĂƐǁĞůůĂƐĂĚĚŝŶŐŶĞǁůĂŶĚƐĐĂƉŝŶŐ͕ƚƌĂĸĐ ĐŽŶƚƌŽůĚĞǀŝĐĞƐ͕ĂŶĚĞŶŚĂŶĐĞĚƐƚƌĞĞƚůŝŐŚƟŶŐ͘ ^ŽƵƚŚĞƌŶ ĂůŝĨŽƌŶŝĂ ƐƐŽĐŝĂƟŽŶ ŽĨ 'ŽǀĞƌŶŵĞŶƚƐ ;^'ͿĂĚŵŝŶŝƐƚĞƌƐƚŚĞƌĞŐŝŽŶĂůƉŽƌƟŽŶŽĨƚŚĞdWĂŶĚ ƌĞůŝĞƐŽŶƚŚĞĂůŝĨŽƌŶŝĂdƌĂŶƐƉŽƌƚĂƟŽŶŽŵŵŝƐƐŝŽŶ ;dͿĂůůĨŽƌWƌŽƉŽƐĂůƐƉƌŽĐĞƐƐƚŽƐĞůĞĐƚƚŚĞĐĂƉŝƚĂů ƉƌŽũĞĐƚƐƚŽďĞĨƵŶĚĞĚƚŚƌŽƵŐŚƚŚĞƌĞŐŝŽŶĂůƉƌŽŐƌĂŵ͘ ŝƟĞƐ ůŝŬĞ ŶĂŚĞŝŵ ĐĂŶ ĂůƐŽ ĂƉƉůLJ ĚŝƌĞĐƚůLJ ĨŽƌ ƚŚĞ ƐƚĂƚĞǁŝĚĞƉŽƌƟŽŶ͖ĚƵƌŝŶŐƚŚĞŵŽƐƚƌĞĐĞŶƚĨƵŶĚŝŶŐ ĐLJĐůĞ;dWLJĐůĞϯͿ͕ϰϬƉƌŽũĞĐƚƐǁĞƌĞƌĞĐŽŵŵĞŶĚĞĚ ƚŽƌĞĐĞŝǀĞĨƵŶĚŝŶŐŽĨŶĞĂƌůLJΨϭϯϮŵŝůůŝŽŶ͘ϴ &ĞĚĞƌĂů^ŽƵƌĐĞƐ CDBG Infrastructure Financing dŚĞ ŝƚLJ ŽĨ ŶĂŚĞŝŵ ƌĞĐĞŝǀĞƐ ŽŵŵƵŶŝƚLJ ĞǀĞůŽƉŵĞŶƚ ůŽĐŬ 'ƌĂŶƚ ;'Ϳ ĨƵŶĚƐ ĨƌŽŵ  ƚŚĞ ĞƉĂƌƚŵĞŶƚ ŽĨ ,ŽƵƐŝŶŐĂŶĚ hƌďĂŶ ĞǀĞůŽƉŵĞŶƚ ;,hͿĂŶŶƵĂůůLJ͘'ĨƵŶĚƐĐĂŶƐƵƉƉŽƌƚĂǁŝĚĞĂƌƌĂLJ ŽĨŝŶĨƌĂƐƚƌƵĐƚƵƌĞŝŵƉƌŽǀĞŵĞŶƚƐ͘ƐŝŐŶŝĮĐĂŶƚƉŽƌƟŽŶ ŽĨƚŚĞĞĂĐŚŽƵůĞǀĂƌĚ^ƚƵĚLJƌĞĂůŝĞƐǁŝƚŚŝŶĂ͞' ůŝŐŝďůĞ ƌĞĂ͕͟ ǁŚŝĐŚ ƋƵĂůŝĮĞƐ ĐĂƉŝƚĂů ŝŵƉƌŽǀĞŵĞŶƚ ƉƌŽũĞĐƚƐĨŽƌƚŚĞ'ƉƌŽŐƌĂŵ͘dŚĞŝƚLJŽĨŶĂŚĞŝŵ ĂŶƟĐŝƉĂƚĞƐƌĞĐĞŝǀŝŶŐĂďŽƵƚΨϰŵŝůůŝŽŶŝŶ'ĨƵŶĚƐ ,Z/E'Z&dKdKZϮϬϭϴͮD/Eн/DW>DEdd/KE | 141 5 ĨŽƌƚŚĞ&ŝƐĐĂůzĞĂƌϮϬϭϵͲϮϬϮϬ͘ ƵƌƌĞŶƚůLJ͕ƚŚĞŝƚLJŽīĞƌƐ 'ͲĨƵŶĚĞĚ ĐŽĚĞ ĞŶĨŽƌĐĞŵĞŶƚ ĂŶĚ ƌĞƐŝĚĞŶƟĂů ƌĞŚĂďŝůŝƚĂƟŽŶ ƉƌŽŐƌĂŵƐ ƚŚĂƚ ĐŽƵůĚ ďĞŶĞĮƚ ĞĂĐŚ ŽƵůĞǀĂƌĚƌĞƐŝĚĞŶƟĂůĂƌĞĂƐ͘ /ŶĂĚĚŝƟŽŶƚŽ'ĨƵŶĚƐ͕ƚŚĞŝƚLJŽĨŶĂŚĞŝŵ ƌĞĐĞŝǀĞƐ ĂŶŶƵĂů ,ŽŵĞ /ŶǀĞƐƚŵĞŶƚ WĂƌƚŶĞƌƐŚŝƉƐ ;,KDͿĂŶĚŵĞƌŐĞŶĐLJ^ŽůƵƟŽŶƐ'ƌĂŶƚ;^'ͿĨƵŶĚƐ͘ dŚĞŝƚLJƵƐĞƐ,KDĨƵŶĚƐĨŽƌƚŚĞĐŽŶƐƚƌƵĐƟŽŶĂŶĚ ƌĞŚĂďŝůŝƚĂƟŽŶŽĨĂīŽƌĚĂďůĞŚŽƵƐŝŶŐƉƌŽũĞĐƚƐ͘dŚĞŝƚLJ ĂŶƟĐŝƉĂƚĞƐƌĞĐĞŝǀŝŶŐĂďŽƵƚΨϭŵŝůůŝŽŶŝŶ,KDĨƵŶĚƐ ĨŽƌ&ŝƐĐĂůzĞĂƌϮϬϭϵͲϮϬϮϬ͘dŚĞĐŝƚLJĂůůŽĐĂƚĞƐ^'ĨƵŶĚ ŽŶ ƉƌŽŐƌĂŵƐ ďĞŶĞĮƟŶŐ ƚŚĞ ŚŽŵĞůĞƐƐ ƉŽƉƵůĂƟŽŶ͘ dŚĞŝƚLJĂŶƟĐŝƉĂƚĞƐƌĞĐĞŝǀŝŶŐŶĞĂƌůLJΨϯϱϬ͕ϬϬϬŝŶ^' ĨƵŶĚƐĨŽƌ&ŝƐĐĂůzĞĂƌϮϬϭϵͲϮϬϮϬ͘ &ĞĚĞƌĂůdƌĂŶƐƉŽƌƚĂƟŽŶ^ŽƵƌĐĞƐ dŚĞ&ŝdžŝŶŐŵĞƌŝĐĂ͛Ɛ^ƵƌĨĂĐĞdƌĂŶƐƉŽƌƚĂƟŽŶ;&^dͿ ĐƚǁĂƐƐŝŐŶĞĚŝŶƚŽůĂǁŝŶĞĐĞŵďĞƌϮϬϭϱ͕ĂŶĚ ĂƵƚŚŽƌŝnjĞƐ ĨĞĚĞƌĂů ĨƵŶĚŝŶŐ ĨŽƌ Ă ǁŝĚĞ ĂƌƌĂLJ ŽĨ ƚƌĂŶƐŝƚŝŵƉƌŽǀĞŵĞŶƚƐƚŚƌŽƵŐŚĮƐĐĂůLJĞĂƌϮϬϮϬ͘/ƚ ŝŶĐůƵĚĞƐĂŶƵŵďĞƌŽĨƉŽƚĞŶƟĂůĨƵŶĚŝŶŐƐŽƵƌĐĞƐƚŚĂƚ ĐŽƵůĚďĞŶĞĮƚƚŚĞtĞƐƚŶĂŚĞŝŵ^ƉĞĐŝĮĐWůĂŶƌĞĂ͕ ŝŶĐůƵĚŝŶŐĂƉŝƚĂů/ŶǀĞƐƚŵĞŶƚ'ƌĂŶƚƐ͕hƌďĂŶŝnjĞĚƌĞĂ &ŽƌŵƵůĂ 'ƌĂŶƚƐ͕ ĂŶĚ ^ƵƌĨĂĐĞ dƌĂŶƐƉŽƌƚĂƟŽŶ ůŽĐŬ 'ƌĂŶƚWƌŽŐƌĂŵƐ͘ dŚĞ&^dĐƚĂůƐŽĞƐƚĂďůŝƐŚĞĚĂŶĞǁEĂƟŽŶĂů^ƵƌĨĂĐĞ dƌĂŶƐƉŽƌƚĂƟŽŶĂŶĚ/ŶŶŽǀĂƟǀĞ&ŝŶĂŶĐĞƵƌĞĂƵǁŝƚŚŝŶ ƚŚĞĞƉĂƌƚŵĞŶƚƚŽƐĞƌǀĞĂƐĂĐŽŶƐŽůŝĚĂƚĞĚƌĞƐŽƵƌĐĞ ĨŽƌƉƌŽǀŝĚŝŶŐůŽĐĂůŐŽǀĞƌŶŵĞŶƚĂŐĞŶĐŝĞƐǁŝƚŚĨĞĚĞƌĂů ĨƵŶĚŝŶŐ͕ĮŶĂŶĐŝŶŐ͕ĂŶĚƚĞĐŚŶŝĐĂůĂƐƐŝƐƚĂŶĐĞ͘ 'ƌĂŶƚƐ͗^ƵƌĨĂĐĞdƌĂŶƐƉŽƌƚĂƟŽŶůŽĐŬ'ƌĂŶƚWƌŽŐƌĂŵ ;^d'Ϳ dŚĞ^ƵƌĨĂĐĞdƌĂŶƐƉŽƌƚĂƟŽŶůŽĐŬ'ƌĂŶƚWƌŽŐƌĂŵŝƐ ŽŶĞŽĨƚŚĞƉƌŝŵĂƌLJŇĞdžŝďůĞĨƵŶĚŝŶŐƐŽƵƌĐĞƐĂǀĂŝůĂďůĞ ĨŽƌ ƚƌĂŶƐŝƚ Ăƚ ƚŚĞ ůŽĐĂů ůĞǀĞů͘ dŚĞƐĞ ĨƵŶĚƐ ŵĂLJ ďĞ ƵƐĞĚ ĨŽƌ Ă ǁŝĚĞ ĂƌƌĂLJ ŽĨ ƚƌĂŶƐŝƚ ĐŽƌƌŝĚŽƌ ĐĂƉŝƚĂů ŝŵƉƌŽǀĞŵĞŶƚƐ͕ŝŶĐůƵĚŝŶŐƉƵďůŝĐƚƌĂŶƐƉŽƌƚĂƟŽŶĐĂƉŝƚĂů ŝŵƉƌŽǀĞŵĞŶƚƐ͕ĨƌŝŶŐĞĂŶĚĐŽƌƌŝĚŽƌƉĂƌŬŝŶŐĨĂĐŝůŝƟĞƐ͕ ďŝĐLJĐůĞ ĂŶĚ ƉĞĚĞƐƚƌŝĂŶ ĨĂĐŝůŝƟĞƐ͕ ĂŶĚ ŝŶƚĞƌĐŝƚLJ Žƌ ŝŶƚƌĂĐŝƚLJďƵƐƚĞƌŵŝŶĂůƐĂŶĚďƵƐĨĂĐŝůŝƟĞƐ͘d'ĨƵŶĚŝŶŐ ŝƐ ĂƉƉŽƌƟŽŶĞĚ ĚŝƌĞĐƚůLJ ƚŽ ^' ďLJ ƚŚĞ &ĞĚĞƌĂů ,ŝŐŚǁĂLJĚŵŝŶŝƐƚƌĂƟŽŶ͘dŚĞĨƵŶĚŝŶŐŝƐĂůůŽĐĂƚĞĚďLJ ƚŚĞ^ƚĂƚĞŽĨĂůŝĨŽƌŶŝĂ͕ǁŝƚŚĂŶŽŶͲĨĞĚĞƌĂůĨƵŶĚŝŶŐŵĂƚĐŚ ƌĞƋƵŝƌĞŵĞŶƚŽĨϭϭ͘ϰϳƉĞƌĐĞŶƚ͘ tŝƚŚ ƌĞƐƉĞĐƚ ƚŽ ƉůĂŶŶŝŶŐ͕ ^ƵƌĨĂĐĞ dƌĂŶƐƉŽƌƚĂƟŽŶ WůĂŶ ;^dWͿĨƵŶĚƐĐĂŶďĞƵƐĞĚĨŽƌƐƵƌĨĂĐĞƚƌĂŶƐƉŽƌƚĂƟŽŶƉůĂŶŶŝŶŐ ĂĐƟǀŝƟĞƐ͕ ǁĞƚůĂŶĚ ŵŝƟŐĂƟŽŶ͕ ƚƌĂŶƐŝƚ ƌĞƐĞĂƌĐŚ ĂŶĚ ĚĞǀĞůŽƉŵĞŶƚ͕ĂŶĚĞŶǀŝƌŽŶŵĞŶƚĂůĂŶĂůLJƐŝƐ͘KƚŚĞƌĞůŝŐŝďůĞ ƉƌŽũĞĐƚƐƵŶĚĞƌ^dWŝŶĐůƵĚĞƚƌĂŶƐŝƚƐĂĨĞƚLJŝŵƉƌŽǀĞŵĞŶƚƐ ĂŶĚŵŽƐƚƚƌĂŶƐƉŽƌƚĂƟŽŶĐŽŶƚƌŽůŵĞĂƐƵƌĞƐ͘^dWĨƵŶĚƐĂƌĞ ĚŝƐƚƌŝďƵƚĞĚǁŝƚŚŝŶĂ^ƚĂƚĞďĂƐĞĚŽŶƉŽƉƵůĂƟŽŶĂŶĚŽƚŚĞƌ ƉƌŽŐƌĂŵŵĂƟĐĐĂƚĞŐŽƌŝĞƐ͘ dƌĂŶƐƉŽƌƚĂƟŽŶůƚĞƌŶĂƟǀĞƐ;dͲ^ĞƚƐŝĚĞͿ tŝƚŚŝŶ ƚŚĞ ^d' ĨƵŶĚŝŶŐ ĂďŽǀĞ ŝƐ Ă ƐĞƚ ĂŵŽƵŶƚ ĐĂůůĞĚ ƚŚĞ dƌĂŶƐƉŽƌƚĂƟŽŶ ůƚĞƌŶĂƟǀĞƐ ͞^ĞƚͲƐŝĚĞ͟ ;ĨŽƌŵĞƌůLJ dƌĂŶƐƉŽƌƚĂƟŽŶ ůƚĞƌŶĂƟǀĞƐ WƌŽŐƌĂŵ͕ Žƌ dWͿ͘ dŚĞ d ^Ğƚ ƐŝĚĞ ĮŶĂŶĐĞƐ ƉƌŽũĞĐƚƐ ĚĞĮŶĞĚ ĂƐ ͞ƚƌĂŶƐƉŽƌƚĂƟŽŶ ĂůƚĞƌŶĂƟǀĞƐ͕͟ŝŶĐůƵĚŝŶŐŽŶͲĂŶĚŽīͲƌŽĂĚƉĞĚĞƐƚƌŝĂŶĂŶĚ ďŝĐLJĐůĞ ĨĂĐŝůŝƟĞƐ͕ ƌĞĐƌĞĂƟŽŶĂů ƉƌŽŐƌĂŵƐ͕ ŝŶĨƌĂƐƚƌƵĐƚƵƌĞ ƉƌŽũĞĐƚƐ ĨŽƌ ŝŵƉƌŽǀŝŶŐ ͞ŶŽŶͲ ĚƌŝǀĞƌ͟ ĂĐĐĞƐƐ ƚŽ ƉƵďůŝĐ ƚƌĂŶƐƉŽƌƚĂƟŽŶ͖ ĞŶŚĂŶĐĞĚ ŵŽďŝůŝƚLJ͕ ĐŽŵŵƵŶŝƚLJ ŝŵƉƌŽǀĞŵĞŶƚĂĐƟǀŝƟĞƐ͕ĂŶĚĞŶǀŝƌŽŶŵĞŶƚĂůŵŝƟŐĂƟŽŶ͘ dŚĞd^ĞƚͲƐŝĚĞĂůƐŽĨƵŶĚƐĂĐƟǀŝƟĞƐƌĞůĂƚĞĚƚŽƚŚĞĨŽƌŵĞƌ ^ĂĨĞ ZŽƵƚĞƐ ƚŽ ^ĐŚŽŽů ;^Zd^Ϳ ƉƌŽŐƌĂŵ͕ ǁŚŝĐŚ ŚĞůƉĞĚ ĨƵŶĚ ƚŚĞ ĐŽŶƐƚƌƵĐƟŽŶ ŽĨ ŝŶĨƌĂƐƚƌƵĐƚƵƌĞͲƌĞůĂƚĞĚ ƉƌŽũĞĐƚƐ ŽŶ ƉƵďůŝĐ ƌŽĂĚƐ ĂŶĚ ďŝĐLJĐůĞ ƉĞĚĞƐƚƌŝĂŶ ƉĂƚŚǁĂLJƐ ŶĞĂƌ ƐĐŚŽŽůƐ͘tŚŝůĞĂƉƉŽƌƟŽŶĞĚĨƵŶĚŝŶŐĨŽƌƚŚŝƐƉƌŽŐƌĂŵŚĂƐ ďĞĞŶĞůŝŵŝŶĂƚĞĚ͕ƚŚĞdWƉƌŽŐƌĂŵŵĂŬĞƐƚŚĞƐĞĂĐƟǀŝƟĞƐ ĞůŝŐŝďůĞĂƐůŽŶŐĂƐƚŚĞLJĐŽŶĨŽƌŵƚŽdWƌĞƋƵŝƌĞŵĞŶƚƐ͘ 142 ͮD/Eн/DW>DEdd/KEͮ,Z/E'Z&dKdKZϮϬϭϴ dŚŝƐƉĂŐĞŝŶƚĞŶƟŽŶĂůůLJůĞŌďůĂŶŬ͘ THE GROVESAT LOMA LINDA Specific Plan (Hearing Draft, June 12, 2018) City of Loma Linda THE GROVES AT LOMA LINDA SPECIFIC PLAN Acknowledgments ACKNOWLEDGMENTS CITY COUNCIL Rhodes Rigsby • Mayor Phill Dupper • Mayor pro tempore Ovidiu Popescu • Council Member * Ron Dailey • Council Member * John Lenart • Council Member PLANNING COMMISSION John Nichols • Chairman * Ryan Gallant • Commissioner Jay Nelson • Commissioner * Doree Morgan • Commissioner Larry Karpenko • Commissioner HISTORICAL COMMISSION James Shipp • Chairman William B. Coffman Lori Curtis Georgia Hodgkin Fred Ramos Richard Schaefer Betty Stark Michael Stewart Dick Wiley CITY STAFF T. Jarb Thaipejr • City Manager Konrad Bolowich • Assistant City Manager, Director of Community Development Lorena Matarrita • Associate Planner Jeff Peterson • Associate Engineer Nataly Alvizar • Administrative Specialist II CONSULTANTS PPlanning PLUS / P+ Melanie Doran Traxler, Principal 2701 Prospect Avenue La Crescenta, CA 91214 818.248.7158 PlaceWorks Karen Gulley, Principal 3 MacArthur Place, Suite 1100 Santa Ana, CA 92707 714.966.9220 Goodman & Associates Douglas L Goodman 2079 Sky View Drive Colton, CA 92324 909.969.3181 OTHER CONTRIBUTORS RHA Landscape Architects Randy Hlubik, Principal 951.781.1930 Archimetric Jay Nelson, Principal 909.322.7582 T&B Planning Joel Morse, Principal 714.505.6360 We Solva Greg C. Spalek, Principal 310.883.5773 * Specific Plan Subcommittee Member THE GROVES AT LOMA LINDA SPECIFIC PLAN Table of Contents TTOC-i Table of Contents CONTENTS CHAPTER 1 - INTRODUCTION 1.1 - ROLE AND FUNCTION OF SPECIFIC PLANS................................................................................................ 1-1 1.2 - AUTHORITY FOR SPECIFIC PLANS ................................................................................................................. 1-1 1.3 - REQUIRED SPECIFIC PLAN CONTENT ......................................................................................................... 1-2 1.4 - REGULATORY PURPOSE OF THIS SPECIFIC PLAN ................................................................................... 1-2 1.5 - OVERVIEW OF THE GROVES DEVELOPMENT........................................................................................... 1-4 1.6 - CONTENTS OF THIS SPECIFIC PLAN ............................................................................................................ 1-5 CHAPTER 2 - PLANNING CONTEXT 2.1 - LOCATION AND PLAN BOUNDARY ............................................................................................................. 2-1 2.2 - CURRENT CONDITIONS .................................................................................................................................. 2-4 2.3 - CURRENT POLICIES AND REGULATIONS .................................................................................................. 2-5 2.4 - OPPORTUNITIES, CONSTRAINTS, AND ISSUES ....................................................................................... 2-9 2.5 - ENVIRONMENTAL COMPLIANCE................................................................................................................ 2-11 2.6 - PUBLIC PARTICIPATION.................................................................................................................................. 2-11 CHAPTER 3 - DEVELOPMENT PLAN 3.1 - CONCEPT OVERVIEW ....................................................................................................................................... 3-1 3.2 - LAND USE PLAN ................................................................................................................................................. 3-8 3.3 - MOBILITY PLAN ............................................................................................................................................... 3-23 3.4 - PARKS, OPEN SPACE, AND RECREATION PLAN .................................................................................. 3-28 3.5 - CONSERVATION AND PRESERVATION PLAN ...................................................................................... 3-49 3.6 - INFRASTRUCTURE, SERVICE, UTILITIES, AND WATER QUALITY PLAN ......................................... 3-56 CHAPTER 4 - DEVELOPMENT STANDARDS AND GUIDELINES 4.1 - APPLICABILITY ..................................................................................................................................................... 4-1 Table of Contents THE GROVES AT LOMA LINDA SPECIFIC PLAN TTOC-ii 4.2 - ALLOWED LAND USES ..................................................................................................................................... 4-1 4.3 - SITE PLANNING .................................................................................................................................................. 4-8 4.4 - DEVELOPMENT STANDARDS ...................................................................................................................... 4-14 4.5 - DESIGN GUIDELINES ...................................................................................................................................... 4-84 4.6 - PROPERTY MAINTENANCE AND MANAGEMENT ............................................................................. 4-147 4.7 - REQUIRED REVIEW, APPROVALS AND PERMITS ............................................................................... 4-147 CHAPTER 5 - IMPLEMENTATION AND ADMINISTRATION 5.1 - GENERAL PLAN CONSISTENCY ..................................................................................................................... 5-1 5.2 - RELATIONSHIP TO CITY ZONING CODE ................................................................................................... 5-2 5.3 - SPECIFIC PLAN INTERPRETATION ................................................................................................................ 5-3 5.4 - COMPLIANCE WITH GOVERNMENT CODE .............................................................................................. 5-3 5.5 - SPECIFIC PLAN DEVELOPMENT PHASING AND SEQUENCING ......................................................... 5-3 5.6 - SPECIFIC PLAN EXEMPTIONS ........................................................................................................................ 5-4 5.7 - SPECIFIC PLAN MODIFICATIONS AND ADJUSTMENTS ........................................................................ 5-4 5.8 - SPECIFIC PLAN IMPROVEMENTS AMENDMENTS .................................................................................. 5 - 4 5.9 - PERIODIC REVIEW, REPORTING, AND MONITORING ........................................................................... 5-6 5.10 - SPECIFIC PLAN IMPROVEMENTS FINANCING ....................................................................................... 5-6 5.11 - NOTIFICATIONS ................................................................................................................................................ 5-6 5.12 - MAINTENANCE AND OPERATION ............................................................................................................. 5-7 5.13 - TRANSFER OF RESIDENTIAL DEVELOPMENT REQUIREMENTS/ RIGHTS ...................................... 5-7 5.14 - PUBLIC USE SITE RESERVATION ................................................................................................................. 5-9 5.15 - PARKS AND OPEN SPACE IMPLEMENTATION ...................................................................................... 5-9 THE GROVES AT LOMA LINDA SPECIFIC PLAN Table of Contents TTOC-iii APPENDIX APPENDIX A – GENERAL PLAN CONSISTENCY ............................................................................................. A-1 Table of Contents THE GROVES AT LOMA LINDA SPECIFIC PLAN TTOC-iv LIST OF FIGURES Regional and Vicinity Map ................................................................................................................. 2-2 Figure 2.1 - Specific Plan Boundary and Phase Reference Map ................................................................... 2-3 Figure 2.2 - Existing Project Site and Surrounding Area Land Uses ............................................................ 2-7 Figure 2.3 - Opportunities and Constraints Map ............................................................................................ 2-10 Figure 2.4 - Land Use Plan ....................................................................................................................................... 3-10 Figure 3.1 - Figure 3.2 - Vehicular Circulation and Access Plan ........................................................................................ 3-25 Figure 3.3 - Non-Vehicular Circulation and Access Plan ............................................................................. 3-26 Figure 3.4 - Open Space and Recreation Plan ................................................................................................ 3-29 Figure 3.5 - Conceptual North Park Plan .......................................................................................................... 3-33 Figure 3.6 - Conceptual Central Park Plan (Alternative One) ..................................................................... 3-34 Conceptual Central Park Plan (Alternative Two) ..................................................................... 3-35 Figure 3.6 - Figure 3.7 - Conceptual South Park .................................................................................................................... 3-36 Figure 3.8 - Oak Woodland Preserve .................................................................................................................. 3-37 Figure 3.9 - Heritage Park ...................................................................................................................................... 3-38 Figure 3.10 - Conceptual Paseo Plan ................................................................................................................... 3-41 Figure 3.11 - Master Drainage Plan ...................................................................................................................... 3-60 Figure 3.12 - Master Strom Drain Plan ................................................................................................................ 3-61 Figure 3.13 - Master Water Plan ............................................................................................................................ 3-67 Figure 3.14 - Master Sewer Plan ........................................................................................................................... 3-69 Figure 3.15 - Infrastructure Implementation Improvement Districts ......................................................... 3-75 Figure 4.1 - Community Structure Plan ............................................................................................................... 4-18 Figure 4.2 - Entry Monument (Concept A) ...................................................................................................... 4-114 Figure 4.3 - Other Entry Monument (Concept B) .......................................................................................... 4-115 Figure 4.4 - Corner Treatment ............................................................................................................................. 4-116 California Street-Citrus North to Boundary (144’ ROW) ...................................................... 4-120 Figure 4.5 - Figure 4.6 - California Street-Citrus South to Boundary (144’-152’ ROW) ............................................ 4-121 Figure 4.7 - Redlands Boulevard (102’ ROW) .................................................................................................. 4-122 Figure 4.8 - Mission Road (104’ ROW) .............................................................................................................. 4-123 THE GROVES AT LOMA LINDA SPECIFIC PLAN Table of Contents TTOC-v Figure 4.9 - Park Avenue-Fronting Planning Area 2-6 (88’ ROW) ...........................................................4-124 Figure 4.10 - Park Avenue-Fronting Planning Area 2-7 (88’ ROW) ......................................................... 4-125 Figure 4.11 - Park Avenue-Fronting Planning Area 3-4 (88’ ROW) .......................................................... 4-126 Figure 4.12 - Park Avenue-Fronting Planning Area 3-2 (88’ ROW) ......................................................... 4-127 Figure 4.13 - Citrus Avenue-Typical (64’ ROW) .............................................................................................. 4-128 Figure 4.14 - Citrus Avenue-Fronting Planning Area 3-4 (64’ ROW) ...................................................... 4-129 Figure 4.15 - Orange Avenue-Typical (64’-88’ ROW) ................................................................................... 4-130 Figure 4.16 - Orange Avenue @ South Park/Residential ............................................................................ 4-131 Figure 4.17 - Orange Avenue @ South Park/Mission Road ....................................................................... 4-132 Figure 4.18 - Bryn Mawr Avenue (118’ ROW)................................................................................................... 4-133 Figure 4.19 - Internal Main Street (86’ ROW) ..................................................................................................4-134 Figure 4.20 - Local Street (60’ ROW) ................................................................................................................. 4-135 Figure 4.21 - Paseo at Local Street ..................................................................................................................... 4-136 Figure 4.22 - Wall and Fence Details ................................................................................................................. 4-138 Figure 4.23 - Interface-Single Family Residential Park ................................................................................ 4-141 Figure 4.24 - Interface-Single Family Residential/Mixed Use ....................................................................4-142 Figure 4.25 - Interface-Senior Housing/Mixed Use ......................................................................................4-143 Figure 4.26 - Interface-Senior Housing/Water Quality Basin ................................................................... 4-144 Figure 4.27- Interface-Mixed Use/Off-Site RV Park ......................................................................................4-145 Figure 4.28 - Interface-Mixed Use/Off-Site School ......................................................................................4-146 Table of Contents THE GROVES AT LOMA LINDA SPECIFIC PLAN TTOC-vi LIST OF TABLES THE GROVES Land Use Statistical Summary .................................................................................. 1-4 Table 1.1 - Table 3.1 - THE GROVES Statistical Summary by Planning Area .................................................................. 3-5 Table 3.2 - Mixed Use Development Requirements ....................................................................................... 3-21 Table 3.3 - Mixed Use Categories ........................................................................................................................ 3-23 Table 3.4 - Parks, Open Space, and Trails Allocation Summary ................................................................ 3-42 Table 3.5 - Provision of Parks, Open Space, and Trails for Phase 2 Planning Areas .......................... 3-45 Table 4.1 - Permitted and Conditionally Permitted Uses ................................................................................ 4-2 Table 4.2 - Shopefront Frontage Type ............................................................................................................... 4-97 Table 4.3 - Forecourt Frontage Type ................................................................................................................ 4-98 Table 4.4 - Gallery Frontage Type ....................................................................................................................... 4-99 Table 4.5 - Arcade Frontage Type ...................................................................................................................... 4-100 Table 4.6 - Terrace Frontage Type ..................................................................................................................... 4-101 Table 4.7 - Stoop Frontage ................................................................................................................................... 4-102 Table 4.8 - Porch Frontage Type ........................................................................................................................ 4-103 Table 4.9 - Yard Frontage Type ...........................................................................................................................4-104 Table 4.10 - Street Tree Palattee ......................................................................................................................... 4-109 Table 4.11 - Shrub and Vine Palette ................................................................................................................... 4-112 INTRODUCTION 1 THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 1 11-1 Chapter 1 - Introduction 1.1 - ROLE AND FUNCTION OF SPECIFIC PLANS A Specific Plan is a tool for the systematic implementation of the general plan for a designated area. It should effectively establish a link between implementing policies of the general plan and the individual development proposal(s) within a defined plan area. Specific Plans function as versatile tools for implementing general plans and defining a particular development or land use. They systematically implement the general plan for all or part of the area under its scope in any of three ways: (1) by acting as statements of planning policy that refine the general plan policies applicable to a defined area; (2) by directly regulating land use; or (3) by bringing together detailed policies and regulations into a focused development scheme. Once a Specific Plan is adopted, all development projects and development agreements for that specific area must be consistent with the plan. A Specific Plan may be as general as setting forth broad policy concepts, or as detailed as providing direction to every facet of development or utilization of the land from the type, location and intensity of uses to the design and capacity of infrastructure; from the resources used to finance public improvements to the design guidelines of a development project. 1.2 - AUTHORITY FOR SPECIFIC PLANS Authority for the Specific Plan is established by California Government Code, Title 8, Division 1, Chapter 3, Article 8, Sections 65450 through 65457, which grants authority to cities to adopt Specific Plans for the purposes of implementing the goals and policies of their general plans. A Specific Plan must be consistent with the adopted general plan of the jurisdiction within which it is located. In turn, all subsequent subdivision, development, public works projects and zoning regulations for the defined area must be consistent with the adopted Specific Plan. As with a general plan, the authority for adoption of the Specific Plan is vested with the local legislative body pursuant to Government Code Section 65453(a). Unlike the general plan, which is required to be adopted by resolution (Section 65356), two options are available for the adoption of a Specific Plan: (1) adoption by resolution, which is designed to be policy driven; or (2) adoption by ordinance, which is regulatory by design. Government Code Section 65453(a) states that a Specific Plan may be amended as often as necessary. Amendments to a Specific Plan are accomplished in the same manner as its adoption. Chapter 1 THE GROVES AT LOMA LINDA SPECIFIC PLAN 11-2 1.3 - REQUIRED SPECIFIC PLAN CONTENT The range of issues contained in a Specific Plan is generally left to the discretion of the decision- making body; however, all Specific Plans, must comply with Sections 65450 - 65457 of the Government Code. Further, the California Office of Planning and Research provides guidelines for the preparation of Specific Plans. Section 65451 of the Government Code mandates that a Specific Plan be structured as follows: (a) A Specific Plan shall include a text and a diagram or diagrams which specify all of the following in detail: x The distribution, location, and extent of the uses of land, including open space, within the area covered by the plan. x The proposed distribution, location, and extent and intensity of major components of public and private transportation, sewage, water, drainage, solid waste disposal, energy, and other essential facilities proposed to be located within the area covered by the plan and needed to support the land uses described in the plan. x Standards and criteria by which development will proceed, and standards for the conservation, development, and utilization of natural resources, where applicable. x A program of implementation measures including regulations, programs, public works projects, and financing measures necessary to carry out paragraphs (1), (2), and (3). (b) The Specific Plan shall include a statement of the relationship of the Specific Plan to the general plan. 1.4 - REGULATORY PURPOSE OF THIS SPECIFIC PLAN The purpose of THE GROVES at Loma Linda Specific Plan (THE GROVES Specific Plan or Specific Plan) is to allow for development across 299.81 acres in a coordinated manner that accommodates the multiple ownerships, large size and visual prominence of this area. The unique considerations of this area require a comprehensive approach to its planning in order to accomplish a rational land use pattern. Further, due the Loma Linda General Plan land use designation of this area as Special Planning Area “D” (SPA-D), as master-planned approach is a requirement. More specifically, the General Plan requires that this area be comprehensively planned to fulfill the criteria set forth by the Implementing Policies and in accordance with Genera Plan Table 2B. THE GROVES Specific Plan is a comprehensive planning document that will establish the preliminary land use development entitlement for the balance of the previously un-entitled SPA-D area, as well as the shared circulation, infrastructure and parkland programs for the entire 299.81 acre area. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 1 11-3 It is the intent that SPA-D be comprehensively planned and the implementation and buildout of this area be coordinated, and not piecemealed, to ensure that development reflects the Guiding Policy and Implementing Policies (as per the General Plan) for siting of land uses and buildings, architectural design, landscaping, road infrastructure, utilities, and other community elements. The General Plan’s vision for this area is a “livable, walkable community” with a high level of amenities for residents, such as parks, trails and paseos, and other recreational uses, exhibiting a high level of design quality. Another key concept for this area is development of a large, sports- oriented community park to assist Loma Linda in achieving its desired park acreage-to-population ratio. In addition, this area is intended to be characterized by a horizontal and vertical mixed uses developed along the frontages of Redlands Boulevard and California Street, including commercial, office, structured parking, and up to 400 very high density residential dwelling units. Single-family residential uses should be placed towards the central, western, and southern portions of the Specific Plan area, with multi-family development permitted toward the interior of the area. New residential uses in proximity to existing, historical residential uses along Mission Road should be compatible in density and scale to those historic residential uses. The General Plan envisions establishment of a heritage park within the Redlands Boulevard/California Street in SPA-D, providing passive recreational uses within an historic setting, consisting of examples of local historic architecture. This vision includes relocating historic homes into the park, and establishing a local heritage/cultural museum, as well as adapting the structures for use for civic and cultural events, as well as for use by local civic and cultural organizations. Religious assembly uses are also anticipated along Redlands Boulevard and California Street. The existing Mission Elementary School at the corner of Redlands Boulevard and California Street should continue as an educational facility or otherwise the historic buildings should be adaptively reused for professional and medical offices, low intensity commercial and restaurant use, or other similar compatible uses. THE GROVES Specific Plan establishes the preliminary land use development entitlement for the balance of the SPA-D area through defining the proposed development program for the previously un-entitled balance of SPA-D, which includes approximately 103 acres for the Phase Three Concept Area. The Specific Plan incorporates previous approvals for the Phases One and Two Concepts, and updates some provisions tied to those approvals to ensure consistency with and streamline the implementation and administration of THE GROVES Specific Plan. Further, the Specific Plan provides the City and landowners with the necessary flexibility to respond to market demand and evolving community needs. Chapter 1 THE GROVES AT LOMA LINDA SPECIFIC PLAN 11-4 The primary entitlement action includes adoption of THE GROVES Specific Plan by ordinance. Secondary entitlement actions include an amendment of the Citrus Trails Master Plan, which becomes incorporated within the Specific Plan, and removal of the East Valley Corridor Specific Plan designation from properties located along Redlands Boulevard. THE GROVES Specific Plan provides the regulatory framework for a master-planned approach under which meaningful phased development can be implemented within SPA-D and to facilitate orderly development and to ensure that adequate pre-planning is considered to achieve the intended balance of land uses, internal connectivity, and breadth of community amenities. This Specific Plan is intended to streamline and improve overall management and administration of SPA-D, while ensuring uses are developed and operated compatibly with surrounding uses. This Specific Plan also addresses long-term infrastructure and neighborhood compatibility issues. 1.5 - OVERVIEW OF THE GROVES DEVELOPMENT The Specific Plan is intended to allow for improvements and development within the 299.81 acre SPA-D. Under the Specific Plan, the type and relationship of allowed land uses and intensities would be as depicted in the Loma Linda General Plan Table 2B: Table Special Planning Area D Land Use Concept (as adopted and amended). Upon complete buildout of the Specific Plan, a maximum 1,067 residential dwelling units would be allowed, including a required 549 units that meet affordable/special needs housing targets consistent with the adopted Housing Element. Also, approximately 10-12 acres of commercial/businesses/services uses would be established providing up to approximately 930,000 square feet (maximum) within the mixed-use areas. In addition, almost 70 acres of active and passive park and open space area would be integrated throughout the community. A summary of existing and proposed development described in this Specific Plan is provided in Table 1-1, Summary of THE GROVES Development. THE GROVES Land Use Statistical Summary Table 1.1 - Land Use Designation Acreage Assigned DU Required Affordable DU Assigned Maximum SF Very Low Density Residential 29.3 60 0 0 Low Density Residential 49.5 198 0 0 Medium Density Residential 12.4 103 0 0 High Density Residential 10.1 93 0 0 Senior Citizen Housing 9.0 213 149 0 THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 1 11-5 Land Use Designation Acreage Assigned DU Required Affordable DU Assigned Maximum SF Mixed Use-Residential 20.0 400 400 0 Mixed-Use-Retail /Service /Office 57.0 0 0 903,665 Institutional 25.1 0 0 0 Park 40.4 0 0 25,000 Open Space, Trails, Private Park, RUSD field Park 27.8 0 0 0 Road 19.3 0 0 0 TOTAL 299.8 1,067 549 928,665 1.6 - CONTENTS OF THIS SPECIFIC PLAN THE GROVES Specific Plan is organized as follows: Chapter 1.0 – Introduction: This chapter provides an explanation of the role and function of Specific Plans, the purpose of THE GROVES Specific Plan, and a summary overview of the subject THE GROVES uses, activities and development. Chapter 2.0 – Planning Context: This chapter describes the location, setting, context and planning issues associated with THE GROVES and the objectives of the Specific Plan. Chapter 3.0 – Development Plan: This chapter includes the conceptual and component-Specific Plans for THE GROVES development. In addition to the concept overview, this chapter provides component plans for the land use concept; mobility and circulation, parks, open space and recreation; conservation and preservation; grading, drainage and water quality compliance; and infrastructure, utilities and services plan. Chapter 4.0 – Development Standards and Guidelines: This chapter sets forth allowed land uses, site planning standards, permitting requirements, landscaping, monitoring and reporting provisions for all uses and development within THE GROVES area. Chapter 5.0 – Implementation and Administration: This chapter provides a review of the Specific Plan’s relationship to the City’s General Plan, Loma Linda Municipal Code (including the Zoning Code), and other regulatory codes. In addition, this chapter discusses the implementation, administration and amendment process for the Specific Plan. Chapter 1 THE GROVES AT LOMA LINDA SPECIFIC PLAN 11-6 This page is intentionally left blank. PLANNING CONTEXT 2 THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 2 22-1 Chapter 2 - Planning Context 2.1 - LOCATION AND PLAN BOUNDARY 2.1.1 - Project Location THE GROVES at Loma Linda Specific Plan is located in the northeast portion of the City of Loma Linda, west of the City of Redlands, 2.3 miles south of San Bernardino International Airport, 3.75 miles east of the I-215 Freeway, and approximately 0.5 miles south of the I-10 Freeway. The site is bordered by Redlands Boulevard to the north, California Street to the east, and Mission Road to the south. See Figure 2-1: Regional and Vicinity Map. Located in the northeast portion of the City of Loma Linda, the Specific Plan site reflects the area referenced in the City’s General Plan as “Special Planning Area D” (SPA-D). THE GROVES at Loma Linda Specific Plan site is bordered by Redlands Boulevard to the north, California Street to the east, Mission Road to the south, and residential uses on the west. Barton Road, one of the City’s major east-west arterials, is approximately one tenth of a mile to the south of the Specific Plan site. 2.1.2 - Specific Plan Boundary The Specific Plan area is defined as the entirety of the area that is located south of Redlands Boulevard, west of California Street, north of Mission Road and bounded on the west by the western edge of 0292-111-51 and 0292-111-31. The Specific Plan area covers 299.81 acres that are coincident with the boundary for SPA-D as defined by the General Plan. The Specific Plan area is comprised of both developed and vacant areas, and areas that have been previously entitled for development through Phases One and Two Concept Area plans approved within SPA-D. The Specific Plan incorporates the Phase One and Two areas and establishes a Phase Three Concept Area for the balance of SPA-D. In addition, portions of the Specific Plan area that owned and managed by the Redlands Unified School District (RUSD) are included as “Other” (or a non-phase). See Figure 2-2: Specific Plan Boundary and Phase Reference Map. Phases are described in Chapter 3 of this Specific Plan. Chapter 2 THE GROVES AT LOMA LINDA SPECIFIC PLAN 22-2 Regional and Vicinity Map Figure 2.1 - THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 2 22-3 Specific Plan Boundary and Phase Reference Map Figure 2.2 - Chapter 2 THE GROVES AT LOMA LINDA SPECIFIC PLAN 22-4 2.1.3 - Property Ownership The Specific Plan area is owned by multiple landowners that include both public agencies (owning approximately 42 percent) and private entities (owning approximately 58 percent).All of the Phase One and Two areas are privately owned (currently). Approximately,83 percent of Phase Three (totaling 102.9 acres) is publicly owned including approximately 79 acres managed by the Successor Agency to the City of Loma Linda Redevelopment Agency (Successor Agency) an approximately 6.5 acres owned by the City of Loma Linda and designated as Heritage Park. The balance of Phase Three is owned by other multiple private property owners. Also included within the Specific Plan area is approximately 39 acres owned by the RUSD, which consist of 11.5 acres associated with the existing Mission Elementary School and 27.5 acres set aside for a future middle school. 2.2 - CURRENT CONDITIONS 2.2.1 - Existing Property Conditions Approximately 57 percent of the Specific Plan site is currently in agricultural production as citrus groves. Land uses within the Specific Plan site include the Mission RV Park to the north along Redlands Boulevard and the Mission Elementary School to the northeast at the corner of California Street and Redlands Boulevard. The Veterans Affairs (VA) Ambulatory Care Center is located at the northwest corner of the Specific Plan site, at the southwest corner of Bryn Mawr Avenue and Redlands Boulevard. Within the southwest portion of Specific Plan site is the City’s Heritage Park. Several single-family residential structures are located along the eastern and southern edges of the Specific Plan site. The balance of the Specific Plan site is vacant cleared land or land in agricultural production with citrus groves. An approximate 3.0-acre grouping of oak trees located in the north- central area of the site is designated under the General Plan as an oak woodland preserve. Historic structures located in the Specific Plan area include: the Nathaniel Hinckley Residence (26300 Mission Road), the Frink Adobe and the associated Frink Ranch utility structures (26248 Mission Road), and the Van Leuven residence (26248 Mission Road). The entire Specific Plan site also falls within the Zanja Historic Landscape, which has been recently designated and listed in the Sacred Land Files of the Native American Heritage Commission. The alignment of the historic Mill Creek Zanja irrigation ditch crosses the southern portion of the Specific Plan site parallel to Mission Road. The 6.5-acre Heritage Park is located at the southwest corner of the Specific Plan site. Heritage Park contains four historic structures that have been relocated to the park. The Specific Plan site, which is essentially flat with an elevation range of approximately 1,180 feet above mean sea level, lies within an alluvial plain having soils comprised of various series of sandy loams. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 2 22-5 2.2.2 - Surrounding Area Uses surrounding the Specific Plan site include citrus groves, a church, isolated residences, the Citrus Lane and Citrus Glen residential developments (under construction) and neighborhood commercial along the east side of California Street. To the south across Mission Road is a single- family residential tract processed as a planned unit development neighborhood. To the west are multiple-family residential uses and the Southern California Edison Easement. To the north on the opposite side of Redlands Boulevard are multiple-family residential uses. To the northeast at the intersection of Redlands Boulevard and California Street, which crosses the San Bernardino County Flood Control Channel, is a shopping center within the City of Redlands. See Exhibit 2-3: Existing Project Site and Surrounding Area Land Uses. 2.3 - CURRENT POLICIES AND REGULATIONS 2.3.1 - Loma Linda General Plan In 2006, the City of Loma Linda adopted a General Plan, which was a comprehensive revision and update to the 1973 Loma Linda General Plan. That update effectively replaced the previous General Plan and established goals and policies to reflect the current community-wide vision. It was the first major update since the City’s incorporation in 1970. The General Plan was subsequently amended in 2009 to incorporate and reflect the will of the community per voter approved “Measure V.” The General Plan is the City’s most important statement regarding its ultimate physical, economic, and cultural development within the 25-year planning period. It is intended to be used by officials and others to guide decisions governing development and management of human and natural resources. The General Plan is comprised of text, maps and illustrations to document the organization of physical, environmental, economic, and social activities desired by the City’s residents in order to create and maintain a healthful, functional, and desirable community. The General Plan addresses short-term and long-term goals for key aspects of the community, including land use, traffic/circulation, open space/conservation, noise, safety and other aspects that contribute to the public health, safety, and “quality of life” considerations of the Loma Linda community. In additional to the traditional land use designations assigned to lands within the City, the General Plan identifies seven general areas within the City that are designated as “Special Planning Areas”. Each area is intended to provide a different variety of uses at varied densities according to each area’s location, access, size, and adjacent land use designations. Each area has its own purpose and intent and provides a healthy mix of land uses throughout the City. The intent is to create areas in which a mix of uses can come together to meet the commercial, employment, institutional, and residential needs of the neighborhood and community at large through efficient patterns of land use, and allow for flexibility to accommodate changing market forces in the future. Chapter 2 THE GROVES AT LOMA LINDA SPECIFIC PLAN 22-6 The Specific Plan site lies entirely within the 299.81 acres encompassing SPA-D, also known as the Redlands Boulevard/California Avenue Plan Area. The General Plan intends that SPA-D be characterized by horizontal and vertical mixed uses, including commercial, office, structured parking and high-density residential, developed along the frontages of Redlands Boulevard and California Street. Single-family, medium-density residential (multi-family) and recreational uses are intended within the central, western and southern portions of the Planning Area. The General Plan’s vision for SPA-D is as a “livable, walkable community” with a high level of amenities for residents, including parks, trails/paseos, and other recreational uses, while also exhibiting a high level of design quality. 2.3.2 - Loma Linda Municipal Code and Zoning The Loma Linda General Plan designates the Specific Plan site as SPA-D and identifies a required mix of land uses (per General Plan Table 2.B.) conceived for SPA-D. Approximately 82 acres of the northern end of the Specific Plan site lie within the boundary of the East Valley Corridor Specific Plan (EVCSP), and are designated as “Special Development” (EVC-SD). The Specific Plan site currently is zoned a combination of Single-Family Residential (R-1), Institutional-Health Care (I-HC), Open Space (OS), Planned Community (PC), EVC-Institutional, and EVC-Special Development (EVC- SD). Concurrent with adoption of the Specific Plan, the area is rezoned to exclude all portions of the Specific Plan site from the EVCSP and rezone the majority of the property as Planned Community (PC) with use-specific zoning of Institutional-Health Care (I-HC) for the existing and future school sites and Open Space (OS) for the existing Heritage Park site. The Specific Plan site lies within the Mission Historic Overlay District (Mission District), which extends along both sides of Mission Road between California Street to the east and Pepper Way to the west.1 The Historic Mission Overlay District of the Loma Linda Municipal Code (Chapters 17.80, Historic Preservation, and 17.82, Historic Mission Overlay District), requires an emphasis to further the public knowledge of Loma Linda’s local history. 1 Loma Linda General Plan EIR, Chapter 4.5. 2004. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 2 22-7 Existing Project Site and Surrounding Area Land Uses Figure 2.3 - Chapter 2 THE GROVES AT LOMA LINDA SPECIFIC PLAN 22-8 2.3.3 - Measure V On November 7, 2006, the Loma Linda voters passed Measure V, The Residential and Hillside Development Control Measure. As outlined in Section II (A) (3) of Measure V, all development projects shall be required to cover 100 percent of their pro rata share of the cost of any public infrastructure, facilities and services through the payment of development impact fees. The City Council has the authority to set and determine development fees sufficient to cover 100 percent of a development’s pro rata share of the estimated cost of such public infrastructure, facilities, and services based on appropriate cost-benefit analyses, as required by the provisions of California law. Section II (F) (2) of Measure V requires that traffic levels of service (LOS) be maintained at level C or better. Specifically, Measure V states: x To assure the adequacy of various public services and prevent degradation of the quality of life experienced by the residents of Loma Linda, all new development projects shall assure by implementation of appropriate mitigation measures that, at a minimum, traffic Levels of Service are maintained at a minimum of Level of Service C throughout the City, except where the current Level of Service is lower than Level of Service C. In any location where the Level of Service is below Level of Service C at the time an application for a development project is submitted, mitigation measures shall be imposed on that development project to assure, at a minimum, that the level of traffic service is maintained at Levels of Service that are no worse than those existing at the time an application for development is filed. In any location where the Level of Service is F at the time an application for a development project is submitted, mitigation measures shall be imposed on that development project to assure, at a minimum, that the volume to capacity ratio is maintained at a volume to capacity ratio that is no worse than that existing at the time an application for development is filed. Projects where sufficient mitigation to achieve the above stated objectives is infeasible shall not be approved unless and until the necessary mitigation measures are identified and implemented. In general, the provisions of Measure V establish managed growth principals that in turn preserve, enhance, and maintain the special quality of life valued by the community of Loma Linda. Projects which are consistent with the above provisions (i.e., payment of fair share for infrastructure, facilities and services, and maintain acceptable traffic LOS) can be considered to be somewhat self- mitigating with regard to potential impacts related to public utilities and services, and local roadway traffic congestion. 2.3.4 - Previous Land Development Approvals As discussed above, the Specific Plan area reflects the 299.81 acres of property designated by the Loma Linda General Plan as SPA-D. Per the General Plan, it is the intent that SPA-D be comprehensively planned and the implementation and buildout of this area be coordinated to THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 2 22-9 ensure that development reflects the Guiding Policy and Implementing Policies (associated with SPA-D) for siting of land uses and buildings, architectural design, landscaping, road infrastructure, utilities, and other community elements. Further, it is the intent that SPA-D be thoughtfully planned and implemented according to a comprehensive and pre-established framework, rather than piecemealed without a regard to the broader goals and context intended for SPA-D. On June 11, 2013, in order to balance the desire to see this area developed as a singular community with the reality of market timing, a policy for sequential phasing of SPA-D was approved by the Loma Linda City Council. That approval allowed for a series of actions that established a Phase One implementation policy for SPA-D, as well as created the opportunity to establish future phases that meet the 40-acre minimum size requirement and demonstrate consistency with the implementing policies for SPA-D. The Phase One Concept Area, approved in 2013, involves a +46-acre area within the Specific Plan site to accommodate the VA Ambulatory Care Center, 5 acres of commercial property, and the southerly extension of Bryn Mawr Avenue. The VA facility and roadway have been constructed, but the commercial property remains vacant. The Phase Two Concept Area, approved in 2017, involves the 111.7-acre Citrus Trails Master Plan project, which will accommodate development of up to 581 residential units, a maximum of 562,000 square feet of commercial/office uses, and almost 22 acres of parks, open space and trails. 2.4 - OPPORTUNITIES, CONSTRAINTS, AND ISSUES The development concepts in the Specific Plan adapt to physical, social, and economic constraints by envisioning an approach to the design and implementation of The Groves that is consistent with the community’s values. An emphasis is placed on quality design and pedestrian orientation. Priority is given to ensuring that the City’s housing needs are met by providing for a range of housing options, including options for affordability and special needs. Chapter 2 THE GROVES AT LOMA LINDA SPECIFIC PLAN 22-10 Opportunities and Constraints Map Figure 2.4 - THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 2 22-11 2.5 - ENVIRONMENTAL COMPLIANCE The California Environmental Quality Act of 1970 (“CEQA”) requires the decision-making body of a Lead Agency to consider the environmental impacts of a discretionary action prior to approving a project. For purposes of implementing CEQA, the City of Loma Linda is the Lead Agency. As required by CEQA Guidelines section 15064, an Environmental Impact Report (“EIR”) is required when a proposed project will result in one or more significant effects on the environment that cannot be mitigated to a less-than-significant level. The City has determined that an EIR is the appropriate level of environmental review to ensure compliance with the CEQA. An EIR was prepared to evaluate and disclose the environmental impacts anticipated through the adoption and implementation of THE GROVES at Loma Linda Specific Plan. The EIR was certified and adopted by the Loma Linda City Council on [DATE TO BE INSERTED]. A copy of the certified EIR is on file with the City’s Planning Division and the City Clerk. 2.6 - PUBLIC PARTICIPATION The project team facilitated three public workshops as part of the Specific Plan outreach process to gather input from the community, Planning Commission and City Council. The Joint Workshop focused on the design and implementation for the remaining area of Special Planning Area D. In addition, all workshop participants were asked to select their top 10 photo images from a series of posters that included a variety of housing types, park concepts, lake examples, public space concepts, and other images that represent design ideas that could be incorporated into the preferred plan and Specific Plan. The results of the preference survey are shown below. Chapter 2 THE GROVES AT LOMA LINDA SPECIFIC PLAN 22-12 DEVELOPMENT PLAN 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-1 Chapter 3 - Development Plan 3.1 - CONCEPT OVERVIEW 3.1.1 - Specific Plan Vision The Specific Plan for THE GROVES must begin with a vision – a vision that describes the community’s aspirations for how this important and historic area of the city will look and live in the future. While a sizable portion of the specific plan area is either built or approved for development, there is a remaining core that remains to be envisioned and planned. In fact, this core area is the “glue” that will bring cohesion to THE GROVES and create a place for all Loma Linda residents. This is a vision for how THE GROVES at Loma Linda will look 25 years from now: TTHE GROVES is the heart of east Loma Linda. It is has grown into an active, mixed-use center, offering a living, shopping, dining, and recreating environment that draws residents, businesses and visitors. Clusters of retail shops, restaurants, coffee houses, and other local-serving businesses along the community’s internal “Main Street” and focal features surrounding the centralized community park create fun places to gather with friends and family. A variety of residential neighborhoods serve the community, from doctors, seniors, veterans and countless others in the healthcare industry and related support and wellness services. This has become a place to plant roots, start businesses, and raise families because of strong ties to Loma Linda and the desirability of this special place. THE GROVES offers a vast variety of open space and recreation opportunities. From a sports park, historic park, oak woodland preserve, passive open space and trails, THE GROVES is the community’s destination for outdoor recreation. These same amenities also unite THE GROVES community with surrounding neighborhoods, including providing connections to other City and “A city is not gauged by its length and width, but by the broa dness of its vision and the hheight of its drea ms”. — HERB CAEN Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-2 regional trails. The VA Ambulatory Center is an anchor for the area, providing patients and their families a place to access the outdoors, share time together and focus on healing and quality living. Two schools are also anchors for this area. The elementary and middle schools are centers of learning for nearby youth, with students having safe pathways to walk and bike to the schools. History is on display here – with the City’s historic park with a collection of historic homes, and the recognition of the Zanja Trail along Mission Road. Community pride is unmistakable – just attend a community event or a farmer’s market at one of the parks, a food festival along “Main Street”, or talk with residents and businesses. This amenity-rich environment offers visual interest and many options to interact. It includes venues to accommodate civic functions and cultural activities. Forward thinking in design and concept, TTHE GROVES sets the example for quality design and creating a great place within Loma Linda. 3.1.2 - Guiding Principles The following principles reflect the input received during community workshops, meetings with the Steering Committee, and meetings with City Staff. ™ Provide a Range of Housing that Meets Loma Linda’s Needs x Set aside a large area within THE GROVES for large-lot custom and semi-custom homes, designed as a private enclave. x Allow for multi-family housing to meet the City’s housing obligation (as determined by the State) that can be provided in a variety of high-quality housing products: walk-up townhomes, courtyard housing, triplex homes, live-work units, and stacked flats above commercial. x Locate condominiums and apartments near commercial uses and design a pedestrian- oriented environment. x Ensure that THE GROVES provides traditional single-family homes for working families. x Ensure that all residential is well-connected to a system of trails connecting schools, parks, and commercial areas. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-3 ™ Boost the Economy x Ensure that commercial uses are located and designed in such a way that a “place” is created – one that is connected from a vehicular and pedestrian standpoint. x Require that commercial uses are clustered around an internal “Main Street” to create a walkable environment, with plaza areas designed with amenities for dining, relaxing, and gathering with friends and families. x Dedicate staff resources, as feasible, to focus on economic development with THE GROVES. x Work with developers to attract desirable retail and restaurant uses, with a mix of local businesses and national chains. ™ Create Additional Gathering and Recreation Areas x Plan for a well-connected trail system that links THE GROVES with nearby neighborhoods and off-site regional trails. x Plan a trail system that provides safe routes for children to walk to the two on-site schools. x Plan for a trail system that connects the residential neighborhoods to the commercial areas and parks within THE GROVES. x Provide standards for providing open space amenities, public plazas and paseos within new development. x Set aside 20 to 25 percent of THE GROVES for public open space and recreation that include sports facilities, passive recreation, tot lots, Farmer’s Market, City events and regular recreation programming. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-4 x Ensure that public open space and recreation areas have a sustainable source of funding for maintenance and operations. ™ Promote Sustainable Development x Provide a means to accommodate the detention/retention of storm water for individual projects in collective manner to create a larger open space/water amenity within THE GROVES. x Encourage pedestrian, bike and other sustainable transportation to reduce reliance on the automobile, enhance walkabilty, and promoting social interaction. x Locate higher density residential within a half-mile of the Redlands Transit Station. The Vision and Guiding Principles are expressed in the plans for land use, mobility, and infrastructure found within Chapter 3 of this Specific Plan. The range of land uses envisioned, combined with a multi-model transportation system, will lead to the development of an active village environment. In addition, the Vision and Guiding Principles are the foundation for the development requirements and design guidance provided in Chapter 4 of this Specific Plan. 3.1.3 - Land Use Concept Overview THE GROVES Specific Plan establishes 299.81 acres as a master-planned community consistent with the Loma Linda General Plan concept for Special Planning Area “D”. THE GROVES land use concept originated from the City’s vision for the development of Special Planning Area “D” as expressed in the Loma Linda General Plan Table 2.B, Table Special Planning Area D Land Use Concept, and related Implementing Policies, all of which specify the land use types, acreages, and dwelling units for Special Planning Area “D”. THE GROVES features single-family residences, pedestrian-oriented mixed-use development, a range of multi-family housing options, and active and passive recreational amenities. Access for pedestrians and bicyclists between the various land uses in the community is established by a logical layout of the local roads within the community and provision of reciprocal access easements in strategic locations. THE GROVES community provides collectively for the development of 1,067 residences, including 291 detached, single-family homes on minimum 7,200 square foot (sf) and 10,000 sf lots, 213 senior THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-5 citizen residences, 163 multiple-family residents built at medium-to-high density configurations, and 400 residential units within the community’s mixed use development component to accommodate affordable and special housing needs. The Mixed Use designation is comprised of 83.8 acres, which includes commercial and office uses (comprising the equivalent of approximately 63.8 acres inclusive of the VA Ambulatory Care Center, or 26.9 acres exclusive of the VA facility) along with the residential component (comprising the equivalent of approximately 11.1 acres). The 400 residential units located within the Mixed Use designated areas will be built at a minimum average of 20 units per acres (du/ac) to ensure that affordability requirements are met. Total commercial square footage will range between approximately 362,000 sf and 584,000 sf, exclusive of the square footage assigned to the existing VA Ambulatory Care Center (at 345,000 sf). A summary of residential units and building square footage is provided in Table 3-1: THE GROVES Statistical Summary by Planning Areas. Table 3.1 - THE GROVES Statistical Summary by Planning Area Planning Area Land Use Deesignation Acreage (Gross) Assigned DU Assigned Maximum SF PA 1-1 Mixed Use 36.9* -- 345,000 PA 1-2 Mixed Use 5.9* -- 121,970 PA 1-Road Road 3.3 -- -- Subtotal (Phase 1) 46.1 -- 466,970 PA 2-1 Mixed Use 4.4 26** 67,520 PA 2-2 Mixed Use (Preserve Overlay) 0.5* -- -- PA 2-3 Senior Citizen Housing 5.0 125** -- PA 2-4 Senior Citizen Housing 4.0 88*** -- PA 2-5 Mixed Use 5.8 54** 67,520 PA 2-6 Park / Open Space 13.9 -- -- PA 2-7 Mixed Use 6.7 62** 78,410 PA 2-8 Low Density Residential 13.5 54 -- PA 2-9 Mixed Use 1.3 -- 28,315 PA 2-10 Mixed Use 0.9 -- 19,600 PA 2-11 Mixed Use 0.9 -- 19,600 PA 2-12 Low Density Residential 20.0 80 -- Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-6 Planning Area Land Use Deesignation Acreage (Gross) Assigned DU Assigned Maximum SF PA 2-13 High Density Residential 5.5 33 -- PA 2-14 Low Density Residential 11.0 44 -- PA 2-15 Park / Open Space 4.0 -- -- PA 2-16 Low Density Residential 5.0 20 -- PA 2-17 Park / Open Space 2.3 -- -- PA 2-18 Park / Open Space 1.1 -- -- PA 2-Road Road 5.9 -- -- SubTotals (Phase 2) 111.7 -- 280,965 PA 3-1 Park / Open Space (Community Overlay) 6.6 -- 10,000 PA 3-2 High Density Residential 4.6 60 -- PA 3-3 Mixed Use 19.4* 165** 155,730 PA 3-4 Park / Open Space (Community Overlay) 15.9 -- 15,000 PA 3-5 Medium Density Residential 12.4 103 -- PA 3-6 Very Low Density Residential 29.3 60 -- PA 3-7 Mixed Use 4.6 93** -- PA 3-Road Road 10.1 -- -- SubTotals (Phase 3) 102.9 180,730 PA 0-1 Institutional 11.6* -- -- PA 0-2 Institutional 27.5* -- -- Subtotal (Other Phase) 39.1 -- -- THE GROVE TTOTAL 299.8 1,067 928,665 Note: * A portion of the acreage under this Planning Area designation is allocated as park, open space, or trail under Private ownership but intended for public access and use. See section 3.4 of THE GROVES Specific Plan for details. ** These assigned units are required to be developed at a minimum density and configuration to qualify as “affordable”or special needs housing. *** Twenty-four of these units must comply with the affordable / special needs housing requirement. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-7 THE GROVES includes almost 70 acres of active- and passive-use park land, including the North Park (13.9 acres in Planning Area 2-6), Central Park (15.9 acres in Planning Area 3-4), South Park (4.0 acres in Planning Area 2-15) and Heritage Park (6.6 acres in Planning Area 3-1). The smaller Oak Woodland Preserve provides approximately 4 acres (within Planning Areas 2-2 and 3-3) of passive trail-based park land nestled amongst mixed-use and senior housing uses. The major parks are linked by a centralized Paseo (Planning Area 2-17) that ranges in width between 27 and 40 feet and provides a multi-purpose meandering trail for recreation, access and mobility throughout THE GROVES. Additional trails systems are integrated along major roadway routes and traverse Planning Areas to ensure a well-connected and pedestrian-mobile community. Park lands will be managed through combined public and private ownership. While the major parks (i.e., North, Central, South and Heritage Parks) will be publicly managed, other key park and open space features, including the VA Linear Park, the Oak Woodland Preserve, the central Paseo Corridor, the Mission Road (Zanja) Trail, California Trail, Park Avenue Trail and Citrus Avenue Trail, and other similar open space and trails for public use, will be privately managed and maintained. Simple, direct access for pedestrians and bicyclists between the various land uses in the community is facilitated by a logical and efficient layout of local roads within THE GROVES. The major roadway system facilitates access to key destinations (i.e., the future middle school, parks and the Main Street district) within THE GROVES without undue burden to the surrounding arterial roadways or disruption to existing or future residential neighborhoods. The rich heritage of Loma Linda serves as the inspiration for the thematic elements and aesthetic design of THE GROVES community, consistent with the Historic Mission Overlay District ordinance adopted by the City of Loma Linda. The community draws its overall visual theme from the heritage of Loma Linda, utilizing locally recognizable architectural styles defined within the Historic Mission Overlay District ordinance and landscape elements, such as entry treatments and park design, to convey the local history of THE GROVES area. Architecture guidelines are strongly influenced by historic uses of the project site and surrounding area, including historic elements such as a Mission storehouse, a Native American village, a Mexican rancho, Mormon settlements, and early citrus farming. Twenty-nine individual Planning Areas that are used to define THE GROVES are formed according to logical boundaries delineated by property ownership patterns, land use types, and physical characteristics such as roads. The Specific Plan describes Planning Area size in gross acres. Likewise, the assigned residential densities and commercial floor area assignments are calculated and intended based on those gross acreages (as defined Table 3.1). The Planning Area boundaries, acreages and unit counts provided in THE GROVES Land Use Plan are based upon the best available information at the time of the Specific Plan document preparation. Recognizing that minor adjustments to these details may occur during the course of Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-8 detailed engineering and architectural design in compliance with the Implementation Plan (see Chapter 5), the Specific Plan allows for minor adjustments through the administration of THE GROVES (see Section 5.9). 3.2 - LAND USE PLAN 3.2.1 - Relevant General Plan Policy The Land Use Element of the General Plan designates the general distribution, location, and extent of land uses for housing, business, industry, open space, institutions, city facilities, and other categories of public and private uses of land. The emphasis of the Land Use Element is on the desired or intended use of land in the community, including future development of the City and its sphere of influence. The unique nature of land use is such that it influences, and is influenced by, many other elements of the General Plan. The General Plan’s vision for Special Planning Area D is as a “livable, walkable community” with a high level of amenities for residents, including parks, trails/paseos, and other recreational uses, while also exhibiting a high level of design quality. Further, the General Plan intends that this area be characterized by horizontal and vertical mixed uses, including commercial, office, structured parking and high-density residential, developed along the frontages of Redlands Boulevard and California Street. Single-family, medium-density residential (multi-family) and recreational uses are intended within the central, western and southern portions of the Planning Area. Other relevant elements that strongly influence land use patterns include the Economic Development, Housing and Growth Management Elements. The Economic Development Element seeks to promote economic and fiscal stability in Loma Linda in order to maintain a vibrant and healthy community. The intent of the Housing Element is to ensure that the City makes a good effort and commits available resources to meeting the housing needs of all economic segments of the community. It also establishes that Special Planning Area D provide fulfill a substantial role in addressing the City’s housing needs through provision of 1,067 residential units, including a majority of which will be at densities appropriate to encourage affordable housing. The Growth Management Element was established to maintain internal consistency with the City’s Measure V, and it includes six principals of managed growth to be applied to all new development to achieve the goal of maintaining the unique quality of life in the City of Loma Linda. See Appendix A for relevant General Plan policies and consistency analysis. 3.2.2 - Development Concept and Plan Features THE GROVES Specific Plan area has been comprehensively planned, consistent with the Loma Linda General Plan concept for Special Planning Area “D”, as a livable, walkable community THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-9 featuring single-family and multi-family residences, pedestrian-oriented mixed-use development, and a range of active and passive recreational amenities. THE GROVES provides for improvements and development within 299.81 acres. Upon complete buildout, THE GROVES will provide a maximum of 1,067 residential dwelling units, including a required 549 units that meet affordable/special needs housing targets. Approximately 10-12 acres of commercial/businesses/services uses would be established providing up to approximately 930,000 square feet (maximum) within the mixed-use areas. Nearly 70 acres of active and passive park and open space area will be integrated throughout the community. A summary of existing and proposed development described in this Specific Plan is provided in Table 1-1, THE GROVES Land Use Statistical Summary (see Chapter 1.0). This section introduces broad land planning concepts that will be implemented through the development standards and design guidelines provided in Chapter 4.0 (Development Standards and Guidelines), which serves a detailed guide for physical improvements within THE GROVES. Land Use Plan Map 3.2.2(a) - The Land Use Plan designates where specific land uses may be established. Figure 3.1, Land Use Plan, illustrates the spatial relationship and location of designated land uses, special land use overlays and planning areas. These features are described below. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-10 Land Use Plan Figure 3.1 - THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-11 Planning Areas 3.2.2(b) - THE GROVES is organized as twenty-nine unique Planning Areas. The Planning Areas are formed according to logical boundaries delineated by property ownership patterns, land use types, and physical characteristics such as roads. Planning Areas are identified by a Planning Area (PA) number (e.g., Planning Area 1-1, Planning Area 2-4, Planning Area 3-6, etc.). The first digit of the Planning Area number indicates Phase Area (see below), followed by the Planning Area identification number within that phase. Each Planning Area has been assigned a size (in gross acres), land use designation, minimum and maximum density or intensity (as appropriate), and a residential unit allocation. In addition, Planning Areas with a Mixed Use designation have been assigned a minimum requirement of affordable/special needs housing units, minimum and maximum commercial square footage, and a mixed-use category target. Table 3.1, THE GROVES Statistical Summary by Planning Areas, provides the land use information for each Planning Area. Each Planning Area shall be site planned to function as a complete unit. Planning Areas designated as Mixed Use shall be designed in a comprehensive manner, including location of land uses, building orientation, architecture, internal vehicular and pedestrian circulation, location and design of parking, provision of shared parking where feasible, and design of edge conditions along contiguous Planning Areas, including vehicular and pedestrian circulation between adjacent Planning Areas where feasible (and as required per this Specific Plan). Phase Areas 3.2.2(c) - THE GROVES can be described as having four Phase areas. These phases do not reflect a sequential order of development, but rather reflect land areas related by individual development entitlement requests. The Phases are shown in Figure 2.2, Specific Plan Boundary and Phase Reference Map (see Chapter 2.0). Phase One is +46 acres and was previously entitled in 2013. The Veterans Affairs Ambulatory Care Center occupies Planning Area 1-1. Five acres of commercial property is assigned to Planning Area 1-2. This phase also includes the southerly extension of Bryn Mawr Avenue between Redlands Boulevard and Park Avenue. Phase Two involves the 111.7-acre and was approved for development in 2017 as the Citrus Trails Master Plan project. Phase Two was approved to accommodate development of up to 581 residential units, a maximum of 562,000 square feet of commercial/office uses, and almost 22 acres of parks, open space and trails. Phase Three is comprised of approximately 103 acres, which includes approximately 79 acres previously managed by the Successor Agency to the City of Loma Linda Redevelopment Agency Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-12 (Successor Agency), approximately 6.5 acres designated as “Heritage Park” and approximately 18 acres owned by other multiple property owners. Phase Three will accommodate development of 481 residences, including 60 single-family detached residential dwelling units (du) on minimum 10,000 square foot lots, 163 attached residential dwelling units at a mid-range density up to 13 du/acre, and 258 residential units (integrated within the community’s mixed-use development component) at a minimum density of 20 du/acre. The mixed-use designation is comprised of 20 acres, which includes commercial and office uses (approximately 7.1 acres) along with the residential component (approximately 12.9 acres) and 26.5 acres of parks, open space and trails, including a minimum of 3 acres dedicated for Oak Woodland Preserve. Other Phase represents approximately 39 acres owned by the Redlands Unified School District (RUSD), which consists of 11.5 acres associated with the existing Mission Elementary School (Planning Area 0-1) and 27.5 acres set aside for a future middle school (Planning Area 0-2). Land Use Designations 3.2.2(d) - Residential Designations Residential development within THE GROVES will feature a variety of built forms, including traditional single-family neighborhoods, attached residential development condominiums, town homes, and multi-level apartments. The following residential land use designations are included within THE GROVES Specific Plan in order to encourage a mixture of dwelling sizes, layouts and ownership types that are consistent with the corresponding land use designation and density range. A range of residential land use designations is intended in order to provide future residents within THE GROVES with a choice of housing preferences, costs that reflect a range of incomes and varied household needs. VLD Very Low Density (0 to 2 dwelling units per acre) This category is intended to provide for single-family residential homes in a large lot, suburban setting. The allowable density for this category ranges from zero to two dwelling units per acre. Within any Planning Area with this designation, a range of lot sizes shall be provided such that lot sizes and lot configurations are varied and not uniform. The minimum allowable lot size is 10,000 square feet. In order to ensure a range of lot sizes and configurations, no more than 25 percent of the lots within any single Planning Area with this designation shall be less than 15,001 square feet and no more than 25 percent shall exceed 40,000 square feet. The VLD designation is intended to promote and facilitate the development of custom and semi-custom home projects for move-up housing. LD Low Density Residential (0 to 4 dwelling units per acre) THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-13 This category is intended to provide for traditional single-family subdivisions within the city and sphere of influence. The allowable density for this category ranges from zero to four dwelling units per acre. The minimum allowable lot size is 7,200 square feet. The 7,200 square foot minimum lot size requirement is not intended to prohibit the approval of attached or detached guest structures or second residential units on a parcel occupied by a single detached single-family residence, where the guest unit or second residential unit is authorized in conformity with state law or City regulations, and the second units remain under the same ownership as the principal dwelling unit. MD Medium Density Residential (6 to 9 dwelling units per acre) This category allows for attached single-family residential, duplexes, townhouses, and condominium types of development. The allowable density for this category ranges from six to nine dwelling units per acre. It is intended that average density for any single Planning Area with this designation demonstrate a six dwelling unit per acre (6 du/ac) minimum so as to combine opportunities for lower-cost housing with newer market trends for single-family development types that incorporate common shared landscaped open space and other amenities that serve to improve the quality of the living environment for residents. HD High Density Residential (6 to 13 dwelling units per acre) This category is intended for multifamily uses consisting of low-rise (one to three stories) condominium and apartment style development. The allowable density for this use ranges from six to 13 dwelling units per acre. However, attached single-family residential, duplexes, townhouses, and condominium types of development may also be incorporated. When specifically approved, as within Phase Two, detached single-family residential may be allowed within this designation at a minimum density of six dwelling unit per acre (6 du/ac) and demonstrating a minimum allowable lot size is 7,200 square feet. VHD Very High Density Residential (within Mixed Use) See Mixed Use designation (residential component) below. SCH Senior Citizen Housing (20 to 25 dwelling units per acre) This category is intended for multifamily uses consisting of condominium and apartment style development within age-restricted developments. The allowable density for this use ranges from 20 to 25 dwelling units per acre. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-14 Mixed Use Designation An objective of the Mixed Use land use designation is to provide broad flexibility in order to attract new commercial and office uses to serve the retail and service needs of THE GROVES community and to enhance the overall economic viability of Loma Linda. In addition, the Mixed Use designation shall integrate a substantial residential component amongst the commercial base. Mixed use development may present as “vertical mixed use” (i.e., different uses are mixed within the same multi-story building), or as “horizontal mixed-use” (i.e., the different uses occur within separate adjacent buildings). Regardless of any tendency toward vertical or horizontal (or combinations of both), it is intended that development within the Mixed Use land use designation reflect an appropriate mix of uses, physical orientation, building character and scale that emphasizes a strong commitment toward pedestrian orientation. The Mixed Use designation is intended to accommodate both residential and commercial components, as discussed below. MU (VHD) Mixed Use - Residential Component (Average 20 dwelling units per acre) This category is intended for multifamily uses consisting of low-rise (one to three stories) condominium and apartment style development. The allowable density for this use ranges from 20 to 25 dwelling units per acre, with an minimum average density of 20 dwelling unites per acre required to fulfill affordable housing objectives. MU (C) Mixed Use – Commercial Component (Maximum 0.5 FAR, or 0.75 FAR for select uses) The primary intent of the commercial/retail component within the Mixed Use designation is to provide for the shopping and commercial service needs of THE GROVES community, the workers who are employed within and around THE GROVES, and those who visit the city, such as to receive health care. However, it is equally intended that a complimentary range of office, small-scale business park, community uses and religious uses be incorporated into the commercial/office style development (e.g., offices in small storefronts, a cluster of office suites within a larger shopping center, or religious assembly uses in buildings originally designed for commercial uses) and in a manner such that the dominant character of the overall development remains commercial. The commercial component of the Mixed Use designation shall generally be consistent with the commercial-based, employment- generating land use categories defined in the General Plan Land Use Element, including the Commercial, Office and Business Park categories. Health Care, Institutional and City Facilities that are designed to be compatible with the surrounding uses shall also be appropriate. Supporting commercial and service uses may include office supply stores, copy services, pharmacies, day care, restaurants, dry cleaners, sundry stores and similar uses. The Mixed THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-15 Use commercial designation encourages pedestrian-oriented development and small-scale development that feature specialty stores and boutiques to create vibrant areas for people to gather and socialize and to better serve the community by providing a greater range of personalized commercial uses (e.g., sit-down restaurants, upscale apparel, stores related to hobbies or collectibles, gifts, etc.). It is also the intent of the Mixed Use commercial designation to encourage more commercial leisure activities (e.g., family-oriented commercial recreation facilities, kids’ entertainment restaurants, day spas, sit-down restaurants that not only provide food but are oriented around family gatherings and appreciation of nature through their settings) and community programmed activities (e.g., museums, community theaters and cultural institutions). Visitor-serving uses, including lodging, are also supported under this designation. Examples of the intended nature of development footprints within the Mixed Use commercial category include shopping centers, in-line shops, specialty shops, and stand-alone commercial buildings. The maximum allowable density for the commercial/retail component of the Mixed Use designation is 0.5 FAR, or 0.75 FAR for hotel and hospitality uses. Buildings may range from low to mid-rise (one to three stories), with some allowance for four stories when specifically approved in accordance with the Development Standards provided in Section 4.4. Community and Public Uses Designations Included within this heading are institutional and public categories of uses such as recreational open space (public and private). Some of these land uses may be outside of the jurisdictional control of the City of Loma Linda. I Institutional (Maximum 0.5 FAR) Within THE GROVES, the Institutional land use designation is intended for educational institutions and schools (e.g., Mission Elementary). More specifically, the designation applies to two Planning Areas (Planning Area 0-1 and Planning Area 0-2) that are owned and managed by the Redlands Unified School District (RUSD). These include a 11.5-acre site for the existing Mission Elementary School and a 2705-acre site for a future middle school (or combined K thru 9 school). The City of Loma Linda acknowledges that some uses within the institutional category may be outside of the jurisdictional control of the City and that the corresponding public entities might not be required to follow the City’s development standards. In such cases, the design policies provided in this Specific Plan are intended to serve as a guideline for the public agency. It is also recognized that institutional uses are unique, often with special architectural requirements and style preferences that reflect the buildings’ users and function, and thus flexibility is required. Institutional educational uses may include facilities characterized by classrooms, auditoriums, libraries, gymnasiums, Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-16 administration offices, and cafeterias. Also included are outdoor active uses areas for athletic fields, playgrounds and outdoor classroom areas. P Park / Open Space The Park / Open Space designation applies to lands owned and operated by the City of Loma Linda as passive or active public parks, as well as privately-owned/operated areas with dedicated public-use easements (i.e., trails, paseos and neighborhood-serving parks). It also applies generally to community-based recreational and trail use areas, including areas set aside for preservation of orange trees and sections of a pedestrian/bicycle/concrete walkway and trail system, that are intended to serve nearby neighborhoods and the community in general by contributing toward establishing a continuous trail system city-wide. Except as otherwise provided within the Community Overlay (see below), development of buildings is generally prohibited within this land use designation, except those that may be ancillary to the recreational use (e.g., restrooms, small service buildings). Special Use Overlays Community Overlay (Maximum 0.1 FAR) The Community Overlay is established to provide opportunity to integrate selected quasi- commercial and community uses within public parks and open space areas that traditionally do not accommodate such activity. Commercial and community uses within the Community Overlay are intended to accommodate uses that are complimentary to the park uses and serve to enhance the overall quality of special features within the broad park areas. The Community Overlay extends along the northern edge of Central Park (Planning Area 3-4) and North Park (Planning Area 2-6), and over the southern portion of Heritage Park (Planning Area 3-1). The Community Overlay along the south edge of Park Avenue (i.e., Planning Areas 3-4 and 2-6) offer the opportunity to accommodate community uses and commercial entertainment-oriented uses, such as a fire station, a community room/facility, concession areas, small vendor kiosks, and private commercially operated recreation/entertainment/fitness uses (i.e, batting cages, virtual golf, yoga/pilates, etc.). Restaurant uses and small gallery type stores could also be incorporated within the overlay and incorporated to activate the potential lake or stream bed features. Within Heritage Park, the Community Overlay encompasses the historic structures located within that area. Community uses should be limited to those that are adaptable to the historic structures, including for example administrative offices for public agencies and community-serving non-profit organizations. Land use limitations are discussed in more detail in Chapter 4.0 (Development Standards and Guidelines). THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-17 Oak Woodland Overlay (Maximum 0.1 FAR) A minimum 3.5-acre Oak Woodland Preserve is established across portions of Planning Areas Planning Area 2-2 and Planning Area 3-3 to preserve and protect a mature oak woodland vegetation community. The overlay designation serves not only to preserve and protect, but also establish an area for which a long-term habitat management program will be developed and implemented, and to define an area for which special design treatment will be applied to integrate the oak woodland as a focal feature that will interface with other surrounding development. The precise boundary of the overlay will be determined in conjunction with preparation of the Oak Woodlands Preserve Plan. The preserve plan will be developed with the assistance of a qualified arborist and will encompass a cluster of approximately 26 existing oak trees in the area. It is intended that the land area within Oak Woodland Overlay would be privately owned and maintained, but fully accessible to the public for passive recreational use and pedestrian trail access. The Oak Woodland Preserve is described in more detail in Section 3.4 (Parks, Open Space and Recreation Plan) and Chapter 4.0 (Development Standards and Guidelines). Other Special Use Areas and Districts “Main Street” District Concept THE GROVES envisions an internal “Main Street” extending through three or four of the northerly Mixed Use designated Planning Areas. The “Main Street” will serve as a unifying feature used to anchor and serve as a focal point for mixed use development. The traditional small town “Main Street” is the prototype for modern pedestrian-oriented development, which provides a mix of land uses such as retail, offices, commercial services, and residential in the same building or in nearby buildings. This mix of uses helps to build the synergy that is necessary for successful pedestrian oriented development because it allows buildings to be in use 24 hours a day. The form along the “Main Street” should be quite different from that of more traditional commercial development that may occur within other mixed use areas, which may be designed around the car. In particular to the Main Street, design buildings so as to locate retail uses on the first floor in order to benefit from street activity and to generate activity themselves by providing convenient shopping opportunities and attractive window displays. Service uses, such as hair salons and dry cleaning drop-off/pick-up, should only be placed on the first floor if the interior tenant spaces are designed to present an attractive, active image that adds to the vitality of the street life. Within horizontally mixed-use buildings, provide professional services offered directly to the public on the first floor with other office-based employment reserved office uses for the second floor of pedestrian-oriented buildings. Encourage public Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-18 open areas such as plazas that are designed for gathering and ancillary outdoor uses such as outdoor dining. Provide seating areas (e.g., benches, tables and chairs, low walled planters) and trash receptacles for convenience and that encourage use of these outdoor public areas. Mixed Use/Affordable Housing Provision THE GROVES features housing opportunities in a variety of home types, sizes, and architectural styles, intended to appeal to residents of different family sizes, income levels, and ages. The number of residential units required within THE GROVES is based on units identified General Plan Land Use Element (Special Planning Area “D”) and the Housing Element. Specifically, the Land Use Element establishes 400 as the number of mixed use residential units assigned to THE GROVES, while the Housing Element requires that a minimum of 549 units overall be provided as combined Very High Density and Senior Housing “affordable” units. Consistent with these requirements, each Planning Area within the Mixed Use and Senior Citizen Housing designations is assigned a required affordable/special needs housing requirement. Residential densities within these areas will range from 20 to 25 dwelling units per acre, and a minimum average density of 20 units per acre. Historic Mission Overlay District THE GROVES is located within the Historic Mission Overlay District, as established under Chapter 17.82 of the Loma Linda Municipal Code. This Specific Plan incorporates development standards and architectural and site design guidelines that reflect the historical designation and intent of the Historical Mission Overlay District. Specific Plan features that serve to protect, preserve and ensure compatibility with historic resources are discussed in Section 3.5 (Conservation and Preservation Plan) and Chapter 4.0 (Development Standards and Guidelines). 3.2.3 - IMPLEMENTATION PROGRAM 3.2.3(a) - Affordable Housing Implementation THE GROVES specifies several methods to ensure that the affordable housing units requirements are implemented consistent with the requirements of the Housing Element. To ensure consistency with the affordable housing provisions of the General Plan Housing Element, residential units seeking to qualify as “affordable” shall comply with at least one of the following criteria, in perpetuity: x Density: A residential development within a Mixed Use Planning Area with a minimum residential density of 20 dwelling unites per acre shall be considered to meet the THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-19 requirement for providing affordable housing. Density within the Mixed Use Planning Areas may be increased up to 25 dwelling units per acre if in compliance with subsection (b), Special Populations, or (c), Federal, State or City Programs. Density shall be calculated as provided in Appendix B, Definitions. x Specia l Populations: Within the residential portion of mixed use projects, 25 percent of the units shall be targeted and reserved for special populations including, but not limited to, senior citizens, special needs persons, disabled veterans, those needing short term housing to support medical treatment, or as determined by the Community Development Director. x Federal, State or City Progra ms: Units in the residential portion of mixed use projects shall be considered affordable through participation in a specific Federal, State or City affordable housing program when meeting the criteria of the respective program. 3.2.3(b) - Transfer of Residential Units Each Planning Area is assigned a residential unit value. The Specific Plan provides for the transfer of residential units between Planning Areas in accordance with the provisions of Section 5.13, (Transfer of Residential Development Requirements/Rights). Such a transfer may include all the residential units in a Planning Area or a portion of the residential units, provided that the transferred units retain the original assigned attribute identified as affordable or market rate. Residential units may only be transferred to a receive Planning Area that can accommodate the required density of the transferred units. 3.2.3(c) - Implementing a Balanced Mixed of Uses The Mixed Use designation is designed to result in a broad range and functional mix of commercial-oriented uses consistent with the General Plan’s vision for Special Planning Area “D” as a “livable, walkable community,” by providing for a strong mix of commercial uses (including neighborhood retail, specialty retail, restaurant, entertainment, office-based employment and/or professional services) and encouraging a rich pedestrian-oriented character that offers plazas, pocket parks, public art, and similar amenities to create gathering places with a high level of visual interest. In order to promote the efficient use of commercial land and to encourage a broad range of community-serving commercial uses, the Specific Plan restricts large-scale, single-use developments considered unsuitable within the Mixed Use Planning Areas. Further, the Specific Plan provides for a strong mix of commercial uses including neighborhood retail, specialty retail, restaurant, entertainment, office-based employment and/or professional services. To meet this objective, the Specific Plan includes requirements for each Mixed Use Planning Area that specify the maximum commercial square footage, the minimum commercial square footage, and a minimum number of commercial uses. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-20 3.2.3(d) - Ensuring a Mix of Uses The Specific Plan ensures that each Mixed Use Planning Area provides the required residential development as well as efficient and varied commercial land uses. A Mixed Use Planning Area must provide its allocated residential units, leaving the remainder of the site available for commercial development. The Specific Plan establishes maximum and minimum commercial floor area ratios based on the square footage available for commercial development in each Mixed Use Planning Area and requires a variety of commercial use types through designated use categories. (Deviation from the maximum floor area ratio and the minimum number of required categories may be allowed when specifically approved by the Planning Commission as part of a Precise Plan of Design and consistent with modifications as discussed in Chapter 5.0 (Implementation and Administration). The square footage available for commercial development within each Mixed Use Planning Area is designated as the “Assigned Commercial Component” (ACC) (refer to Table 1-1, The Grove Land Use Statistical Summary). The following terms and concepts unique to THE GROVES are referenced to ensure a mix of uses. Calculations corresponding to these terms are specified for each Planning Area in Table 3.2, Mixed Use Development Requirements. (1) The Allocated Residential Area (ARA) for each Mixed Use Planning Area is the acreage (converted to square feet) required to accommodate the allocated residential units at a default density of 20 dwelling unites per acre. (2) The Assigned Commercial Component (ACC) for each Mixed Use Planning Area is the acreage (converted to square feet) remaining in the Planning Area after the ARA is subtracted from the Planning Area’s Gross Acreage (i.e., ACC = Gross Planning Area Area – ARA). If the calculation of the Assigned Commercial Component results in zero or a negative number, no commercial development is required for that Mixed Use Planning Area. (3) Maximum Floor Area Ratio (FAR) for Mixed Use Planning Areas is 0.5 of the Assigned Commercial Component (ACC). Deviations from the maximum FAR are allowed when specifically approved by the Planning Commission as part of a Precise Plan of Design entitlement in compliance with modifications address in Chapter 5.0 of this Specific Plan. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-21 Table 3.2 - Mixed Use Development Requirements Mixed Use Planning Area Planning Area Acreage Allocated Residential Area (SF) Assigned Commercial Component (SF) Applied Maximum FAR (SF) 11 Applied Minimum FAR to Satisfy Each Mixed Use Category (SF) Required Number of Mixed Use Categories (Minimum) 11,2 PA 1-12 5.9 0 257,004 121,970 60,985 2 PA 2-1 4.4 56,628 135,036 67,518 13,504 3 PA 2-4 4.0 180,774 03 0 0 2 PA 2-5 5.8 117,612 135,036 67,518 13,504 4 PA 2-7 6.7 135,036 156,816 78,408 15,682 4 PA 2-9 1.3 0 56,628 28,314 5,663 2 PA 2-10 0.9 0 39,204 19,602 3,920 1 PA 2-11 0.9 0 39.204 19,602 3,920 1 PA 3-3 19.4 359,370 485,694 242,847 48,569 4 PA 3-7 4.6 200,376 03 0 0 1 Notes: 1. Deviations from the maximum FAR and minimum number of required Mixed Use Categories may be allowed only when specifically approved by the Planning Commission as part of a Precise Plan of Design entitlement and in compliance with Chapter 5.0 (Implementation and Administration) 2 Residential development equals one use category requirement 3 When calculation of the Assigned Commercial Component results in a negative number; the Assigned Commercial Component is determined to be zero and fulfillment of the provisions for ensuring a mix of uses. (4) Minimum Use Types and Minimum Floor Area Ratio (FAR) apply to require a minimum 0.1 FAR for each use type is established for each Mixed Use Planning Area, to ensure that a minimum square footage of commercial use is developed in each Planning Area and to encourage efficient use of land within the commercial component of THE GROVES. The Minimum FAR to satisfy a Mixed Use Category and the minimum number of required categories for each Mixed Use Planning Area is established in Table 3.2, Mixed Use Development Requirements. Deviations from the minimum number of required categories may be allowed when specifically approved by the Planning Commission as part of a Precise Plan of Design entitlement. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-22 a) To receive credit for fulfilling a Mixed Use Category, each Planning Area must develop a minimum of 0.1 FAR of the Assigned Commercial Component (ACC) for each use category assigned to the Planning Area. b) The Specific Plan provides incentives to facilitate community uses and other similar community-oriented uses. To encourage development of the following uses, the minimum 0.1 FAR shall not be required for the corresponding Mixed Use Category to be fulfilled. x Day cares (child or elder care) and preschools x Library x Museum x Community theater x Senior center x Fire station x Post office x Police/sheriff substation c) The minimum FAR requirement does not apply to Mixed Use Category A (Residential). d) The required number of Mixed Use Categories is based on the size of each Mixed Use Planning Area. Development of residential units within a Mixed Use Planning Area qualifies as providing one of the required number of Mixed Use Categories. If a Planning Area transfers all of its allocated residential units (in compliance with Section 5.13, Transfer of Residential Development Requirements/Rights) the required number of Mixed Use Categories for the Planning Area specified in Table 3.3 shall be reduced by one. (5) Mixed Use Categories consist of ten (A-J) categories of land uses permitted in the Mixed Use designated areas. The Mixed Use Categories are generally distinguished by similar building forms reflecting the type of use (i.e., offices versus restaurants versus retail spaces). The Mixed Use Categories are Residential, Retail, Services, Eating Establishments, Recreation/Entertainment, Hospitality, Office, Health/Social Services, Community/Education, and Government/Public Facilities. THE GROVES Mixed Use Categories, assigned letters A through J, are identified in Table 3.2, Mixed Use Categories. Specific allowed uses tied to each of the ten Mixed Use Categories is provided in Table 4-1, Permitted and Conditionally Permitted Use, found in Section 4.2 of this Specific Plan. Table 4-1 groups the allowed uses by Mixed Use Category. a) Development applications for Mixed Use Planning Areas (e.g., Precise Plans of Design, Conditional Use Permits) shall demonstrate satisfaction of the Mixed Use Category requirements. Mixed Use Category requirements shall apply only during discretionary site plan review in conjunction with a development application. b) The building plans shall identify the Mixed Use Category for each building according to building design, building massing, and placement of buildings on the site. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-23 c) Development proposals shall demonstrate the square footage provided in each Mixed Use Category, which shall be determined by the commercial building’s gross leasable square footage. d) The square footage of two or more buildings of the same Mixed Use Category may be combined to achieve the required 0.1 FAR. e) The building plans shall provide a tally of the square footage of each building within a Mixed Use Category to demonstrate compliance with the provisions of this subsection, to the satisfaction of the Community Development Director. Table 3.3 -- Mixed Use Categories Category Land Use Type** A Residential B Retail C Services D Eating Establishments E Recreation/Entertainment F Hospitality G Office H Health/Social Services I Community/Education J Government/Public Facilities Note: * Specific allowed uses tied to each of the ten Mixed Use Categories is provided in Table 4-1 (Permitted and Conditionally Permitted Use) of The Groves Specific Plan., which groups the allowed uses by Mixed Use Category. 3.3 - MOBILITY PLAN 3.3.1 - Relevant General Plan Policy The Transportation and Circulation Element defines the City’s overall planned transportation system. This element identifies and establishes the City’s policies governing streets and highways, public transit network, bicycle routes, pedestrian ways, and other components of the circulation system. The identified goals and policies are intended to provide guidance and specific actions to ensure the continued safe and efficient movement of people and goods within and through the City. See Appendix A for relevant General Plan policies that influence the Mobility Plan. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-24 3.3.2 - Mobility Plan Concept Context and Overview 3.3.2(a) - Vehicular Circulation, Access, and Parking Plan Local Circulation and Roadway Plan The Specific Plan site is surrounded by a network of existing streets including Redlands Boulevard to the north, California Street to the east, Mission Road to the south, and the southern extension of Bryn Mawr Avenue to the west. Four major roadways establish the internal circulation within the Specific Plan site. The roadway concept is shown in Exhibit 3-2, Vehicular Circulation and Access Plan. Park Avenue and Citrus Avenue extend westward from California Street to Bryn Mawr Avenue, and beyond to allow access to a future middle school anticipated in Planning Area 0-2. The existing westerly leg at the California Street/Mission Road intersection will be removed and terminated east of Earp Drive. A western extension of Orange Avenue will connect with Mission Road (at the intersection with Earp Drive) and established a new alignment of Mission Road and connection with California Street. Ultimately, access from California Street to Mission Road will be provided exclusively by this segment of Orange Avenue. Mission Road will be terminated east of the intersection with Earp Drive. Vehicle Access and Connectivity Plan In addition to the four primary roadways, a network of secondary north-south local roadways will be established to facilitate internal access throughout the Specific Plan site and provide functional connectivity between Planning Areas. The precise location and alignment of secondary roadways will be determined at the time of each individual development implementing phase. However, in order to provide for a coordinated approach that meets the Project objectives and Implementing Policies of the Loma Linda General Plan, the Specific Plan includes an Access Plan with guidelines for the placement of primary and secondary access. Conceptual vehicular entry points for each Planning Area, as well as the general potential locations for internal access between Planning Areas, is shown in Exhibit 3-2. Access points are designated with the express purpose of limiting vehicular access onto Redlands Boulevard and California Street, minimizing curb cuts and potential interference with the flow of traffic on these arterial streets. 3.3.2(b) - Non-Vehicular Circulation and Access Plan Pedestrian Access and Orientation The Groves offers residents a southern California outdoor lifestyle that includes access to a well integrated network of trails that address a range of access, function, recreational and well-being needs. The parks, paseos and trails provide residents with multiple options for pedestrian mobility and non-vehicular access. The pedestrian circulation and access plan is shown in Exhibit 3-4: Non- Vehicular Circulation and Access Plan. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-25 Figure 3.2 - Vehicular Circulation and Access Plan Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-26 Figure 3.3 - Non-Vehicular Circulation and Access Plan THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-27 Simple, direct access for pedestrians and bicyclists between the various land uses in the community is facilitated by the layout of the local roadways under the master roadway plan for The Groves. The network of north-south local roadways, as well as the centrally located paseo, allows pedestrians to make their way from the residential areas to the retail stores and services located in the mixed use areas and the two primary parks, Heritage Park (Planning Area 3-1) and Central Park (Planning Area 3-4). The Decomposed Granite Trail systems is accessible adjacent to key roadway corridors, but it also threads between key use areas within the community. For example the DG Trail will directly link Heritage Park (Planning 3-1) with Central Park (Planning Area 3-4), and connect the parkland and mixed use areas of The Groves to residential development along Mission Road. 3.3.3 - Implementation Program The Groves development area is divided into Infrastructure Implementation Improvement Districts, which serve to establish a means for coordinating improvements, including roadways, sidewalks and parkway trails, for areas that share common infrastructure components. Phase Two and Phase Three are each divided into distinct Improvement Districts that represent guidance and expectations for the implementation requirements of infrastructure improvements established by the Specific Plan, as shown in Exhibit 3-15, Infrastructure Implementation Improvement Districts, found in Section 3.6.3 of this Specific Plan. Phase Two (Citrus Trails Master Plan) is divided into five Improvement Districts (A, B, C, C-1 and D), while Phase Three is divided into three Improvement Districts (A, B and C). The Improvement District concept provides flexibility in the timing of the construction of the infrastructure improvements, including roadways, sidewalks and parkway trails, required to support the development of any individual Planning Area, regardless of sequence. Therefore, the Improvement Districts allow for Planning Areas to be developed in any order, provided however, that the necessary supporting infrastructure improvements within a particular Improvement District(s) and the infrastructure in any other Improvement District that is necessary to support the improvements, is in place or is constructed. Development construction phasing has not been determined at this time. The provision of roadways, sidewalks, and parkway trails to serve The Groves is assured through the designation of Improvement Districts that delineate facilities to be constructed in support of all development, or interim development implementing phases, within an Improvement District. Construction of each of these facilities shall be timed to adequately service each individual development project. As such, this may require construction of the facilities both on-site (within or adjacent to the PA) and/or off-site (within other PAs or outside of the Specific Plan area) to connect with existing circulation and access facilities in the surrounding area. Required facilities Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-28 must be constructed by the development project if the facilities are not already in place to serve an implementing development project (e.g. development of a Planning Area). 3.4 - PARKS, OPEN SPACE, AND RECREATION PLAN This section describes the plan for community parks, neighborhood parks, special use parks, and paseos within THE GROVES. The parks identified through the Citrus Trails Master Plan have been incorporated here. Conceptual plans for the design of the each of the parks and trails have been prepared. The plans represent the types of activities desired for each, as well as a conceptual layout. These are meant to provide direction to future developers, but not limit alternative designs and additional uses. Relevant General Plan Policy 3.4.1. See Appendix A for relevant General Plan policies that influence the Parks, Open Space and Recreation Plan for THE GROVES Specific Plan. Development Concept and Plan Features 3.4.2. THE GROVES at Loma Linda includes a thoughtfully planned system of parks and trails to provide residents with convenient access to a variety of outdoor recreation (both active and passive) and social activities. The location of recreational facilities within THE GROVES is displayed on Figure 3- 3, Park and Open Space Plan. In the heart of the community will be a large park consisting of North Park and Central Park, with a combined total of 29.8 acres. North Park had original been conceived through the planning and entitlement for Citrus Trails. Based on the additional open space requirements per Special Planning Area D, Central Park has been planned and located adjacent to North Park to create a grand community park for all residents of Loma Linda. The overall park and open space objective is to provide a variety of recreations activities within THE GROVES and to link every neighborhood to a trail system that connects to the parks and open space areas. As shown on Figure 3.2, Non-Vehicular Circulation and Access Plan, consideration has been given to how internal trails can connect to existing and planned off-site local and regional trail systems. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-29 Figure 3.4 - Open Space and Recreation Plan Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-30 3.4.2(a) - Community Parks a. North Park The 13.9-acre North Park, identified as Planning Area 2-6, provides active recreational opportunities for residents and the greater Loma Linda community. As presented on Figure 3.5, Conceptual North Park Plan, North Park includes recreational amenities such as basketball courts, bocce ball courts, pickle ball courts, horseshoe pits, and a children’s playground. A large open area designed for use as a dog park is located in the northeast corner of North Park. The majority of the turf area within the park is allocated for youth soccer fields, sized to provide game facilities for a variety of ages. Conveniently located throughout North Park, picnic shelters provide shaded seating and a 10-foot wide decomposed granite trail encircles the North Park boundary. North Park also provides a parking lot for vehicles and a restroom building. Evergreen canopy trees, deciduous trees, and accent trees that include pockets of orange trees are located along the park periphery and clustered within the northern portion of the park. Figure 3.1, Land Use Plan, shows a Community Use Overlay which allows for a variety of community-serving uses including a fire station, community multi-purpose building/facility, concession areas or restaurants, and commercial recreation uses such as fitness studios and batting cages. This overlay provides an optional range of uses to be considered in the final design of the park. b. Central Park In contrast to the emphasis on structured sports in North Park, the 15.9-acre Central Park is intended for multi-purpose areas for family picnics, tot lots, community fairs (arts/crafts, food festivals, etc.), annual concerts in the park, farmer’s market, biking and walking. The development of North Park is expected to occur prior to Central Park, therefore Central park should be designed and programmed in coordination with North Park in terms of shared parking, access between the two parks, and activities. At build-out, the two parks should function as one integrated community park. Figure X, Conceptual Central Park Plan, identified a preferred solution for shared parking, and a layout of multipurpose fields, trails, and other uses that compliment the conceptual plan for North Park. Like North Park, Figure 3.1, Land Use Plan, shows a Community Use Overlay which allows for a variety of community-serving uses including a fire station, community multi-purpose building/facility, small Amphitheatre, concession areas or restaurants. This overlay provides an optional range of uses to be considered in the final design of the park. Central Park may also be designed to accommodate storm water drainage from development within THE GROVES so that individual projects will not have to incorporate detention basins on-site (see Section 3.6, Grading, Drainage and Water Quality). This may be in the form of a permanent THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-31 lake that is designed to handle annual run-off, or in the form of detention basin that also includes non-structural park uses, or even in the form of an improved drainage channel that winds through the park and incorporates trails and landscaping. As illustrated in Figures 3.6, Conceptual Central Park Plan, Central Park includes community fair ground, family picnic, amphitheater, demonstration garden, drainage channel, and children’s playground. 3.4.2(b) - Neighborhood Parks a. South Park Located in Planning Area 2-15, the 4.0-acre South Park provides convenient recreational opportunities for residents of THE GROVES and neighborhoods located south of Mission Road. The concept plan for South Park, provided on Figure 3.6, Conceptual South Park Plan, features amenities for group use including a picnic shelter and gathering areas. Additional facilities include bocce ball courts, a children’s playground, and open play areas. A 10-foot wide decomposed granite trail, which leads past picnic benches and exercise stations, encircles South Park and ties into the pedestrian Paseo that leads to North Park. The Zanja Trail, which bisects South Park and continues off-site along Mission Road, includes interpretive signage as discussed in Section 3.5.2 (b) to educates users about the importance of the Zanja irrigation ditch to the history of the area. A parking lot and restrooms are also provided within South Park. Evergreen canopy trees and accent trees consistent with the landscape theme are located throughout South Park, creating a distinct community identity. 3.4.2(c) - Special Use Parks a. Oak Woodland Preserve The Oak Woodland Preserve consists of a .5-acre Oak Preserve Park (Planning Area 2-2) and a minimum 3-acre area within Planning Area 3-3, Mixed Use. These two areas encompass a mature coast oak woodland habitat which is to be preserved and protected. These two areas are expected to be incorporated into the design of any adjacent development project. Within Planning Area 3-3, this area is defined as an overlay, with the final boundary to be determined as part of the overall design of the planning area. As presented on Figure 3.7, Conceptual Oak Woodland Preserve Plan, the Oak Woodland Preserve will include a treehouse playground, healing garden, and picnic areas. It will also provide pedestrian connection to the surrounding uses. Priority trees have been identified in Section 3.5.2 (a). The final design shall include the necessary drainage area to ensure the health of the trees, as determined by an arborist. Improvements may include benches, picnic tables and additional native landscaping consistent with the coast oak woodland habitat. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-32 b. Heritage Park Heritage Park is a 6.6-acre existing, largely unimproved park within THE GROVES at Loma Linda. The site is located on the western edge of the Specific Plan area, north of Mission Road and adjacent to the Edison Easement. It currently contains two historic homes that have been moved to the site from nearby citrus properties. It also contains an historic adobe storage building built along the Zanja for storage of wheat, barley, beans, corn, and peas, as discussed in Section 3.5.2(b), Historic Resources. The historic homes, adobe, train car, and a wireless facility are located on the lower third of the park, with citrus groves located on the remainder of the site. The historic homes are currently being leased for office use. As noted in Section 3.5.2(b), Historic Resources, several additional historic homes within the specific plan area may be moved to Heritage Park. Existing Heritage Park include two historic homes and a historic adobe storage building. The conceptual plan for Heritage Park incorporates the existing uses, future historic homes, and expands improvements to include uses and activities for the public. As shown in Figure 3.8, Conceptual Heritage Park Plan, the park includes additional train cars, engines, a picnic and play area, and museum within one of historic homes. A small outdoor amphitheater for educational presentations or entertainment may also be included. The northern portion of Heritage Park will maintain the citrus groves, which can be accessed by a system of pedestrian trails. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-33 Figure 3.5 - Conceptual North Park Plan Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-34 Figure 3.6 - Conceptual Central Park Plan (Alternative One) THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 3 33-35 Conceptual Central Park Plan (Alternative Two) Figure 3.6 - Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-36 Figure 3.7 - Conceptual South Park THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-37 Figure 3.8 - Oak Woodland Preserve Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-38 Figure 3.9 - Heritage Park THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-39 Linear Park, Paseo and Parkway Trails 3.4.2(d) - a. VA Linear Park The Veterans Affairs Ambulatory Care Center (Planning Area 1-1) is an existing use within THE GROVES and includes a 5.5-acre Linear Park. The VA Linear Park is within the front setback area of the facility along Redlands Boulevard and Bryn Mawr. It includes a passive and active recreational area, including: a pocket seating area, a walking trail, an orchard grove, bocce ball, horseshoe pit, exercise circuit, chess tables, and public parking. b. Paseo and Trails Connecting Mission Road to Main Street A 2.3-acre Paseo (Planning Area 2-17) and a decomposed granite trail system provide a pedestrian amenity and facilitate access from Mission Road to Main Street. The Paseo, which varies in width from 27 to 40 feet, is located along the western boundary of single-family residential community of Citrus Trails, and features a 10-foot wide meandering decomposed granite trail surrounded by evergreen canopy and accent trees, as depicted on Figure 3.9, Conceptual Paseo Plan. The trail then extends north of Citrus Avenue to North Park and then continues through the Oak Woodland Preserve to Main Street. Picnic tables and exercise stations are sited along the Paseo, adding to the Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-40 function of this community amenity. Interpretive signage, as discussed in Section 3.5.2(b), Historic References, educates users of the Paseo about the history of the local area. c. Parkway Trails California Trail An 1.1-acre open space area and trail bordering THE GROVES frontage along California Street in Planning Area 2-18 provides a 10-foot wide decomposed granite trail flanked by trees, shrubs and groundcover south of Citrus Avenue. Adjacent to the Mixed Use Planning Areas north of Citrus Avenue, a 15-foot wide hard surface trail is provided in lieu of the decomposed granite material, which allows for continuation of the pedestrian connection along California Street and also facilitates the pedestrian oriented design of the adjacent Mixed Use Planning Areas by providing a wide walkway or space for outdoor dining. Commercia l Trail Commercial trail is a 22-foot parkway with a 10-foot wide meandering decomposed granite trail on the east side of Bryn Mawr Avenue abutting Planning Area 1-2 and 3-3. The trail will incorporate building frontage to create an appealing and comfortable street environment. It will also provide pedestrian connections to the surrounding parks and open spaces. Zanja Trail Connection Zanja Trail will be a natural surface path along the Mill Creek Zanja irrigation ditch parallel to Mission Road. It connects to its existing off-site alignment. Zanja Trail will include interpretive signage and elements relating to adjacent historic resources, local history, and other information about the area to educate the community and visitors. THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-41 Figure 3.10 - Conceptual Paseo Plan Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-42 Implementation Program 3.4.3. 3.4.3(a) - Park Dedication Requirements THE GROVES Specific Plan is consistent with the Special Planning Area “D” policies regarding the provision of parks, open space, and trails, which envision a minimum of 68.2 acres of parks, open space, and trails within Special Planning Area “D”. Table 3.4 below identifies the variety of facilities identified in this Specific Plan. Table 3.4 - Parks, Open Space, and Trails Allocation Summary Planning Area Parks, Open Space, and Trails Acreage Allocations Total Acreage Park Open Space Trail School Play Fields PA 1-1 VA Linear Park 5.5 5.5 PA 1-2 Commercial Trail 0.3 0.3 PA 2-2 Oak Woodland Preserve (Phase 2) 0.5 0 0 0.5 PA 2-6 North Park 13.5 0.4 0 13.9 PA 2-15 South Park 3.7 0.3 0 4.0 PA 2-17 Paseo 1.0 0.9 0.4 2.3 PA 2-18 California Trail 0 0.4 0.8 1.1* PA 3-1 Heritage Park 6.6 0 0 6.6 PA 3-2, 3-3 Park Avenue Trail 0 0.3 0.7 1.0 PA 3-3 Oak Woodland Preserve (Phase 3) 3.0 3.0 PA 3-4 Central Park 15.9 0 0 15.9 PA 0-1 Mission Elementary 5.0 5.0 PA 0-2 Future Middle School 9.1 9.1 Pa rks, Open Space, TTra il a nd School TTotal 49.7 2.33* 2.2 1 4.1 68.2* Note: * Mathematical inconsistency is a result of rounding The Loma Linda Municipal Code, Title 17, Chapter 17.20, requires residential development projects to provide 2.8 acres of park land per 1,000 residents. As shown in Table 1.1. THE GROVES provides for the development of 1,067 residential units. Using population generation rates provided in the Loma Linda Municipal Code, THE GROVES is expected to generate approximately 3,655 residents at ultimate build-out Therefore, under Chapter 17.20, THE GROVES has a park land requirement of THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-43 10.2 acres (3,655 residents/1,000 residents) x 2.8 acres = 10.2 acres). This Specific Plan provides for more than 10.2 acres of parks, open space, and trails, and therefore satisfies the park land dedication requirements of the Loma Linda Municipal Code. 3.4.3(b) - Provision of Required Park Facilities As THE GROVES community develops, the parks, open space, and trail facilities shall be available to serve the growing residential population. This subsection describes the process for determining Planning Area responsibility for the funding, design, and construction of park facilities within the Specific Plan. The responsibility for park facilities are proportionally allocated to each Planning Area based on the type of residential development and the number of residential units within the Planning Area using the residential unit/parkland ratios established in this subsection. Design and construction of the park facilities may be undertaken by the Planning Area property owners under a private cost sharing reimbursement agreement. Such an agreement is required to establish the proportional allocation of the expenses associated with the design, construction, and dedication of park facilities. Alternatively, the City may choose to undertake the design and construction of any or all of the park facilities described in the Specific Plan. Under this scenario, the City shall require each Planning Area to pay its proportional obligation for design, construction, and dedication of park facilities based on the type of residential development and the number of residential units developed within the Planning Area, using the residential unit/parkland ratios established in this subsection. 3.4.3(c) - Phase 2 Planning Areas - Contribution Through Funding or Construction Planning Areas within Phase 2 (Citrus Trails) shall proportionally contribute toward design, construction, and dedication of park facilities based on residential units via the method designated in Table 3.5, Provision of Parks, Open Space, and Trails, which establishes requirements for construction of park facilities or payment of fees for each Planning Area. Table 3.5 shall apply to the respective property owners for residential development within Low Density Residential, High Density Residential, Senior Housing, or Mixed Use Planning Areas. Table 3.5 specifies payment of fees or construction of facilities based upon property ownership. The parcels within Phase 2 are owned by several different land owners. Where land owners have land available to dedicate for park facilities, Table 3.5 specifies the required dedication of land and construction of park facilities upon the development of an associated Planning Area. When an owner of a Planning Area does not possess land to dedicate for park facilities, a monetary Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-44 contribution is required upon development of the Planning Area. (Credits and debits under the private cost sharing reimbursement agreement ultimately provide for proportional distribution of the total cost based on residential development.) 3.4.3(d) - Phase 2 Planning Areas - Determining Proportional Share for Park Facility Implementation This subsection describes the process for determining the proportional distribution of park facility design, construction, and dedication costs based on a Planning Area’s residential development. x The estimated cost for detailed design and construction of the park facilities and the value of land dedicated for park improvements shall be determined as discussed below or as described in the parkland private cost sharing reimbursement agreement; x The estimated costs and land values shall be proportionally allocated among Planning Areas based on type of residential development and number of residential units; x As part of the development process for each Planning Area, as provided in Table 3.5, Provision of Parks, Open Space, and Trails Trails for Phase 2 Planning Areas, the Planning Area property owner shall design and construct park facilities to support development of the Planning Area or the Planning Area property owner shall pay their share of the park implementation costs through the private cost sharing reimbursement agreement. Reimbursement shall only be for expenses incurred beyond their proportional responsibility for the park facility being designed and constructed as set forth in the private cost sharing reimbursement agreement. 3.4.3(e) - Phase 2 Planning Area - Determining Expense of Park Facility Development The total cost to prepare design plans, construct, and dedicate land for the Parks, Open Space, and Trails identified in Figure 3.4, Open Space and Recreation Plan, shall be determined in order to proportionally allocate the expenses associated with implementation of park facilities. (The open space trail located along California Street, which shall be constructed in segments as part of the roadway improvements by the adjacent Planning Areas as each is developed, shall be excluded from park facility cost estimates.) THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-45 Table 3.5 - Provision of Parks, Open Space, and Trails for Phase 2 Planning Areas Planning Area Primary Method of Contribution Threshold for Implementation -- Residential Building Permits Monetary Contribution to Fund Park Developmeent Dedicate Land and Construct Indicated Facility1 Submit Construction Plans22 Commence Construction Complete Park Facility3 2-1 -- Oak Woodland Preserve (Planning Area 2-2) Prior to issuance of the 1st MFR Building Permit in Planning Area 2-1 -- Prior to issuance of the final MFR Certificate of Occupancy in Planning Area 2-1 2-2 Yes -- -- -- -- 2-4 Yes -- -- -- -- 2-5 Yes -- -- -- -- 2-7 Yes -- -- -- -- 2-8 -- North Park - northern portion (Planning Area 2-6A) Prior to issuance of the 1st SFR Building Permit in Planning Area 2-8 Prior to issuance of the 50th SFR Building Permit in Planning Area 2-8 Prior to issuance of the final SFR Certificate of Occupancy in Planning Area 2-8 2-9 – 2- 114 -- -- -- -- -- 2-12 -- North Park - southern portion (Planning Area 2-6B) Prior to issuance of the 1st SFR Building Permit in Planning Area 2- 12 Prior to issuance of the 50th SFR Building Permit in Planning Area 2-12 Prior to issuance of the final SFR Certificate of Occupancy in Planning Area 2-12 Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-46 Design and construction costs shall be determined through submittal of competitive bids for the preparation of detailed landscape plans, landscape construction documents, and labor and materials for installation of park facility improvements, consistent with the Specific Plan conceptual park facility exhibits. The bids shall be submitted to the area property owners as provided in the private cost sharing reimbursement agreement. The value of land required to be dedicated for park facilities shall be the value assigned to land in the City’s park fee schedule. 3.4.3(f) - Phase 2 Planning Area - Determining Required Level of Contribution After determining the total cost for preparation of plans, construction, and land dedication, a prorated cost per Phase 2 Planning Areas allocated residential unit shall be established under the terms of the private cost sharing reimbursement agreement to determine the required financial contribution for each Planning Area. 2-13, 2-14 or 2-16 -- South Park and Paseo (Planning Area 2-15 and 2-17) Prior to issuance of the 1st SFR Building Permit in Planning Area 2- 13, 2-14 or 2-16 Prior to issuance of the 50th SFR Building Permit in Planning Area 2-13, 2-14 or 2-16 Prior to issuance of the final SFR Certificate of Occupancy in Planning Area 2- 13, 2-14 or 2-16 (cumulative) Notes: 1. The open space trail located in Planning Area 2-18 shall be constructed in segments as part of the roadway improvements by the adjacent Planning Areas as each is developed. 2. Design/Construction plans shall address the entire park facility, and shall not be limited to a specific half or segment. 3. Prior to issuance of a Certificate of Occupancy for the indicated dwelling unit, the respective park facility shall be deemed complete to the satisfaction of the Public Works Director, who shall have discretion to determine if sufficient progress toward park completion may allow for issuance of a Certificate of Occupancy prior to final park completion. 4. Planning Area 2-9, 2-10, and 2-11 shall not be required to contribute to park funding, dedication, or construction provided the respective Planning Area does not contain residential units. If residential units are developed within Planning Area 2-9, 2-10, or 2-11 through the Transfer of Development process (Section 5.13), the Planning Area shall be responsible for a per residential unit contribution to park facility funding. THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-47 1) The level of contribution toward park facility implementation for each Planning Area shall be determined by the product type and number of residential units developed within each Planning Area. Single-family and multi-family homes are allocated a larger share of parkland responsibility than senior or special needs housing units because these uses have a lower demand for park facilities. 2) Single-family residential homes shall be counted as 1.0 residential unit; multi-family units (excluding senior and special needs units) as 0.6 residential unit; and senior and special needs units as 0.44 residential unit. 3.4.3(g) - Phase 2 Planning Areas - Determining Payment or Credit In Table 3.5, Provision of Parks, Open Space, and Trails, each Planning Area is designated to either contribute funding or design/construct facilities. For Planning Areas that are required to design/construct park facilities, once the park facilities are complete, the Planning Area property owner’s actual cost for design/construction, along with the value of dedicated land, shall be determined. This amount shall be compared to the calculated proportional cost obligation for the Planning Area. If the costs are greater than the Planning Area park fee obligation, the property owner shall be credited that amount, pursuant to the private cost sharing reimbursement agreement. In the event that the costs are less than the Planning Area park fee obligation, the property owner shall pay the difference, pursuant to the private cost sharing reimbursement agreement. 1) Payment x For Planning Areas that are required to contribute funds per Table X, the provisions in subsection (2), Determining Required Level of Contribution, shall be utilized to determine the Planning Area financial obligation for implementation of park facilities. The full obligation shall be paid by the Planning Area property owner through the private cost sharing reimbursement agreement prior to issuance of the first residential building permit in the respective Planning Area or as provided in the private cost sharing reimbursement agreement (payment shall be documented to the satisfaction of the Community Development Director). x Planning Areas that design and construct park facilities as specified in Table X shall be required to fulfill any cost deficit if their actual cost of park facility implementation (for design plans, construction, and value of dedicated land) is less than their obligation as calculated in subsection (2), Determining Required Level of Contribution. The property owner shall make an additional monetary contribution through the private cost sharing reimbursement agreement to fulfill the deficit prior to issuance of a Certificate of Occupancy for the last residential building permit in Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-48 the respective Planning Area (payment shall be documented to the satisfaction of the Community Development Director). 2) Credit x Planning Areas that design and construct park facilities as specified in Table X shall receive a credit if their actual cost of park facility implementation (for design plans, construction, and value of dedicated land) is more than their obligation calculated in subsection (2), Determining Required Level of Contribution. A credit shall be provided to the Planning Area property owner through the private cost sharing reimbursement agreement prior to issuance of a Certificate of Occupancy for the last residential building permit in the respective Planning Area or upon completion and acceptance of the park facility. 3.4.3(h) - Phase 2 Planning Areas - Timing of Park Facility Construction The timing for submittal of construction plans to the City, commencement of construction, and completion of the park facility shall be as specified in Table 3.5. Prior to issuance of a Certificate of Occupancy indicated in Table3.5. the respective park facility shall be deemed complete to the satisfaction of the Public Works Director, who shall also have the discretion to determine sufficient progress toward park facility completion to allow for issuance of Certificate of Occupancy permits prior to final park facility completion. 3.4.3(i) - Open Space and Recreation Plan Development Standards 1) Final park land dedication requirements for Phase 2 Planning Area shall be based on the park, open space, and trail requirements in Table 2.B of the Loma Linda General Plan and be determined by the City at the time the implementing tentative tract map(s) is submitted for review. 2) Private recreational facilities, such as those serving residential units within the Mixed Use and Senior Housing Planning Areas, shall be privately owned and maintained by a master homeowners’ association or similar entity. 3) Recreational facilities and manufactured slopes within the open space areas shall be landscaped and, where necessary, irrigated in a manner that is conducive to the type of plant material and landscape setting. 4) Landscaping within recreation and open space areas shall be consistent with Section IV, Design Guidelines, of this Specific Plan. 5) Landscaping within recreation and open space areas shall conform to the standards set forth in the Loma Linda Municipal Code Chapter 13.32, Water-Efficient Landscape. 6) Conceptual landscaping plans shall be submitted to the City of Loma Linda Planning Division for review in conjunction with tentative map applications that implement any portion of this Specific Plan. THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-49 3.4.3(j) - Phase 3 Planning Areas – Park Implementation Requirements Phase 3 Planning Areas are expected to be developed by multiple property owners’ overtime. Each of the parks, open spaces, and trails within Phase 3 will be implemented as follows: 1) Central Park – All residential projects within Phase 3 shall be required to either contribute funding or design/construct park facilities in accordance with their fair share park dedication obligation per the Loma Linda Municipal Code. Central Park shall satisfy the public parkland obligation for Phase 3 Planning Areas. Each project shall enter into an agreement with the City at the time of approval of a subdivision map regarding the terms for meeting their requirement. 2) Oak Woodland Preserve – A minimum of 3-acres shall be dedicated and improved by the property owner(s) for Planning Area 3-3, in accordance with the Planning Area development standards in Chapter 4.0. The property owner(s) for Planning Area 3-3 shall enter into an agreement with the City at the time of approval of a subdivision map regarding the terms for meeting their requirement. 3) Heritage Park – Heritage Park is currently owned and maintained by the City. The City shall continue to own, maintain, and improve the park overtime as funding permits. 3.5 - CONSERVATION AND PRESERVATION PLAN 3.5.1 - Relevant General Plan Policy See Appendix A for relevant General Plan policies that influence the Conservation and Preservation Plan for THE GROVES Specific Plan. 3.5.2 - Development Concept and Plan Features 3.5.2(a) - Biological Resources The Specific Plan area includes approximate 3.5 acres of disturbed coast live oak woodland located in the northern portion of the area, predominately within Planning Areas Planning Area 2-2 and Planning Area 3-3. The City’s General Plan guiding policy for oak woodlands states to preserve, as feasible, the oak woodland areas within the City by requiring development to incorporate the trees into the development design. The Specific Plan designates this oak woodland habitat to be preserved and managed in perpetuity through an Oak Woodland Preserve Overlay. The Groves provide development standards and guidelines to preserve existing oak trees and provide for replacement at an appropriate ratio of those trees than cannot feasibly be preserved. Further, the Loma Linda Municipal Code Chapter 17.74 “Tree Placement, Landscape Materials, and Tree Removal” outlines Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-50 local policies and ordinances regulating landscape development which include protecting and maintaining significant existing trees. The Specific Plan includes project design criteria for avoidance of removal or encroachment of coast live oak trees during development, and requires that the oak woodlands be actively managed to ensure their long-term health. 3.5.2(b) - Historic Resources The following elements are included throughout THE GROVES community to help educate residents and visitors in the rich history of the surrounding area by providing historic information and/or visual references to one or more of the following historic uses of the project site or project area: a Mission storehouse, a Native American village, a Mexican rancho, Mormon settlements, and early citrus farming. a. Historic Reference through Architectural Styles The architectural styles selected for THE GROVES reflect modern interpretations of the historic architecture prevalent in the region. The designated architectural styles for THE GROVES are: Mediterranean Revival, Craftsman, Prairie, Monterey, and Italianate. These architectural styles are consistent with the Loma Linda Municipal Code, Chapter 17.82 (Historic Mission Overlay District). b. Historic Reference through Mission District Identification In order to convey the area’s history to residents and visitors of THE GROVES, the design of the Major Monuments and Minor Monument discussed in Section IV.D.3, Monumentation, includes text identifying the “Historic Mission District” in addition to the THE GROVES community name at prominent entryways into the community. c. Historic Reference through Public Art at Entry Monuments As a special accent to the Monuments discussed in Section IV.D.3, Monumentation, public art elements are used to evoke the history of THE GROVES area. The theme and materials employed in the art sculpture may include references to any of the following: Mission period, Native American village, Mexican rancho, Mormon settlers, or citrus farming. The preliminary art concept for the entry monument located on the southwest corner of California Street and Citrus Avenue is a cast metal sculpture of a child riding a vintage orange crate scooter. The vision for the entry monument located on the northwest corner of California Street and Orange Avenue features a cast metal sculpture of vintage smudge pots, which were used in citrus groves to protect fruit trees from frost. THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-51 d. Historic Reference through Residential Street Naming The residential builder(s) of the THE GROVES community will work with the City of Loma Linda to create a residential street naming program that uses words or names connected with the area’s historic past, which may include references to the Mission period, Native American village, Mexican rancho, Mormon settlers, or citrus farming. e. Historic Reference Design Guidelines These Historic Reference Design Guidelines apply to the locations and land uses specified below to ensure that the design of THE GROVES amenities links the present day community to the area’s past. Provisions that are followed by a parenthetical reference to a section of the Loma Linda Municipal Code shall be considered mandatory provisions. The word “shall” indicates elements required by the Loma Linda Municipal Code; whereas, “should” indicates an element that is encouraged but not required, or provides one of a variety of possibilities to implement a mandatory provision. The photographs accompanying the Historic Reference Design Guidelines provisions provide a suggestion, and are not meant to dictate the precise design of the elements. 1) Zanja Trail The following are requirements pertaining to the identification and preservation of the Zanja Trail on-site. x Establish Zanja Trail alighment based on confirmed Zanja location. x Interpretative signage shall be provided along the Zanja Trail from South Park to Heritage Park (per 17.82.090.C.5). x Design elements or materials that provide a visual reference to the appearance of the original Mill Creek Zanja should be considered at a key point along the Zanja Trail connection. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-52 2) South Pa rk x Site design and amenities (e.g., play equipment, picnic shelters) should be influenced by Native American village and/or Mission themes through use of materials including clay tile pavers, barrel tile roofs, stucco, cobble, simple wrought iron, and wood rail fencing. x Park furnishings (e.g., benches, light standards, drinking fountains, trash receptacles) shall feature styles and materials that are compatible with the historic use of the area (per 17.82.090.C.7) as a Native American village and/or Mission storehouse. 3) Pa seo x Interpretative signage shall be provided at the north and south entrances of the Paseo and/or along its path (per 17.82.090.C.5). Consideration should be given to using interpretative signage to create a timeline through history along the Paseo trail (i.e., representing the Mission and Native American periods along the southern portion near South Park, the Mexican rancho period and Mormon settlement in the middle, and citrus farming along the northern portion near North Park). x Design of the landscape should be complementary to the historic theme, such as the use of native trees and shrubs in a natural pattern, stone accents, and rustic/natural materials. x Amenities (e.g., benches, exercise stations) shall be complementary to the periods conveyed in the interpretive signage (per 17.82.090.C.7), such as through the use of simple, natural materials. 4) Community Pa rks x Community Park should reflect the citrus farming history of THE GROVES, including the early period to the modern era, through elements that may include themed playground equipment and themed amenities such as picnic shelters. x Consideration should be given to the use of citrus trees as an accent in the landscaping within or near Community Parks. THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-53 x Park furnishings (e.g., benches, light standards, drinking fountains, trash receptacles) shall feature styles and materials that are compatible with the historic use of the area (per 17.82.090.C.7) for citrus farming. 5) Mixed Use and Senior Housing Public art should be employed within focal points in the Mixed Use and Senior Housing areas to educate residents and visitors about the area’s diverse history. Appropriate historic references may include one or more of the following: Mission period, Native American village, Mexican rancho, Mormon settlers, or citrus farming. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-54 x Signage should be compatible with the building architectural styles to reflect the historical significance of the area. Signage may include modern interpretations provided it complements the building architecture. Signage should avoid a mundane, mass- produced appearance by discouraging the use of can signs or internally illuminated channel lettering. The design of the sign program shall be able to provide at least one element or component (such as a district logo, sign shape, material, or color) that can be used to unify all future sign programs within the Historic Mission Overlay District. 3.5.2(c) - Sustainable Practices To further the City of Loma Linda’s objectives for sustainable development, The Groves concepts incorporate the following concepts: x Encourage sustainable landscapes or landscapes that require little irrigation through the use of drought-tolerant and native vegetation in new development. x Pursue the use of reclaimed water for the irrigation of all appropriate open space facilities and City projects, and encourage existing and new developments to tie to the reclaim water system when available and recommended by the San Bernardino Municipal Water Department (wastewater provider) to reduce demand on municipal water supplies. x Through the development review process, encourage water conservation in all new and rehabilitated development through the use of water conserving fixtures in all new residential and commercial development. x Require implementation of Best Management Practices to reduce drainage system discharge of non-point source pollutants originating from streets, parking lots, residential areas, businesses, industrial operations, and those open space areas involved with pesticide application. 3.5.3 - Implementation Program [In taking action on the Specific Plan, the City Council may provide direction to City staff for revisions to the Pubic Hearing Draft, dated June 2018, and for incorporation into the final adopted version of the Specific Plan. This section will be completed and finalized by the Community Development Director as directed by the City Council.] Oak Woodland Preserve Mitigation Measure MM 4.3-1 is required as identified in the adopted Mitigation Monitoring and Reporting Program for The Groves Specific Plan. MM 4.3-1 requires the following to ensure protection of the oak woodlands area: In accordance with the City of Loma Linda General Plan to conserve oak woodland a minimum of 3 acres of oak woodland shall be preserved in perpetuity. An Oak Woodland Protection Plan shall be THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-55 developed prior to development of the Phase Three Concept Area. A copy of the Oak Woodland Protection Plan, prepared by a qualified biologist, shall be submitted to the Community Development Director at the time grading or building plans are submitted for approval and permits. The Oak Woodland Protection Plan will include the following items: x Responsibilities and Qualifications of the Personnel to Implement and Supervise the Plan. The responsibilities of the Landowner, Specialists, and Maintenance Personnel that would supervise and implement the Plan shall be specified. x Site Selection. The location of the 3-acre protected oak woodland shall be clearly identified. Additionally, individual tree locations within the 3-acre preserve shall be identified. x Site Preparation and Planting Implementation. Site preparation shall include: (1) protection of existing trees, (2) trash and weed removal, (3) native species salvage and reuse (i.e., duff), (4) signage installation at strategic locations to keep pedestrians on designated trails, and (5) selection and protection of naturally recruited oak trees. x Maintenance Plan/Guidelines. The Maintenance Plan shall include: (1) weed control, (2) herbivory control, (3) trash removal, and (4) seedling/sapling protection. x Monitoring Plan. The Monitoring Plan shall include: (1) qualitative monitoring (i.e., photographs and general observations); (2) quantitative monitoring and (3) annual reports which shall be submitted to the Community Development Director for five years. x Long-Term Preservation. Long-term preservation of the site shall ensure the mitigation site is not impacted by future development. A performance bond shall be secured prior to implementation of the plan and the site shall be preserved as open space in perpetuity. The prepared plan will be submitted to the Community Development Director for final approval prior to ground disturbance. related to implementation of any Phase Three Concept Area project activities. The Plan will then be implemented within one year of the completion of rough grading activities. Preservation of Historic Resources Mitigation Measures MM 4.4-1 through MM 4.4-12 are required as identified in the adopted Mitigation Monitoring and Reporting Program for The Groves Specific Plan. These measures ensure protection of historic structures and sub-surface cultural resources. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-56 3.6 - INFRASTRUCTURE, SERVICE, UTILITIES, AND WATER QUALITY PLAN 3.6.1 - Relevant General Plan Policy See Appendix A for relevant General Plan policies that influence the Infrastructure, Service, Utilities, and Water Quality Plan for THE GROVES Specific Plan. 3.6.2 - Development Concept and Plan Features The Specific Plan includes guidance for the coordinated development of infrastructure, utilities and services to serve the Specific Plan site. 3.6.2(a) - Grading and Soils The Specific Plan site is situated within a fault-bounded valley/basin, informally referred to as the San Bernardino Basin. Most of the basin surface is covered by alluvial fans emanating from the San Bernardino Mountains, as well as the neighboring San Timoteo Badlands and Crafton Hills. The Specific Plan area lies within what is known, hydrologically, as the Bunker Hill groundwater basin and encompasses all of the San Bernardino Valley Basin. Based on historic groundwater level data, groundwater at the Specific Plan site has not been encountered above a depth of 70 feet below ground surface (bgs). Topographically, the Specific Plan area occupies the mid-portion of an alluvial fan emanating from San Timoteo Canyon about one mile southeast of the Specific Plan area. The natural slope within the area displays a surface gradient of about one percent (0.01 foot/foot). The Specific Plan site is not located within a special studies (Alquist-Priolo) zone. No known active nor potentially active faults lie within or project towards the Specific Plan site. Surficial materials within the Specific Plan site consist of topsoil and recent alluvial deposits. Older alluvial deposits underlie the entire site at depths greater than about 50 feet. Native topsoil materials that once blanketed much of the site have been extensively disturbed due to cultivation for the citrus orchards and residential development along the southern and northern borders of the site. Where still present, these soils are described by the U.S Department of Agriculture Soil Conservation Service (USDA, 1980) as San Emigdio fine sandy loam and Hanford sandy loam, both part of the Hanford Soils Series. These soils are typically dry, porous, loose, contain varying amounts of organic material, and are as much as five feet thick. These soils are considered to be moderately to highly permeable, and moderately erodible in their natural condition. Any improvement projects that involve structural components tied to soils are required to submit to the City for review and approval a soils report or geotechnical report prepared by a State- licensed geotechnical engineer, and to comply with conclusions and recommendations of the soils report which ensure that the structural integrity of any future construction would not be THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-57 compromised by the underlying soils. Compliance with standard City engineering requirements, as well as the recommendations of any geotechnical and soils report is required. Construction would address the recommendations made in the geotechnical report to ensure seismic and soils stability and reliability. 3.6.2(b) - Surface Water Drainage, Storm Water and Water Quality Management The Specific Plan site is located within the Santa Ana River Watershed and is located primarily in the Bunker Hill Basin. This water basin underlies most of the San Bernardino Valley extending from the San Bernardino Mountain range to the south hills of Loma Linda. The Bunker Hill Basin is artificially recharged by surface stream diversions made for groundwater replenishment. This aquifer supplies the majority of water to the City. The replenishment activities play an extremely important role in managing the Bunker Hill Basin to supply the current and future needs of the Basin, which includes the future needs of the City.1 Based on historic groundwater level data, depth to groundwater beneath the Specific Plan area has reportedly never been shallower than about 70 feet from the ground surface. A Year 2000 groundwater level reading from a well located along Mission Road indicated a groundwater level of 177.9 feet below ground surface. The Basin’s principal groundwater aquifer in the Specific Plan area is capable of producing as much as 4,400 gallons per minute from wells. Irrigation water to the existing and previous agricultural uses in the Specific Plan site is supplied by at least four large irrigation wells located either within or along the margins of the Specific Plan area. Although groundwater recharge from irrigation return once was significant, it has become less so with the continuing urbanization of agricultural lands.2 According to Federal Emergency Management Agency Flood Insurance Rate Maps, the Specific Plan site is located within Flood Zone X, which is defined as outside the zone with 0.2% annual chance floodplain, and is not located in the flood zones for either the Zanja flood control channel, located immediately to the east, or San Timoteo Creek, located approximately 0.17 mile to the south.3 According to the Loma Linda General Plan and the San Bernardino County General Plan Hazard Overlay Map FH31B, the Specific Plan site is not located within a flood hazard zone, except 1 Loma Linda General Plan, Chapter 9.6 (Water Resources). 2006. 2 Magorien, C.E.G., Geology, Soils and Seismicity Report. 2003. 3 FEMA, FIRM No. 06071C8711H. 2008. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-58 for a small area on the border of the northeast corner of the Specific Plan site.4, 5 This area is defined as Zone X, Inside 500 Year Flood Plain. The Specific Plan site has mild slopes of less than two percent which drain in a northwesterly direction.6 Under existing conditions, the Specific Plan site is not subject to off-site stormwater flowing onto the Specific Plan site because off-site stormwater flows are captured within existing street rights-of-way bordering the Specific Plan site and are conveyed to the Mission Zanja Creek/San Bernardino Flood Control Channel located northeast of the site. Therefore, off-site flows are not present under existing conditions.7 Because the Specific Plan site is relatively flat, it is not subject to significant erosion by water through surface drainage during construction. The San Bernardino County Flood Control District services the City for local and regional flood control and drainage facilities. The Specific Plan site and surrounding area is currently served by existing storm drains. The County Flood Control District is responsible for flood protection on major streams, water conservation, and storm drain construction.8 Development of THE GROVES will increase the amount of impervious area, thereby necessitating the need for a comprehensively designed surface water run-off and stormwater drain system to coltected the increased runoff from the site. In accordance to the NPDES permit program and to accommodate the increase in stromwater flow, THE GROVES development would be required to have designed a stormwater collection system to control water pollution by regulating point sources that discharge pollutants into the water. Under the developed condition, stormwater will be captured within road rights-of-way and conveyed to onsite self-treating facilities that will release clean water to an underground storm drain system, before being transported to the City’s existing storm drain system off-site. Water features, basins, open spaces and park sites incorporated throughout THE GROVES will provide ample groundwater recharge. In addition, a reclaimed water system will be installed to irrigate the parks, paseo, and parkways along Park, Citrus and Orange Avenues, Mission Road, and California Street and potentially to field areas of the future middle school and designated park areas. The drainage system for managing stormwater flows within The Goves is shown in Exhibit 3-11: Master Drainage Plan and Exhibit 3-12, Master Storm Drain Plan. Each individual development 4 Loma Linda General Plan, Chapter 10.2 (Flooding Hazards). 2006. 5 San Bernardino County General Plan, Land Use Plan, Hazards Overlays. 2010. 6 Magorien, C.E.G., Geology, Soils and Seismicity Report. 2003. 7 Citrus Trails Master Plan, Drainage Plan. 2016 8 Loma Linda General Plan, Chapter 10.2.1. 2006. THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-59 implementing project within THE GROVES (which could involve multiple Planning Areas), will be required to prepare a Water Quality Management Plan (WQMP). Each WQMP will be designed in accordance with the adopted County of San Bernardino Area Wide Stormwater Program and will utilize the associated Technical Guidance Document for Water Quality Management Plans as the basis for the WQMP design. Low Impact Development (LID) is one of the guiding principles of the WQMP and is defined in the San Bernardino County Stormwater Program as: “a stormwater management and land development strategy that combines a hydrologically functional site design with pollution prevention measures to compensate for land development impacts on hydrology and water quality. LID techniques mimic the pre-development site hydrology by using site design techniques that store, infiltrate, evapo-transpire, bio-filter or detain runoff close to its source”. Potential benefits of implementing LID practices include: 1) Maintaining pre-development hydrology – Maintaining the predevelopment hydrology reduces the volume of water that must be conveyed offsite. 2) Water quality benefits – Pollutant loads carried by stormwater runoff can be greatly reduced through retention of stormwater and pollutants onsite and use of BMPs that biofilter pollutants onsite, thus reducing pollutants that would normally be discharged directly to the storm drain system. 3) Groundwater recharge – LID emphasizes infiltration of runoff onsite, which has the potential to increase local water supply availability from groundwater sources. 4) Aesthetic appeal – LID involves the use of site design practices that minimize the footprint of proposed developments, which increases preservation of open space, including over 20 percent of the site for open space, parks, paseos, and basins. Construction of drainage infrastructure facilities shall occur commensurate with what is warranted at the time of a development project. The facilities that are warranted will be determined by the development project’s specific hydrology study and WQMP. Therefore, timing of construction of any given project is a relevant factor in determining its facility requirement since the requirement will rely on the storm drain facilities in existence at that time. Consequently, an upstream planning area may trigger the need for storm drain improvements on downstream planning areas in advance of their development. In any event, the following Storm Drain Master Plan serves as a guide for implementation for the proposed Project. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-60 Figure 3.11 - Master Drainage Plan THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-61 Figure 3.12 - Master Strom Drain Plan Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-62 The Specific Plan site consists of three types of sub-areas: Type 1, existing development in which no new or additional drainage facilities are envisioned; Type 2, Phase Two Concept Area (Citrus Trails Master Plan), a 111.7-acre master planned development that has been entitled but not yet constructed; and Type 3, the balance of the Specific Plan site that is currently either partially developed or undeveloped. These three sub-areas can be broken down into their respective Planning Areas as follows: 5) Sub-area Type 1 o Planning Area 0-1: Existing Mission Elementary School o Planning Area 1-1: Existing VA Ambulatory Care Center o Planning Area 3-7: Existing Mission RV Park and Cha-Cha’s Tacos 6) Sub-area Type 2 o Planning Area 2-1 through Planning Area 2-17: Phase Two Concept Area (currently entitled but not constructed) 7) Sub-area Type 3 o Planning Area 0-2: Redlands Unified School District future school site (currently undeveloped) o Planning Area 1-2: Vacant, undeveloped land o Planning Area 3-1: Heritage Park (currently partially developed) o Planning Area 3-2 through 3-5: Undeveloped, partially covered with orange groves o Planning Area 3-6: Existing single-family residences and undeveloped, partially covered with orange groves Sub-area Type 1 The existing developed site within Planning Area 0-1 is the Mission Elementary School that underwent site and building renovation in recent years. Renovation included addressing its drainage and water quality requirements, which implemented significant open landscaped areas. The site is unlikely to have any additional alterations in the foreseeable future. The existing developed site within Planning Area 1-1 is a recently constructed VA Ambulatory Care Center. The project complied with current water quality requirements as well as constructed a 54- inch storm drain in Redlands Boulevard that ultimately connects to the Mission Zanja Channel. The storm drain system was analyzed and sized to accommodate upstream tributary areas within the Specific Plan site. The site is unlikely to have any alterations in the foreseeable future. The only site within this sub-area that has a potential for redevelopment in the future is Planning Area 3-7. This Planning Area is currently fully developed and surface drains from south to north to Redlands Boulevard. In the event of future redevelopment, the Planning Area will be responsible to THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-63 address its Water Quality and drainage responsibilities without reliance on facilities proposed by the Specific Plan. Sub-area Type 2 The Phase Two Concept Area has received approval of entitlements by the City of Loma Linda (Planning Area 2-1 through Planning Area 2-17). The approval included an EIR which, among other issues, included a Master Drainage Plan. The master plan addresses all drainage and water quality design requirements that must be implemented as part of the construction in the Phase Two Concept Area (Citrus Trails Master Plan). THE GROVES at Loma Linda Specific Plan builds on the Master Drainage Plan as defined by the Citrus Trails Master Plan and does not propose any alterations to that plan. However, in the event that all or any portion of the Specific Plan is constructed prior to construction of Citrus Trails Master Plan drainage facilities, a hydrologic study will be required to address how storm water from upstream areas within Phase Two Concept Area will be carried through or diverted around the Specific Plan site in a manner acceptable to the City of Loma Linda. Sub-area Type 3 Planning Area 0-2 is a future school site owned by Redlands Unified School District. The site plan and construction schedule for the school is indeterminate at this time. Preliminary concepts suggest that the northerly portion of the site will be sport fields. The existing drainage pattern of the Planning Area is generally to the northwest of the site so that the conceptual location of the fields is ideal for retention and self-treating landscaping. When a commitment is made to a site plan and construction date, a hydrologic study and WQMP will be required to address how storm water and water quality features will address the then current State and Local standards. The Planning Area will be responsible to address its water quality and drainage responsibilities onsite without reliance on facilities proposed by the Specific Plan. The provisions will include retention and self-treating areas that shall be designed to not increase or alter the historic stormwater flows to downstream properties. The southeast corner of Redlands Boulevard and Bryn Mawr Avenue is designated Planning Area 1- 2. The existing drainage pattern is from south to the northwestern corner of the site. Upon submittal for a specific development scheme, this Planning Area will be responsible to address its water quality and drainage responsibilities with onsite self-treating facilities that will release clean water to the existing 54-inch storm drain in Redlands Boulevard through an underground storm drain. Heritage Park (Planning Area 3-1) is a City of Loma Linda owned park and business center that is partially occupied with historic structures, drive access and parking for visitors and business Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-64 patrons. Almost half of the site is currently vacant or occupied by orange grove. The existing site drains from south to north. This Planning Area will be responsible to address its water quality and drainage responsibilities with on-site retention and self-treating facilities that shall be designed to not increase or alter the historic stormwater flows to downstream properties. The majority of sub-area Type 3 is undeveloped land, mostly occupied by orange groves (Planning Area 3-2 through Planning Area 3-5). Proposed within Planning Area 3-3 and Planning Area 3-4 is a public park that is intended to serve multiple purposes. While its primary emphasis is for passive and active recreation for the public, it will also serve as a stormwater retention basin and water quality feature. There is a potential under consideration to incorporate a year-round lake in this area that will be sized to accommodate stormwater requirements. If so, the stormwater that will reach the lake from impervious areas due to development will require some form of pre-treatment prior to entering the lake. In the event a lake is not implemented, then the same general area will be designed as a self-treating landscaped retention basin, only having water present during a storm event. Once the storm water has been appropriately treated, it will be released to an underground storm drain that will connect to the existing 54-inch storm drain in Redlands Boulevard. Planning Areas Planning Area 3-2 through Planning Area 3-5 will all rely on the basin and/or lake to handle the stormwater and water quality features necessary for their development. The northern portion of Planning Area 3-3 will address its water quality and drainage responsibilities with onsite self-treating facilities that will release clean water to the existing 54-inch storm drain in Redlands Boulevard through an underground storm drain. Planning Area 3-6 has existing single-family homes that have access from Mission Road. The existing drainage pattern is away from Mission Road, generally in a northwesterly direction. The majority of this Planning Area will also drain to the above mentioned basin and/or lake. The exception is the westerly parcels having existing residences as shown on Exhibit 3-3. Those parcels will be responsible to address their water quality and drainage responsibilities onsite without reliance on facilities proposed by the Specific Plan should they decide to redevelop their properties. THE GROVES will comply with General Plan Implementing Policies for Water Resources through: the use of drought-tolerant and native vegetation; the use of reclaimed water for the irrigation of all appropriate open space facilities, and; implementation of Best Management Practices to reduce drainage system discharge of non-point source pollutants originating from streets, parking lots, residential areas, businesses, industrial operations, and those open space areas involved with pesticide application. Projects that disturb greater than one acre are required to be in compliance with the National Pollution Discharge Elimination System (NPDES) stormwater permit. The purpose of the NPDES is to contain and control sediment on a short-term basis during construction by preventing soil from THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-65 leaving the site and entering storm drain facilities to impact downstream sources. To comply with NPDES requirements, the Municipal Stormwater Permit (MS4) for San Bernardino County was adopted by the Santa Ana Regional Water Quality Control Board on January 29, 2010 (R8-2010- 036, NPDES CAS618036) and as required by the Clean Water Act. Development with THE GROVES would be required to adhere to and comply with the MS4 Permit, and thus NPDES General Construction Permit and implement an effective Stormwater Pollution Prevention Plan (SWPPP) during construction. The City of Loma Linda requires the preparation of a WQMP for development projects that fall within one of eight project categories established by the RWQCB. According to the San Bernardino County WQMP template, development of the Phase Three Concept Area would require a WQMP because it is involves development of more than 10 residential units. Further, each development project greater than one acre in size within THE GROVES will be required to prepare a WQMP. Each WQMP will be designed in accordance with the adopted County of San Bernardino Area Wide Stormwater Program and will utilize the associated Technical Guidance Document for Water Quality Management Plans as the basis for the WQMP design. THE GROVES development will incorporate drainage features and best management practices (BMPs) identified in a WQMP to minimize runoff and erosion. During site construction, measures would be taken to minimize fugitive dust and thus minimize the potential for exposed soils to be carried off-site due to wind. Construction activity related to development of THE GROVES may cause soil sedimentation and water pollution during grading and other construction activities. Following buildout of THE GROVES, ongoing maintenance and irrigation of the related landscaped areas and parks could lead to sedimentation and water contamination. In accordance with best management practices, development of the Phase Three Concept Area would protect water quality by complying with City standards and a SWPPP. All physical improvements related to development of THE GROVES would be consistent with appropriate best management practices, low-impact development requirements and applicable water quality considerations typical of all development carried out within the City. Any improvements to the current off-site drainage system will be determined by the City engineer. Costs for these improvements will be covered by the developer. Although no significant amount of additional stormwater is anticipated, drainage plans would still be reviewed by the City Engineer to ensure the system would have sufficient carrying capacity. The provision of storm drain facilities to serve THE GROVES is assured through the designation of Improvement Districts that delineate facilities to be constructed in support of all development, or interim development implementing phases, within an Improvement District. Construction of Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-66 drainage infrastructure facilities shall be timed to adequately service each development project, which may require construction of drainage facilities to provide water quality treatment and connection leading to the regional storm drain. Required facilities must be constructed by the development project if the facilities are not already existing. See Section 3.6.3 below for discussion of the Improvement Districts. 3.6.2(c) - Domestic Water Service The City of Loma Linda provides the production and distribution of water within the City. The City obtains its water from groundwater wells in the Bunker Hill Basin, an aquifer underlying the eastern San Bernardino Valley. The City operates five groundwater wells: Richardson Wells 1, 3, and 4 and Mountain View Wells 3 and 5. These production wells have a combined capacity of 14 million gallons per day. The City also has emergency water connections with the City of San Bernardino as well as the City of Redlands water systems. In addition to the existing wells, a water-treatment plant, located on a City of Loma Linda-owned land surrounded by the City of San Bernardino opened in October 2010. This treatment plant provides Loma Linda’s water customers with an additional supply of water. The new plant is capable of pumping and filtering 4,800 gallons of water per minute or about 6.9 million gallons per day (mgd). THE GROVES Water Plan is presented on Exhibit 3-13, Master Water Plan. The Specific Plan’s domestic water system is comprised of an 8-inch backbone system within major internal roadways that connects off-site to the west with the existing 10-inch potable water line located in Bryn Mawr Avenue, as well as connects to the existing 12-inch potable water lines located within Redland Boulevard, California Street, and Mission Road. As shown on Exhibit 3-13, six primary connections occur: California Street at the intersection with Park Avenue, Citrus Avenue and Orange Avenue; Mission Road at Earp Drive and Mesquite Avenue; and at the southerly terminus of the existing 10- inch line in Bryn Mawr. Additional minor connections along Redlands Boulevard, California Street and Mission Road will serve Planning Area 1-2, Planning Area 2-1, Planning Area 3-3, Planning Area 2-9, Planning Area 2-10, Planning Area 2-11, and Planning Area 0-2. Additional 8-inch waterlines are provided within local streets, and within easements where necessary, to provide service to the Planning Areas. THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-67 Figure 3.13 - Master Water Plan Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-68 While not yet supplied by reclaimed water, a reclaimed water system exists in Mission Road. It is anticipated the source of reclaimed water will ultimately be supplied by reclaimed water from the City of Redlands treatment plant. Timing for completion of this system is unknown at this time. However, the City of Loma Linda requires installation of a reclaimed system in anticipation of reclaimed water eventually being available. The proposed system is an 8-inch backbone grid with three primary connections to the existing reclaimed water line in Mission Road. The system will provide reclaimed water to irrigate the parks, paseo, and parkways along Orange Avenue, Mission Road, and California Street and potentially to field areas of the future school. Implementing polices of the General Plan addressing the City’s water distribution include maintaining the existing level of service with the addition of new development and providing for future distribution demands. THE GROVES will provide water distribution facilities for the Specific Plan area and connection to existing lines. Construction plans shall be reviewed by the City Engineer to ensure the design will have sufficient carrying capacity to meet development needs. The provision of water distribution facilities to serve THE GROVES is assured through the designation of Improvement Districts that delineate facilities to be constructed in support of all development, or interim development implementing phases, within an Improvement District. Construction of water distribution infrastructure facilities shall be timed to adequately service each development project, which may require construction of water service lines and connection to off- site feeders. Required facilities must be constructed by the development project if the facilities are not already existing. See Section 3.6.3 below for discussion of the Improvement Districts. 3.6.2(d) - Sewer Service Sewer facilities are provided by City of Loma Linda’s Public Works, Utilities Division. Wastewater treatment services are provided under provisions outlined in a Joint Powers Agreement (JPA) with the City of San Bernardino and provided by the San Bernardino Municipal Water Department wastewater facility and the Rapid Infiltration/Extraction tertiary treatment facility. Wastewater is treated by both the San Bernardino Municipal Water Department wastewater facility and the Rapid Infiltration/Extraction facility located in Colton both having capacity to serve the City at ultimate buildout conditions.9 9 Loma Linda General Plan, Chapter 8.8. 2006. THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-69 Figure 3.14 - Master Sewer Plan Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-70 The Specific Plan site would be served by the existing sewer facilities in Redlands Boulevard and California Street and existing water facilities in California Street, Mission Road and Redlands Boulevard. The City operates an existing 15-inch sanitary sewer main within Redlands Boulevard along the subject site frontage. The developers of any development within THE GROVES would be responsible for connecting the proposed development to the City’s sewer system. THE GROVES Sewer Plan is presented in Exhibit 3-14, Master Sewer Plan. There are existing 12-inch sewer mains in all three major roads surrounding the Specific Plan site. A system of 8-inch mains within major internal roadways will connect to the existing 12-inch sewer line in Bryn Mawr Avenue. Other minor or service connections will occur for Planning Areas that have frontage on Redlands Boulevard, California Street and Mission Road. The provision of sewer collection facilities to serve THE GROVES is assured through the designation of Improvement Districts that delineate facilities to be constructed in support of all development, or interim development implementing phases, within an Improvement District. Construction of sewer collection infrastructure facilities shall be timed to adequately service each development project, which may require construction of sewer service lines and connection to off-site trunk lines. Required facilities must be constructed by the development project if the facilities are not already existing. See Section 3.6.3 below for discussion of the Improvement Districts. 3.6.2(e) - Dry Utilities and Services Power Electricity is provided to the Specific Plan site by Southern California Edison. Existing nearby lines include an electric overhead system located on the south side of Redlands Boulevard (66, 33, and 12 kV), on the west side of California Street (12 kV), and overhead and underground lines located along the south side of Mission Road. Natural Gas The Specific Plan site is served by nearby existing 12-inch natural gas lines located in Redlands Boulevard and along the south side of Mission Road, which proceeds north approximately 200 feet and turns east at Orange Avenue, continuing approximately 600 feet to California Street. Communication and Technology Services Telephone service is provided to the Specific Plan area by Verizon. Existing nearby lines are located on the south side of Redlands Boulevard, the intersection of California Street and Park Avenue, the intersection of California Street and Orange Avenue, and along the south side of Mission Road. THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-71 Cable television service is provided to the Specific Plan area by Time Warner Cable along existing nearby lines located on Redlands Boulevard, the west side of California Street, and the south side of Mission Road. Satellite television service is also provided to the Specific Plan site by Direct TV and others. Consistent with the Loma Linda Connected Community Program (LLCCP), THE GROVES development will be served by infrastructure and connection to the City’s fiber optic network, which the City operates as a utility. The Loma Linda Building Code establishes the provisions and requirements for the infrastructure and service expectations. Solid Waste Service and Disposal The City of Loma Linda contracts with Waste Management to provide solid waste collection services. Solid waste not diverted to recycling, compost or hazardous waste facilities is transported to the San Timoteo Sanitary Landfill located in the city of Redlands.10 During construction (short-term) and operation (long-term), bulk solid waste, excess building material, fill, etc., shall be disposed of in a manner consistent with State of California Integrated Waste Management Act of 1989 (CIWMA) and shall be removed from THE GROVES properties. Additionally, every municipality in the State is required by CIWMA to divert 50 percent of its waste from landfills by the year 2000. The Loma Linda Municipal Code Title 15 requires that at least sixty (60) percent of the estimated tonnage of construction and demolition material be diverted from disposal. Additionally, a waste management plan is required as part of the building permit process. 3.6.2(f) - Community Services Fire Station and Fire Protection Services Fire protection services are provided by the City of Loma Linda, Fire and Rescue Division of the Department of Public Safety. The City maintains a joint response/automatic aid agreement with fire departments in neighboring cities including Colton, Redlands and San Bernardino to ensure adequate fire protection services in an emergency. Loma Linda Fire Station 251 located at 11325 Loma Linda Drive, approximately 0.8 mile southwest of the Specific Plan site.11 In addition, a new fire station will be located within the Specific Plan site. 10 Loma Linda General Plan, Chapter 8.9. 2006. 11 Loma Linda General Plan, Chapter 8.1. 2006. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-72 The City has determined that a new fire station shall be established within the Specific Plan site. The new fire station may be located in either the Phase Two Concept Area or in the Phase Three Concept Area. As part of the Phase Two (Citrus Trails Master Plan) approval, it was conditioned that prior to the issuance of a certificate of occupancy for the one hundredth residential unit within Phase Two, a location for an interim or permanent fire station within the Specific Plan boundary shall be offered to the City. If the City chooses to develop an interim fire station, the Fire Department retains the right of first refusal in locating a site for a permanent fire station. Potential locations for the siting of a fire station are at the discretion of the City of Loma Linda and may be located either in Phase Two or Phase Three. The following criteria should be used to determine as minimum criteria for establishing a fire station site. 1) Lot size should be a minimum of 0.75 acres, preferably one acre. 2) Lot configuration should be either generally rectangular or square. 3) Minimum length of the side lot line should be 120 feet. o Site access along one side is sufficient provided the following can be accommodated in the site layout: apparatus apron for response out of the apparatus bays o side drive for apparatus and employees to access the rear of the station o driveway access for small public parking area on opposite side of apparatus/employee entrance. 4) Site should be located on the periphery of a residential area or in a commercial area because of siren noise. 5) Site should not be located under power lines that could prevent response. 6) Site should provide access to main transportation arteries to facilitate response times. Development associated with THE GROVES shall be subject to City of Loma Linda Fire Department review and consideration per the design criteria listed in the Specific Plan. Prior to submittal of an application for a Precise Plan of Design, each applicant shall consult with the Fire Department to determine if the current development shall be required to incorporate a fire station pad into the site design. THE GROVES development contribution to the demand for additional fire protection services would be offset by payment of the City’s Residential Development Impact Fees to cover 100 percent of THE GROVES pro-rata share of the estimated cost of public infrastructure, facilities, and services.12 Each implementing development phase (i.e., each Planning Area development) will be 12 Loma Linda General Plan, Chapter 8.0. 2006. THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-73 required to pay its pro-rata share of these fees upon approval of and prior to development of each Precise Plan of Design. Police Services Police protection is provided by and contracted through the San Bernardino County Sheriff’s Department (SBSD). The City of Loma Linda provides deputies and a sheriff’s service specialist with an area at City Hall for completing reports, conducting interviews, and coordinating crime prevention activities. The City shares the cost of law enforcement personnel and equipment with the City of Grand Terrace. The SBSD currently has 12 sworn officers assigned to Loma Linda.13 With an estimated 2017 population of 24,528 people, the ratio of officer to citizen is approximately 1:2,044. Upon buildout of the Phase Three Concept Area, an addition of approximately 1,620 new residents would be added to the City. This would result in a demand increase of approximately seven percent in total officers to maintain the City’s current level of service. Development of THE GROVES shall be subject to design criteria listed in the Specific Plan. Criteria includes: circulation for pedestrians, vehicles, and police patrols; lighting of streets and parking areas; front doors into residences that face toward or are visible from the street and allow for easy drive-by surveillance by law enforcement personnel, where practical. THE GROVES’ contribution to the demand for additional police protection services would be offset by the City’s requirement for new developments to pay a Residential Development Impact Fees to cover 100 percent of the development’s pro-rata share of the estimated cost of public infrastructure, facilities, and services. Schools School services for the Specific Plan site are currently provided by the Redlands Unified School District.14 The City mitigates impacts on school services through the collection of development fees. Under Section 65995 of the California Government Code, school districts may charge development fees to help finance local school services. However, the code prohibits State or local agencies from imposing school impact fees, dedications, or other requirements in excess of the maximum allowable fee. Collection of school impacts fees are required by the Redlands Unified School District. 13 Loma Linda General Plan, Chapter 8.2. 2006. 14 Loma Linda General Plan, Chapter 8.3. 2006. Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-74 3.6.3 - IMPLEMENTATION PROGRAM 3.6.3(a) - Infrastructure Implementation Improvement Districts THE GROVES development area is divided into Infrastructure Implementation Improvement Districts, which serve to establish a means for coordinating improvements for areas that share common infrastructure components. Phase Two and Phase Three are each divided into distinct Improvement Districts that represent guidance and expectations for the implementation requirements of infrastructure improvements established by the Specific Plan (see Exhibit 3-15: Infrastructure Implementation Improvement Districts). Phase Two (Citrus Trails Master Plan) is divided into five Improvement Districts (A, B, C, C-1 and D), while Phase Three is divided into three Improvement Districts (A, B and C). The Improvement District concept provides flexibility in the timing of the construction of the infrastructure improvements required to support the development of any individual Planning Area, regardless of sequence. Therefore, the Improvement Districts allow for Planning Areas to be developed in any order, provided however, that the necessary supporting infrastructure improvements within a particular Improvement District(s) and the infrastructure in any other Improvement District that is necessary to support the improvements, is in place or is constructed. Development construction phasing has not been determined at this time. For the purposes of this EIR, the proposed Project has been analyzed for Opening Year 2030 at which time it is anticipated that THE GROVES will be built out. The provision of storm drain facilities, water distribution facilities and sewer collection facilities to serve THE GROVES is assured through the designation of Improvement Districts that delineate facilities to be constructed in support of all development, or interim development implementing phases, within an Improvement District. Construction of each of these facilities shall be timed to adequately service each individual development project. As such, this may require construction of the facilities both on-site (within or adjacent to the PA) and/or off-site (within other PAs or outside of the Specific Plan area) to connect with existing trunk or regional systems. Required facilities must be constructed by the development project if the facilities are not already in place to serve an implementing development project (e.g. development of a Planning Area). THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-75 Figure 3.15 - Infrastructure Implementation Improvement Districts Chapter 3 THE GROVES AT LOMA LINDA SPECIFIC PLAN 33-76 3.6.3(b) - Impact Development Fees Each implementing development phase and/or project associated with THE GROVES will be required to offset the provision of City services and support through the payment of the City’s Residential Development Impact Fees to cover 100 percent of THE GROVES pro-rata share of the estimated cost of public infrastructure, facilities, and services.15 Each implementing development phase (i.e., each Planning Area development) will be required to pay its pro-rata share of these fees upon approval of and prior to development of each Precise Plan of Design. 3.6.3(c) - Public Use Site Reservation Each development project within THE GROVES will comply with the LLMC Section 16.04.240, Public use site reservation-Standards, which requires: “Where a park, recreational facilities, fire station, library, or other public use is shown on an adopted specific plan or adopted general plan containing a community facilities element, recreation and parks element and/or a public building element, the subdivider may be required by the city council to reserve sites as so determined by the city or county in accordance with the definite principals and standards contained in the above specific plan or general plan. The reserved area must be of such size and shape as to permit the balance of the property within which the reservation is located to develop in an orderly and efficient manner. The amount of land to be reserved shall not make development of the remaining land held by the subdivider economically unfeasible. The reserved area shall conform to the adopted specific plan or general plan and shall be in such multiples of streets and parcels as to permit an efficient division of the reserved area in the event that it is not acquired within the prescribed period. (Ord. 109 § 15(B), 1975)” The City has determined that a new fire station shall be located within THE GROVES. Prior issuance of a certificate of occupancy for the one-hundredth residential unit within THE GROVES, a location for an interim or permanent fire station within the Specific Plan area (either Phase Two or Phase Three) shall be offered to the City. If the City chooses to develop an interim fire station, the Fire Department retains the right of first refusal in locating a site for a permanent fire station. 15 Loma Linda General Plan, Chapter 8.0. 2006. DEVELOPMENT STANDARDS AND GUIDELINES 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-1 Chapter 4 - Development Standards and Guidelines 4.1 - APPLICABILITY Implementation of THE GROVES Specific Plan is accomplished through a set of development standards and design guidelines as set forth herein. x Whenever the regulations set forth in this Specific Plan differ from the regulations of the LLMC, the regulations of this Specific Plan shall take precedence. When specific regulations are not established through this Specific Plan, the provisions of the LLMC shall apply. x All grading plans shall comply with the grading requirements of the City of Loma Linda and standards established by this Specific Plan. A preliminary geotechnical engineering report and soil engineering investigations identifying recommendations for safe and stable construction are to be submitted with all development applications. The recommendations of the engineering geologist and soils engineer shall be incorporated into the grading plan design prior to grading plan approval. The stability of the development site must be certified by the engineering geologist and soil engineer prior to the issuance of grading permits. x All construction shall comply with all provisions of applicable building codes and the various mechanical, electrical, fire, energy and other codes related thereto. x Any proposed site plans, agreements or any other development approvals within THE GROVES must be consistent with this Specific Plan. Land uses and Site Plans which are found to be consistent with the Specific Plan will be deemed consistent with the City’s General Plan and its adopted elements. x Any development or physical condition within THE GROVES plan area existing prior to the adoption of this Specific Plan and that may be inconsistent with the development standards and development guidelines established in this Specific Plan, shall be allowed to continue as a legal nonconforming condition consistent with the provisions of Zoning Code.Purpose and Intent 4.2 - ALLOWED LAND USES Table 4.1, Permitted and Conditionally Permitted Uses, identifies the Permitted (P), Conditionally Permitted (C), or Prohibited Uses within each land use designation. The following definitions of each allowed use category shall apply: Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-2 x A Permitted Use does not require discretionary approval for the use itself (however, other approvals are required for the development of a site or modifications to a building); x A Conditionally Permitted Use requires approval of a Conditional Use Permit per the Loma Linda Municipal Code, Title 17, Zoning. According to Chapter 17.30, Administration, uses requiring approval of a Conditional Use Permit are those “that must be located, planned, and used in such a manner as not to be detrimental to the property abutting such uses and to the community as a whole”. x A Prohibited Use is not allowed within the specified land use category because it is deemed to be inconsistent with the concepts of THE GROVES Specific Plan. Table 4.1 - Permitted and Conditionally Permitted Uses Land Use Special Planning Area “D” Very Low and Low Density Residential Medium and High Density Residential Senior Housing Mixed Use Parks/ Open Space/ Trails Residential (Category A) Single-family detached homes with normal accessory structures, of a permanent character and in a permanent location P P C X X Two or more attached single- family and multi-family dwellings, including townhomes, stacked flats, motor courts, garden courts, walk-ups, and apartments (condominium or apartment style), and their associated accessory structures (i.e., parking garages, carports, trash enclosures, community room, pool house, etc.) X P P P X Home occupations as specified in Chapter 17.12, Home Occupations, of the Loma Linda Land Use Development Code P P P P X Second units for senior citizens P P X X X THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-3 Land Use Special Planning Area “D” Very Low and Low Density Residential Medium and High Density Residential Senior Housing Mixed Use Parks/ Open Space/ Trails Combination of residential and nonresidential uses within the same building or on the same parcel X X X P X Housing for special needs or seniors, including special-care assisted living X X P P X Mobile Housing Units X X X X X Foster homes limited to a total of not more than four foster children P P X X X Day care facilities within the residence of the licensee not exceeding six children in addition to children residing at the residence P P X X X Residential care facilities for the elderly within the residence of the licensee serving six or fewer persons P P X X X Residential care facilities for the elderly within the residence of the licensee serving between seven to ten persons C C X X X Retail (Category B) Antique shops X X X P X Art galleries X X X P X Astrology, card or tea leaf reading, palmistry, and other similar businesses or art X X X X X Bicycle shops, sales and repair (no outdoor display) X X X P X Book and stationery stores X X X P X Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-4 Land Use Special Planning Area “D” Very Low and Low Density Residential Medium and High Density Residential Senior Housing Mixed Use Parks/ Open Space/ Trails Clothing stores X X X P X Craft and hobby stores X X X P X Dollar stores X X X P X Drugstores X X X P X Gift shops, boutiques, and specialty stores X X X P X Grocery stores X X X P X Hardware stores X X X C X Health food stores X X X P X Jewelry stores X X X P X Kiosks or temporary carts for retail sales X X X P X Liquor sales (off-site) X X X X X News and magazine stands X X X P X Pet supply shops (not including pet sales) X X X P X Pet supply shops including pet sales, doggie daycare (indoor), or boarding (indoor) X X X C X Pharmacies X X P P X Sporting goods stores X X X P X Smoke and vapor shops X X X X X Toy stores X X X P X Services (Category C) Barbershops, hair salons, nail salons X X P P X Day spas X X P P X Dry cleaners (drop-off location only) X X X P X Fitness centers, gyms (< 5,000 s.f.) X X P P X Laundromats and self-service laundries X X P C X THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-5 Land Use Special Planning Area “D” Very Low and Low Density Residential Medium and High Density Residential Senior Housing Mixed Use Parks/ Open Space/ Trails Pet grooming shops (no overnight boarding allowed) X X X P X Postal services X X X P X Studios – art, dance, martial arts, music, photography, and yoga X X X P X Tattoo and body piercing shops X X X X X Tutoring centers X X X P X Veterinary Services (with overnight boarding limited to as required for veterinary care) X X X P X Eating Establishments (Category D) Bakery, donut shops X X X P X Coffee and tea shops X X P P X Cafes, sandwich shops, and order-at-the-counter establishments X X X P X Ice cream and frozen yogurt shops X X X P X Restaurants, sit-down X X X P X Sale of beer and wine for on- site consumption when in association with a food-service use1 X X X C X Sale of alcoholic beverages for on-site consumption when in association with a food-service use 1 X X X C X Outdoor seating/dining X X X P X Recreation/Entertainment (Category E) Family entertainment and children’s party facilities (indoor X X X P X Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-6 Land Use Special Planning Area “D” Very Low and Low Density Residential Medium and High Density Residential Senior Housing Mixed Use Parks/ Open Space/ Trails activities only, limited food service, no alcohol) Bowling alleys X X X C X Game arcades X X X C X Health fitness facilities (>5,000 s.f.) X X X C X Movie theaters X X X C X Skate facilities X X X C X Rock climbing or obstacle course facilities X X X C X Parks, playgrounds, and outdoor recreation facilities P P P P P Riding and hiking trails P P P P P Local and buffer greenbelts P P P P P Historical preserves/structures P P X X P Picnic shelters, shade shelters and picnic facilities P P P P P Community gathering areas X X P P P Hospitality (Category F) Hotels/motels X X X P X Long-term hotels (i.e., extended stay) X X X P X Bed & breakfast establishments (commercial-scale) X X X P X Office (Category G) Financial and business services (banks, real estate offices, insurance services, employment services) X X X P X Non-medical professional services (attorneys, engineering, accounting) X X X P X THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-7 Land Use Special Planning Area “D” Very Low and Low Density Residential Medium and High Density Residential Senior Housing Mixed Use Parks/ Open Space/ Trails Medical professional services (non-surgical offices) X X X P X Health/Social Services (Category H) Convalescent care, congregate care, and assisted living facilities X X P P X Day cares (child or elder care) and preschools X X X P X Emergency/urgent care clinics X X X P X Health clinics (general health and specialized care) X X X P X Hospitals X X X C X Outpatient surgery/care facilities X X X P X Rehabilitation/physical therapy (outpatient) facilities X X X P X Community/Education (Category I) Churches and places of worship X X X C X Library X X X P X Museum X X X P X Cultural institution X X X P X College/university satellite campus X X X C X Community theater X X X C X Senior center X X P P P Government/Public Facilities (Category J) Fire station C C C C C Post office X X X C X Police/sheriff substation X X X P X Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-8 Land Use Special Planning Area “D” Very Low and Low Density Residential Medium and High Density Residential Senior Housing Mixed Use Parks/ Open Space/ Trails Accessory Uses (in conjunction with a primary use in Category A through J) ATM X X P P X Bus stops, bicycle racks, bike- share stations, and similar public transit accessory uses P P P P P Utilities and Utility Service Boxes P P P P P Water quality management and detention facilities P P P P P Key: P = Permitted Use C = Approval of a Conditional Use Permit required in compliance with the Loma Linda Municipal Code X = Prohibited Use Notes: 1) Standards for restaurants serving beer and wine: a. The restaurant shall have a minimum floor area of 2,000 square feet (including food preparation and dining areas). b. Service of beer and wine shall be in conjunction with the service of food. c. No separate bar service for the sale of beer or wine shall be permitted. 4.3 - SITE PLANNING 4.3.1 - Residential Uses Variety of Residential Design - Provide quality design and visual interest within a development by alternating the massing, layout, architectural details, accent materials, and colors so that adjacent dwelling units are not nearly identical. Residential Orientation on Corner Lots - To reduce architectural massing, orient the shortest and lowest side of a corner residential dwelling unit toward the side street. Residential Garage Placement - Where feasible, orient garages so that garage doors do not directly face the street (e.g., use of “side-on” garage configuration and side loaded corner lots). Garage THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-9 doors should be set back from the front face of the house so that residential tracts are more pedestrian/neighborhood friendly. Multi-family Development Building Orientation and Design Diversity - Within multi-family developments: Cluster residential buildings around open space and/or recreational features; x Design the common space associated with each cluster of multi-family dwelling units to provide differences in size, dimensions, grading, amenities, and site furniture in order to create variety; x In higher density projects with tuck-under parking and/or opposing garages, avoid the monotony of long parking corridors by turning individual units, staggering parking areas, and/or using an interesting variety of landscaping within parking areas; x Provide each unit with some unique elements to create a sense of place and identity; x Individual units should be distinguishable from each other, and should have separate entrances and entry paths, where feasible. x Buildings should be oriented to avoid instances where the living spaces of one unit face the living spaces of another and significantly reduce indoor privacy. 4.3.2 - General Mixed Uses Mixed Use Development Design - Design multiple buildings within a single Mixed Use Planning Area or development project to create a unified image that also helps to define primary and secondary functions among the buildings. Also, site individual buildings/developments to acknowledge and contribute to the development and/or Planning Area as a whole. Refrain from siting buildings so that they turn their “back” on other buildings. Employ architectural detail and rhythm using patterns (e.g., window design/placement/ repetition) to give a human scale to large buildings by reducing large blank areas on the façade. Visually break up buildings into several components and/or use a mix of materials to further reduce the appearance of bulk. Pedestrian Orientation - Facilitate pedestrian access from off-site. Encourage the grouping of buildings or the configuration of a building to create courtyards, plazas, or seating areas where people can gather. Large landscaped setbacks are discouraged as they establish a barrier for pedestrian access. Provide wide sidewalks/walkways for pedestrian circulation and bicycle lanes or paths for bicycle travel. Employ awnings, covered archways, covered patios, arcades, or trees to provide shade and to offer protection from sun and rain. Pedestrian-Oriented Development - Pedestrian-oriented development is designed around the pedestrian, and facilitates walking and bicycling as a primary means of travel for short trips within the development area. Pedestrian-oriented development is typically characterized by the location of buildings close to streets, building architecture that is detailed and scaled to the pedestrian, and a variety of amenities (e.g., benches, fountains, awnings, plazas). Orient buildings so that they are always the primary element as seen from the street, as opposed to parking areas. Encourage the Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-10 use of architectural elements that define the main entrance of buildings and organize space at the ground plane (e.g., arcades, colonnades, and covered walkways) is encouraged. Such elements help to reinforce the pedestrian scale of the building and contribute to its overall neighborhood character. Feature architectural details that relate to the building’s scale and acknowledge pedestrian entryways through the use of detailed rooflines, enhanced entry statements for principal buildings, and building ornamentation. Feature prominent display windows on the first floor of buildings with commercial and commercial service uses. “Main Street” District Development - The traditional small town “Main Street” is the prototype for modern pedestrian-oriented development, which provides a mix of land uses and builds a synergy that is necessary for successful pedestrian oriented development that is in use 24 hours a day. The form along Main Street should be quite different from that of more traditional commercial development that is otherwise designed around the car and requires separation of different types of uses (e.g., residential, commercial). In particular to the Main Street, design buildings so as to locate retail uses on the first floor in order to benefit from street activity and to generate activity themselves by providing convenient shopping opportunities and attractive window displays. Within horizontally mixed-use buildings, provide professional services offered directly to the public on the first floor with other office-based employment reserved office uses for the second floor of pedestrian-oriented buildings. Keep private residential areas on the upper floors of mixed-use buildings distinct from public spaces and public uses, providing separate entries where feasible. “Main Street” District Access and Circulation - Design Main Street to accommodate slow to moderate moving local traffic (e.g., two lanes maximum each direction) and incorporate abundant pedestrian crossings throughout. While pedestrian access is a primary focus, also provide convenient vehicular parking via nearby parking in an adjacent parking lot located to the side or rear of the building and/or on-street diagonal parking. Permit off-street parking standards to be met with a convenient off-site parking structure or lot that serves the area. “Main Street” District Amenities - Encourage public open areas such as plazas that are designed for gathering and ancillary outdoor uses such as outdoor dining. Provide seating areas (e.g., benches, tables and chairs, low walled planters) and trash receptacles for convenience and that encourage use of these outdoor public areas. Encourage the provision of amenities such as water features (e.g., fountains), public art, and enhanced paving (e.g., colored paving, special paving designs) throughout the length of Main Street, and in particular within designated public gathering spaces. Encourage the use of pedestrian-scale landscaping (e.g., walled planters, window boxes, pots, trellised plants, and/or arbors) to add color, fragrance, and soften the appearance of the buildings and invite public lingering. Design lighting so that it provides adequate levels of lighting for security and safety, and to create a “comfortable” atmosphere (e.g., use lighting to highlight landscaping or wall murals). Utilize streetlights that are pedestrian-oriented, attractively designed, compatible in design with other street furniture, and provide adequate visibility and security. Install “street furniture” (benches, bus shelters, planters, bike racks, trash receptacles, newspaper racks, water fountains, and bollards) within streetscapes to enhance the pedestrian experience and embellish pedestrian gathering places (places for sitting, meeting people, relaxing, people THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-11 watching, etc.). It should be compatible with the streetscape theme, durable, easily maintained and easily replaced. The design and location of street furniture should avoid conflicts with driver sight lines and utilities. As pedestrian furniture is both in the public right-of-way and on private property, the style and placement of furniture should be coordinated on public and private property, and should avoid blocking travel on the sidewalk. 4.3.3 - Special Uses Hospitality and Visitor-Serving Development - Hospitality development includes uses such as hotels, which may have ancillary services such as restaurants and meeting rooms, and extended stay hotels (which typically feature “suites” that provide kitchen facilities and living areas in addition to sleeping areas). Design hotels and extended stay hotels to evoke a residential feel (i.e., through roofline forms, choice of materials), in contrast to a hi-tech, high rise look. For example, encourage roofs to be gabled or hipped styles in order to further convey a residential aspect (as opposed to flat roofs). Select exterior materials and colors that are typical in traditional residential construction, such as wood siding (or wood-look vinyl siding), brick, stucco, terra cotta roof tiles, and wood-look roof shingles (i.e., fire resistant materials made to look like wood), as well as compatible with the historic district guidelines. Also, it is recommended that the design feature enhanced architectural elements (e.g., tower, projecting arch, columns, pilasters) on the main building entry. Special exterior treatments may be provided for restaurant and meeting room entrances. Distribute landscape planters throughout the development and the parking lot so that landscaping highlights the building entries, provides shade for pedestrians and cars, and breaks up the visual mass of the asphalt parking lot. Convenience Development - There are many types of “convenience” developments (e.g., service stations, car washes and drive-up windows) today that provide for modern necessities, but that can pose design dilemmas because of their unconventional layouts or building forms. If not properly designed, such “convenience” uses could become design eyesores and result in both pedestrian and vehicular access conflicts. Design “convenience” development to be of a high quality and visually compatible with traditional types of development (such as those that feature fully enclosed buildings). Auto-Oriented Development -The name of this type of development refers to its vehicular- oriented design, not refer to the type of business conducted on the site. Thus, “auto-oriented” development refers to businesses and development that are designed to be primarily accessed via the automobile (e.g., traditional suburban shopping centers, commercial, and office uses). When auto-oriented commercial and small offices are located within a Mixed Use Planning Area, promote designs that facilitate easy auto access and parking and create pleasing buildings that are easily visible from the street. For commercial or small office development that is immediately adjacent to the street, place parking wherever feasible at the side of the building or at the rear of the building. For a building immediately adjacent to the street (i.e., no parking area intervening between the building and the street), design the building elevation facing the street so it is the main architectural focus. A building may place its main entrance adjacent to the parking lot; however, Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-12 the elevation facing the street should still receive the main (or at least equal) architectural focus. However, building elevations visible from the street should feature architectural elements and details of a scale that can be noticed from a passing vehicle, and should feature building articulation and detail to make it easy to identify access/entrances. Design parking lots to ensure safe and convenient circulation for both vehicles and pedestrians. Franchise Architecture Limitations - Avoid the use of “franchise architecture” by requiring that buildings be specifically designed to meet the needs of the subject site consistent with the development standards, design guidelines and community structure elements intended for the Planning Area in which a franchised use will be located. Institutional Development Design - Institutional uses are unique, often with special architectural requirements and style preferences that reflect the buildings’ users and function, and thus flexibility is required. For institutional building types and uses located within the Mixed Use designation, ensure that site and building design reduce traffic and circulation conflicts, minimize disruption to adjacent sensitive uses, and promote high quality architectural design. For example, it is desired that vehicular access be provided via a collector road, instead of from an arterial, wherever feasible, and that vehicular access points be consolidated and designed for efficient ingress/egress. Further, it is recommended that access to schools be designed with sufficient staging areas such that vehicles waiting to drop off or pick up a student do not block travel lanes on public streets. Feature architectural details that relate to the building’s scale and acknowledge pedestrian entryways through the use of detailed rooflines, enhanced entry statements for principal buildings, and building ornamentation. Parking Lot Configuration and Design - Site the buildings so that when viewed from the street, the major focus is on an attractive building elevation(s) instead of a “sea of asphalt” parking lot. Improve the appearance of parking areas by using landscaping and/or building placement to screen them from the street. Design parking lots as clusters of spaces rather than large parking areas with row upon row of parking stalls. Provide abundant landscaping at street edges, parking lot and building entries, and throughout the parking lot so that it provides shade for pedestrians and cars and breaks up the visual mass of the asphalt parking lot. Traffic Calming Guidelines - Implement traffic calming to improve neighborhood livability, pedestrian safety and school children safety. Traffic calming techniques such as narrower than standard streets, speed humps, neck-downs and traffic diverters, rough-paved crosswalks, roundabouts, and planted median islands at the entries into neighborhoods can successfully reduce undesirable through traffic within residential neighborhoods and along Main Street. Paseo and Trail Guidelines x Provide trail amenities such as signage, benches, and trash receptacles. Signage should identify the entrances to the riding and hiking trail. Benches and trash receptacles should be spaced along the trail. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-13 x Maintain the privacy of adjacent dwellings by allowing walls and fences of a standard height along existing residential property lines that are located adjacent to the perimeter of the Paseo or California Trail. x Encourage public visibility of the Paseo and trail system in order to promote safety for the users by designing new adjacent residential development with windows that overlook the trail system. x Design trail entrances to promote visibility and safety by placing them in prominent locations and minimizing obstacles (e.g., walls, tall plant materials) immediately adjacent to the entrances. x Retain, maintain, and irrigate clusters of the existing orange trees within the designated trail areas to serve as landscaping adjacent to the pathway, since these trees help promote the community’s sense of place and reflect the community’s agricultural past. Adaptive Reuse and Preservation with New Development Within THE GROVES are a number of structures, features, and other cultural resources that warrant adaptive reuse and/or preservation (or rehabilitation or re-creation, when appropriate) so that they are not “lost” as the community develops. Adaptive reuse of structures that have local historic value because of their scientific, aesthetic, educational, cultural, architectural, or historical significance is strongly encouraged in order to incorporate them into new development and prevent their demolition. Adaptive reuse can be accomplished through preserve in-place (and reuse) or relocate (e.g., to the Heritage Park), adapt and reuse. Preservation of other physical elements that are cultural resources (e.g., the Zanja) by incorporating them (either in their entirety or through a representative sample/re-creation if it would carry the same merit) into future development of the area is also strongly encouraged. Key considerations for the preservation, adaption or reuse of historic structures and valued cultural resources include the following: x Retain the historic and architectural integrity when pursuing adaptive reuse of buildings, while aiming to meet the design policies set forth within the applicable category of the intended new use to the greatest extent feasible. x Sensitively site and design new adjacent buildings in order to preserve historic buildings, allow for viable access to them, and create a cohesive architectural character that reflects, and is compatible with, the historic building. x Preserve the character of the existing citrus groves by preserving and incorporating strategically located existing trees or rows of existing trees into new development (i.e., in the form of landscaped setbacks and/or landscape treatments). x Include new citrus trees of a hearty variety and/or other species that are similar to resemble citrus trees within appropriate new or re-landscaped City rights-of-way. x Encourage private development to use new citrus trees as landscape materials on any private property when feasible. x Incorporate the palm tree rows into future development, especially in the vicinity of Citrus Avenue, to reflect older established palm trees located along Citrus Avenue east of California Street. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-14 4.4 - DEVELOPMENT STANDARDS 4.4.1 - Introduction General Development Standards and Terms: 1. Setbacks: Building setbacks from streets are measure from back of rights-of-way for ground-floor uses. a. Maximum setback may be increased to allow for additional outdoor uses at the discretion of the Planning Director. b. Pedestrian walkways within a project shall be a minimum of five (5) ft. in width. c. Walkways and outdoor seating allowed within required setback if a pedestrian walkway with a minimum of five (5) feet in width is provided. 2. Building Height: Building height is defined as number of stories above grade. Measurement of height does not include to underground parking, rooftop uses, or architectural features such as a tower or archway. a. For planning areas designated exclusively for residential use architectural components of a building may exceed 35 feet. Up to 25% of the building footprint may exceed 35 feet but must not be more than 3 stories. b. For planning areas with a non-residential use, up to 25% of the building footprint may extend up to 4 stories/ 45 feet. Building footprints include all buildings within a planning area. If a residential use is also included in a planning area, the maximum height may not exceed 35 feet or 3 stories. 3. Open Space a. Commercial open space shall be defined as public plazas, seating nodes, outdoor dining, or landscaped pedestrian pathways within commercial areas. b. Required front, side and rear yard setback areas may not be included in the calculation of open space. c. Open space areas shall have no parking, driveway, or right-of-way encroachments. d. Percentage of lot not covered by building or parking shall be useable open space. e. Minimum dimension for private open space shall be 7 ft. f. Minimum dimension for common open space shall be 20 ft. or based on the minimum building separation requirements as set forth in the State Building Code, whichever is greater. g. Courtyard internal to a project, or enclosed on at least three (3) sides, shall have a minimum of width of forty (40) ft. h. All residential common areas shall be improved as either active or passive facilities, with landscaping or hardscape elements designed to serve the residents of the project. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-15 i. All common areas shall be developed and professionally maintained in accordance with approved landscape and irrigation plans. 4. Gross Acreage: Calculations shall use Planning Area gross acreages as shown in Table 3.1. 5. Calculating Density a. Calculating Density in Horizontal Mixed Use. Residential density for buildings designed in a horizontal mixed use pattern shall be calculated as the ratio of the number of dwelling units to the gross acreage of residential use within each Planning Area (including associated parking and non-recreation landscape areas, but excluding recreation areas/facilities). b. Calculating Density in Vertical or Integrated Mixed Use. Residential density for buildings designed in a vertical or integrated mixed use pattern shall be calculated as the ratio of the residential square footage to the Planning Area square footage (after deducting the commercial square footage and required commercial parking area), converted into acres and divided by the number of dwelling units in the building. 6. Calculating Floor Area Ratio (FAR): The Floor Area Ratio for commercial uses developed in a horizontal mixed use pattern or commercial-residential uses developed in a vertical/integrated mixed use pattern shall be calculated as the ratio of the square footage of the respective building to the square footage of the Assigned Commercial Component (ACC) of the Planning Area. 7. Measuring Building Setback: A building setback shall be the measurement (in feet) from a public or private street right-of-way or a property line to the building plane. Separation distance between two structures shall be the distance (in feet) between the building planes. The minimum setback and minimum separation requirements for multi-story buildings shall be measured from the first floor when all floors have the same aligned building plane, or from the upper stories of buildings that have stepped- back building planes, as demonstrated in the following illustration. (Fire Department regulations may limit the depth of upper floor building step-backs to 5 feet, unless alternative emergency access is provided to the satisfaction of the Fire Department.) Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-16 THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-17 4.4.2 - Planning Area Standards Figure 4.1, Community Structure Plan contains special requirements that are applied to planning areas that will further shape the final urban form as development occurs overtime, as well as connectivity between projects. The Community Structure exhibit addresses the following: x Frontage requirements for key roadway segments, which give direction to the design of the area between the public right-of-way and the adjacent building façade; x View corridors into the site at key locations that should be maintained and enhanced through future site planning and design; x The location of key entry monuments; x The area to be set aside for the preservation of the oak woodlands onsite; x The general locations for historic structures; x A special requirement for an enhanced corner treatment at the primary entry into THE GROVES from Redlands Boulevard; and x A connected system of trails within THE GROVES and to adjacent local and regional trails. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-18 Figure 4.1 - Community Structure Plan THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-19 Planning Area 1-1: MIXED USE PURPOSE AND INTENT Planning Area 1-1 includes the VA Ambulatory Care Center that includes approximately 271,000 square feet of medical offices and healthcare related uses. The VA Ambulatory Care Center is located at the intersection of Redlands Boulevard and Bryn Mawr Avenue at the primary entrance to THE GROVES from Redlands Boulevard. The VA Ambulatory Care Center is in a campus-like setting in the northwest corner of the Specific Plan area. Although largely self-contained, PLANNING AREA 1-1 will serve as an activity center that draws people to the Specific Plan area and helps support adjacent commercial and retail uses. In addition, a recreation trail will be created on the west side of a portion of Bryn Mawr Avenue, the south side of a portion of Redlands Boulevard west of Bryn Mawr Avenue, and along the north side of Park Avenue extending to the west to provide pedestrian connectivity. Design standards and guidelines have been developed to address how future development could be integrated as part of the VA Ambulatory Care Center. DEVELOPMEENT POTENTIAL SUMMARY Planning Area 1-1 is 36.9 total acres and includes the following: x Existing: 271,000 square feet of medial office / healthcare as part of existing VA Ambulatory Care Center x Potential: 412,892 square feet of commercial, office, medical, healthcare services, community services or lodging. x 5.5 acres of parks and open space shall be provided. x No residential development potential is included in Planning Area 1-1. However, residential uses are permitted if development rights are transferred from another planning area. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-20 Planning Area 1-1: MIXED USE DEVELOPMENT STANDARDS Development standards regulate new development by establishing standards that control site configuration (i.e., lot size and setbacks from adjacent streets and uses), and building form (i.e., density and intensity, and building heights). Development standards based on the Institutional- Health Care (I-HC) designation in the Loma Linda Zoning Code (Municipal Code 17.44.040) are applied to Planning Area 1-1. See Section 4.4.31 for certain deviations from building setbacks, building height, and the floor-area-ratio (FAR) standards shown below. TYPE MINIMUM MAXIMUM SITE CONFIGURATION REQUIREMENTS Lot Size None None Lot Width 100 ft None Building Lot Coverage 50% None SETBACK REQUIREMENTS From Mission Rd. 25 ft None Front 25 ft None Side - Abutting Parcel Zoned for Residential 2 ft None Side - Abutting Parcel Zoned for Non- Residential 10 ft None Side – Abutting Street 25 ft None Rear - Abutting Parcel Zoned for Residential 20 ft None Rear - Abutting Parcel Zoned for Non- Residential 10 ft None BUILDING DENSITY / INTENSITY Non-Residential None .5 FAR BUILDING HEIGHTS Non-Residential None 3 Stories and 35 Feet FRONTAGE TYPE REQUIREMENTS Any future development within Planning Area 1-1 adjacent to Park Avenue and the walking trail should have a primary building façade and entry from the identified street. SPECIAL REQUIREMENTS Parking Structure: Existing surface parking may be consolidated into a parking structure to increase the developable area of Planning Area 1-1. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-21 Planning Area 1-2: MIXED USE PURPOSE AND INTENT Planning Area 1-2 is envisioned as a commercial hub located at the primary entrance to THE GROVES from Redlands Boulevard. It is expected to contain a mix of shopping, dining, and hospitality uses located on “Main Street.” It will to serve the nearby VA Ambulatory Care Center, as well as the surrounding neighborhoods in the Specific Plan area. Planning Area 1-2 also provides a recreation trail along the east side of Bryn Mawr Avenue that will connect to the larger trail system within the Specific Plan area. Planning Area 1-2 contains a segment of the internal “Main Street” that will connect to Planning Area 3-3 and Planning Area 2-1. Design standards and guidelines have been developed address how the individual buildings interact with “Main Street” and Bryn Mawr Avenue in particular, to create an active, pedestrian-friendly environment. DEVELOPMENT POTENTIAL SUMMMARY The 5.9 total acres in Planning Area 1-2 include the following: x 121,968 square footage of non-residential x Public open space: 0.3 acres to be maintained as a recreation trail. x No residential development potential is included in Planning Area 1-2. However, residential uses are permitted if development rights are transferred from another planning area. Planning Area 1-2: MIXED USE DEVELOPMENT STANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. Development standards include street-based frontage standards for building facades along “Main Street” and Bryn Mawr Avenue, as well as provisions for entry monumentation and corner treatment. See Section 4.4.31 for certain deviations from building setbacks, building height, and the floor-area- ratio (FAR) standards shown below. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-22 Planning Area 1-2: MIXED USE TYPEE MINIMUM MAXIMUM SITE CONFIGURATION REQUIREMENTS Lot Size None None Lot Width 35 ft None Building Lot Coverage None None SETBACK REQUIREMENTS From Bryn Mawr Avenue – Commercial 5 ft 20 ft From Redlands Boulevard – Commercial 10 ft 20 ft From “Main Street” - Commercial 0 ft 15 ft Private Drive or Street 5ft None Abutting Off-Site One-Story Building 10 ft None Abutting Off-Site Multi-Story Building 20 ft None Abutting Park/Open Space 5 ft None BUILDING DENSITY / INTENSITY Non-Residential .3 FAR .5 FAR BUILDING HEIGHTS Non-Residential None 3 Stories and 35 Feet FRONTAGE TYPE REQUIREMENTS Frontage types address the design elements of the building’s ground floor front façade and the area in front of it extending to the street. It is an essential element of urban design because it is the way a building relates to the sidewalk and either creates a walkable/welcoming environment, or not. All new development adjacent to a street with frontage requirements as shown in Figure 4.1, Community Structure Map, shall have a primary building façade and entry from the identified street. These frontages dictate the relationship between the street (back of the right-of-way) and the façade of the ground-floor of the building (see Section 4.5.4 Building Design, for building frontage design guidelines). The following frontage types in Table 4-6 identify the distinct types of front facades that are permitted along Bryn Mawr Avenue and the internal “Main Street”. For streets where there is not a designated frontage (such as Redlands Boulevard), all building sides abutting the public right-of-way shall require architectural treatment (see Section 4.5.4, Building Design). THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-23 Planning Area 1-2: MIXED USE TYPE PERMITTED FRONTAGE TYPES ALONG “MAIN STREET” PERMITTED FRONTAGE TYPES ALONG BRYN MAWR AVENUE Ground Floor Residential Stoop, Terrace, Forecourt/Courtyard Stoop, Terrace, Forecourt/Courtyard, Porch, Yard Ground Floor Commercial Shopfront, Forecourt, Gallery/Arcade Shopfront, Forecourt, Gallery/Arcade Parking Requirements The following parking requirements shall apply to new development within Planning Area 1-2. Where feasible, shared parking is encouraged throughout Planning Area 1-2, as well as with adjacent parking areas with an approved Shared Parking Agreement in accordance with Section 17.24.110 of the LLMC. Bike parking should be consolidated, and racks should be in a convenient location TYPE MINIMUM PARKING SPACES NON--RESIDENTIAL USES Uses < 3,000 sf 1.6 spaces / 1,000 sf Uses > 3,000 sf 5 spaces / 1,000 sf BICYCLE RACKS 1 space / 25 required parking spaces with a minimum of 1 space / commercial tenant space SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 1-2. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. 2. Open Space for Commercial Uses: 25% of lot not covered by building or parking shall be useable open space (e.g., public plazas, seating nodes, outdoor dining, pedestrian pathways). 3. Landscape Requirement for Non-Residential Uses: For ground-floor commercial or live/work units, up to 80% of the setback area may be paved. 4. CCorner Treatment at Redlands Boulevard and Bryn Mawr Avenue: As shown on Figure 4.1, Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-24 Planning Area 1-2: MIXED USE Community Structure Plan, a Corner Treatment has been identified for the corner of Redlands Boulevard and Bryn Mawr Avenue. As this is the primary entrance to the Specific Plan area from Redlands Boulevard, the design of this corner is an essential element in branding the area. Buildings shall have a major presence at the corner to enhance the pedestrian experience and create character and appropriate massing along the roadway. See Section X, Design Guidelines for architectural design standards for corner treatments. 5. Entry Monumentation: As shown in Figure 4.1, Community Structure Plan, the entrance from Bryn Mawr Avenue should include some type of entry monumentation that denotes the entrance to “Main Street”. 6. View Corridor: Figure 4.1, Community Structure Plan, identifies a view corridor at Park Avenue and Bryn Mawr Avenue. People traveling south on Bryn Mawr will have an opportunity to view the large central park and amenities associated with Planning Area 3-4 and Planning Area 2-6. Future development within Planning Area 1-1 shall provide a view window at the north-west corner of Park Avenue and Bryn Mawr. This can be accomplished through the arrangement of buildings, a corner cut-off, a public plaza or landscape treatment at the corner. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-25 Planning Area 2-1: MIXED USE PURPOSE AND INTENT Planning Area 2-1 is envisioned as an active living, shopping, dining, and potential office environment. The standards are intended to result in an interconnected network of streets and drives the promote walkability within and to adjacent planning areas. The internal “Main Street” is expected to contain many of the retail and restaurant uses in either a stand-alone or mixed-use configuration with residential above. Live-work and walk-up townhomes may also be incorporated onto “Main Street”. Design standards and guidelines have been developed to address how the individual buildings interact with the street and create an active, pedestrian-friendly environment. DEVELOPMENT POTENTIAL SUMMARY The 4.4 total acres in Planning Area 2-1 include the following: x 26 dwelling units x 40,500 square feet of non-residential Additional development for residential and non-residential development is permitted if development rights are transferred from another planning area. DEVELOPMENT STANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. Development standards include street-based frontage standards for building facades along “Main Street”. These regulate building frontage design to form adequate and pedestrian-friendly building faces. See Section 4.4.31 for certain deviations from building setbacks, building height, and the floor-area- ratio (FAR) standards shown below. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-26 Planning Area 2-1: MIXED USE Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size – Non-Residential None None Lot Width 35ft None Building Lot Coverage None None SETBACK REQUIREMENTS From Redlands Boulevard: Commercial & Residential 10 ft 20 ft From “Main Street”: Commercial 0 ft 20 ft From “Main Street”: Residential 5 ft 15 ft Private Drive or Street 5ft None Abutting Off-Site One-Story Building 10 ft None Abutting Off-Site Multi-Story Building 20 ft None Abutting Park/Open Space 5 ft None BUILDING DENSITY / INTENSITY Non-Residential .3 FAR .5 FAR Residential 20 du/ac averages 20 du/ac average Senior Housing 25 du/ac average 25 du/ac average BUILDING HEIGHTS Non-Residential None 3 Stories and 35 Feet Residential 2 Stories 3 Stories and 35 Feet FRONTAGE TYPE REQUIREMENTS Frontage type addresses the design elements of the building’s ground floor front façade and the area in front of it extending to the street. It is an essential element of urban design because it is the way a building relates to the sidewalk and either creates a walkable/welcoming environment, or not. All new development adjacent to a street with frontage requirements as shown in Figure 4.1, Community Structure Plan, shall have a primary building façade and entry from the identified street. These frontages dictate the relationship between the street (back of the right-of-way) and the façade of the ground-floor of the building (see Section 4.5.4 Building Design, for building frontage design guidelines). The following frontage types identify the distinct types of front facades that are permitted along the internal “Main Street”. For streets where there is not a designated frontage (such as Redlands Boulevard), all building sides abutting the public right-of-way shall require architectural treatment (see Section 4.5.4, Building Design). THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-27 Planning Area 2-1: MIXED USE Type Permitted Frontage Types Along “Main Street” Ground Floor Residential Stoop, Terrace, Forecourt/Courtyard Ground Floor Commercial Shopfront, Forecourt, Gallery/Arcade OPEN SPACE AND LANDSCAPING REGULATIONS The following open space and landscaping requirements shall apply to new development within Planning Area 2-1. 1. Landscaping within setback areas of private development adjacent to the Oak Woodland or public park should be designed to maximize views to the open space amenity. The landscape palette should be sensitive to the natural habitat or park landscaping. Type MMinimum Open Space Requirement NON-RESIDENTIAL USES 25% of lot not covered by building or parking shall be useable open space (e.g., public plazas, seating nodes, outdoor dining, pedestrian pathways). RESIDENTIAL USES Private Open Space 50 sf / unit Common Open Space 50 sf / unit PARKING RREQUIREMENTS The following parking requirements shall apply to new development within Planning Area 2-1. Where feasible, shared parking is encouraged throughout Planning Area 2-1, as well as with adjacent parking areas with an approved Shared Parking Agreement in accordance with Section 17.24.110 of the LLMC. Bike parking should be consolidated, and racks should be located in a convenient location. Type Minimum Parking Spaces RESIDENTIAL USES Studio Unit 1.0 space / unit One-Bedroom Unit 1.5 spaces / unit Two-Bedroom Unit or Larger 2.0 spaces / unit NON--RESIDENTIAL USES Uses < 3,000 sf 1.6 spaces / 1,000 sf Uses > 3,000 sf 5 spaces / 1,000 sf BICYCLE RACKS 1 space / 25 required parking spaces with a minimum of 1 space / commercial tenant space Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-28 Planning Area 2-1: MIXED USE SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 2-1. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. 2. Minimum Number of Uses: A minimum of 3 separate uses of the use types listed in Table 3.3 shall be included in Planning Area 2-1. 3. Oak Woodland Preserve: Any development in Planning Area 2-1 must be planned in conjunction with the Oak Woodland Preserve (Planning Area 2-2) THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-29 Planning Area 2-2: MIXED USE PURPOSE AND INTENT Planning Area 2-2 is a small 0.5-acre site that is designated as part of the Oak Woodland Preserve within the Specific Plan area. The Oak Woodland Preserve is expected to be incorporated into the design of any adjacent development project, with uses opening onto the open space area and integrated as part a trail system that is generally depicted in Figure 3.8. The final boundary of the Oak Woodland area shall include the necessary drainage area to ensure the health of the trees, as determined by an arborist. Improvements may include benches, picnic tables and additional native landscaping consistent with the coast oak woodland habitat. DEVELOPMENT POTENTIAL SUMMARY In addition to the General Landscape Standards in Chapter 4, the following additional requirements shall apply. 1. The boundary of the Oak Woodland Preserve should contain the priority trees and the drip line area identified by an arborist or licensed landscape architect. 2. A detailed plan showing all improvements, including trails, fencing, and other amenities shall be prepared by a licensed landscape architect and approved by the City. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-30 Planning Area 2-2: MIXED USE DEVELOPMENT STANDARDS The following requirements shall apply to new development within Planning Area 2-1. 1. Oak Woodland Preserve: Any development in Planning Area 2-1 must be planned in conjunction with the Oak Woodland Preserve (Planning Area 2-2). 2. Trail: A 5 foot wide trail is required to meander along or within the Oak Woodland Preserve and is required to connect to the adjacent trails in Planning Area 3-3 and Planning Area 2-1. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-31 Planning Area 2-3 and 2-4: SENIOR HOUSING PURPOSE AND INTENT Planning Area 2-3 and 2-4 are located on the north side of Park Avenue and are envisioned as an age-restricted multi-family community designed to meet the unique needs of seniors, such as relatively small unit sizes, minimizing stairs, and providing elevators to upper floors. The Planning Areas will also have access on the north to a walking trail that provides access to the Oak Woodland Preserve and connects to the “Main Street” for nearby goods and services. DEVELOPMENT POTENTIAL SUMMARY The 9.0 total acres in Planning Area 2-3 and Planning Area 2-4 allow the development of up to 213 senior housing units. No other development potential is assumed for Planning Area 2-3. Development potential from other planning areas may not be transferred to this planning area. DEVELOPMENT SSTANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. These regulate building frontage design to form adequate and pedestrian-friendly building faces. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-32 Planning Area 2-3 and 2-4: SENIOR HOUSING Type Minimum Maximum SITE CONFIGURATION RREQUIREMENTS Lot Size – Non-Residential None None Lot Width None None Building Lot Coverage None None SETBACK REQUIREMENTS From Park Avenue 15 ft None Private Drive or Street 10 ft None Abutting Off-Site One-Story Building 10 ft None Abutting Off-Site Multi-Story Building 20 ft None Abutting Park/Open Space 5 ft None Abutting Water Quality Basin – One Story Building 10 ft None Abutting Water Quality Basin – Multi-Story Building 20 ft None BUILDING DENSITY / IINTENSITY Senior Housing 25 du/ac average 25 du/ac average BUILDING HEIGHTS Senior Housing 2 Stories 3 Stories and 35 Feet OPEN SPACE AND LANDSCAPING REGULATIONS The following open space and landscaping requirements shall apply to new development within Planning Area 2-3 and Planning Area 2-4. Type MMinimum NON-RESIDENTIAL USES 25% of lot not covered by building or parking shall be useable open space (e.g., public plazas, seating nodes, outdoor dining, pedestrian pathways). RESIDENTIAL USES Private Open Space 50 sf / unit Common Open Space 50 sf / unit PARKING REQUIREMENTS THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-33 Planning Area 2-3 and 2-4: SENIOR HOUSING The following parking requirements shall apply to new development within Planning Area 2-3 and Planning Area 2-4. Where feasible, shared parking is encouraged throughout, as well as with adjacent parking areas with an approved Shared Parking Agreement in accordance with Section 17.24.110 of the LLMC. Bike parking should be consolidated, and racks should be located in a convenient location. Type Minimum # of Spaces RESIDENTIAL USES Senior Housing Unit 1 space / unit SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 2-3 and Planning Area 2-4. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. 2. Shared Access: A primary driveway from Park Avenue is required to serve both Planning Area 2-3 and Planning Area 2-4 in order to minimize curb cuts. Planning for Planning Area 2-3 must be coordinated with Planning Area 2-4 to provide reciprocal access. 3. Non-Vehicular Access: A walking trail with a minimum width of 10 feet should be provided on the north side of Planning Area 2-3. This trail should also serve as a safe-route-to- school. 4. Frontages: Although no specific frontage type requirements are required for Planning Area 2-4, development should include building placement and design along the northern part along the walking trail and the east edge of the planning area adjacent to Planning Area 2- 5 so that development enhances the public realm and has appropriate bulk, scale, setbacks, and fenestration. 5. Oak Woodland Preserve Adjacency: Landscaping within setback areas of private development adjacent to the Oak Woodland or public park should be designed to maximize views to the open space amenity. The landscape palette should be sensitive to the natural habitat or park landscaping. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-34 Planning Area 2-5: MIXED USE PURPOSE AND INTENT Planning Area 2-5 is envisioned as an active living, shopping, dining, and potential office environment. The standards are intended to result in an interconnected network of streets and drives the promote walkability within and to adjacent planning areas. Planning Area 2-5 is located at the intersection of California Street and Park Avenue at one of the primary entrances to the Specific Plan area. Design standards and guidelines have been developed to address how the individual buildings interact with the street and create an active, pedestrian-friendly environment. DEVELOPMENT POTENTIAL SUMMARY The 5.8 total acres in Planning Area 2-5 includes the following: x 54 dwelling units x 67,520 square feet of non-residential Additional development for residential and non-residential development is permitted if development rights are transferred from another planning area. DEVELOPMENT STANDARDS The following development standards shown in Table 4-15 regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-35 Planning Area 2-5: MIXED USE Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size – Non-Residential None None Lot Width 35ft None Building Lot Coverage None None SETBACK REQUIREMENTS From California Street: Commercial & Residential 10 ft 20 ft From Park Avenue: Commercial & Residential 5 ft None Private Drive or Street 5ft None Abutting Off-Site One-Story Building 10 ft None Abutting Off-Site Multi-Story Building 20 ft None Abutting Park/Open Space 5 ft None BUILDING DENSITY / INTENSITY Non-Residential .3 FAR .5 FAR Residential 20 du/ac averages 20 du/ac average Senior Housing 25 du/ac average 25 du/ac average BUILDING HEIGHTS Non-Residential None 3 Stories and 35 Feet Residential 2 Stories 3 Stories and 35 Feet OPEN SPACE AND LANDSCAPING REGULATIONS The following open space and landscaping requirements shall apply to new development within Planning Area 2-5. Type MMinimum NON-RESIDENTIAL USES 25% of lot not covered by building or parking shall be useable open space (e.g., public plazas, seating nodes, outdoor dining, pedestrian pathways). RESIDENTIAL USES Private Open Space 50 sf / unit Common Open Space 50 sf / unit PARKING REQUIREMENTS The following parking requirements shall apply to new development within Planning Area 2-5. Where feasible, shared parking is encouraged throughout Planning Area 2-5, as well as with adjacent parking areas with an approved Shared Parking Agreement. Bike parking should be consolidated, and racks should be located in a convenient location. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-36 Planning Area 2-5: MIXED USE Type Minimum # of Spaces RESIDENTIAL USES Studio Unit 1.0 space / unit One-Bedroom Unit 1.5 spaces / unit Two-Bedroom Unit or Larger 2.0 spaces / unit NON--RESIDENTIAL USES Uses < 3,000 sf 1.6 spaces / 1,000 sf Uses > 3,000 sf 5 spaces / 1,000 sf BICYCLE RACKS 1 space / 25 required parking spaces with a minimum of 1 space / commercial tenant space SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 2-5. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of- way, access, and parking. 2. Minimum Number of Uses: A minimum of 4 separate uses of the use types listed in Table 3.3 shall be included in Planning Area 2-5. 3. Vehicular Access: Secondary access to Planning Area 0-1 should be provided via Park Avenue to reduce potential turning movement and safety conflicts at the entrances to Mission Elementary School along California Street. To provide secondary access to Planning Area 0-1, coordination is encouraged as part of any proposed development in Planning Area 2-5. 4. Urban Trail: A walking trial at least 10 feet wide is required along California Street to provide pedestrian pathway and compliment the mixed-use orientation. 5. Active Uses: Active uses should front California Street and the urban trail to provide enhanced public spaces and active uses. 6. Corner Treatment at California Street and Park Avenue: As shown on Figure 4.1, Community Structure Plan, a Corner Treatment has been identified for the corner of California Street and Park Avenue. As one of the primary entrances to the Specific Plan area from California Street, the design of this corner is an essential element in branding the area. Buildings shall have a major presence at the corner to enhance the pedestrian experience and create character and appropriate massing along the roadway. See Section X, Design Guidelines for architectural design standards for corner treatments. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-37 Planning Area 2-6: PARK PURPOSE AND INTENT Planning Area 2-6 includes the 13.9-acre North Park, which provides active recreational opportunities for residents and the greater Loma Linda community. North Park includes recreational amenities such as basketball courts, bocce ball courts, pickle ball courts, horseshoe pits, and a children’s playground. A large open area designed for use as a dog park is located in the northeast corner of North Park. The majority of the turf area within the park is allocated for youth soccer fields, sized to provide game facilities for a variety of ages. Conveniently located throughout North Park, picnic shelters provide shaded seating and a 10-foot wide decomposed granite trail encircles the North Park boundary. North Park also provides a parking lot for vehicles and a restroom building. Evergreen canopy trees, deciduous trees, and accent trees that include pockets of orange trees are located along the park periphery and clustered within the northern portion of the park. DEVELOPMENT POTENTIAL SUMMARY Planning Area 2-6 includes the 13.9-acre park. No residential or non-residential development is allowed within this planning area. DEVELOPMENT STANDARDS The following development standards regulate the apply to the development of Planning Area 2-6. x Community Overlay: A variety of community-serving uses including a fire station, community multi-purpose building/facility, concession areas or restaurants, and commercial recreation uses such as fitness studios and batting cages are allowed within the community overlay. This overlay provides an optional range of uses to be considered in the final design of the park. x Parking: A parking study shall be prepared to determine the total number of space and location based on the mix of activities in the final Park Plan. Parking for Planning Area 2-6 shall be shared with Planning Area 3-4. Parking along the streets may account toward meeting the parking requirement. x Stormwater Management: Any required storm water management facilities such as stormwater detention basins, should be integrated as functioning portions of the park that provide recreational amenities. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-38 Planning Area 2-7: MIXED USE PURPOSE AND INTENT Planning Area 2-7 is envisioned as an active living, shopping, dining, and potential office environment. The standards are intended to result in an interconnected network of streets and drives the promote walkability within and to adjacent planning areas. Planning Area 2-7 is located at the intersection of California Street and Park Avenue at one of the primary entrances to the Specific Plan area. Design standards and guidelines have been developed to address how the individual buildings interact with the street and create an active, pedestrian-friendly environment. DEVELOPMENT POTENTIAL SUMMARY The 6.7 total acres in Planning Area 2-7 includes the following: x 62 dwelling units x 78,410 square feet of non-residential Additional development for residential and non-residential development is permitted if development rights are transferred from another planning area. DEVELOPMENT STANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. See Section 4.4.31 for certain deviations from building setbacks, building height, and the floor-area-ratio (FAR) standards shown below. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-39 Planning Area 2-7: MIXED USE Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size – Non-Residential None None Lot Width 35ft None Building Lot Coverage None None SETBACK REQUIREMENTS From California Street: Commercial & Residential 10 ft 20 ft From Park Avenue: Commercial & Residential 5 ft None Private Drive or Street 5ft None Abutting Off-Site One-Story Building 10 ft None Abutting Off-Site Multi-Story Building 20 ft None Abutting Park/Open Space 5 ft None BUILDING DENSITY / INTENSITY Non-Residential .3 FAR .5 FAR Residential 20 du/ac averages 20 du/ac average Senior Housing 25 du/ac average 25 du/ac average BUILDING HEIGHTS Non-Residential None 3 Stories and 35 Feet Residential 2 Stories 3 Stories and 35 Feet OPEN SPACE AND LANDSCAPING REGULATIONS The following open space and landscaping requirements shall apply to new development within Planning Area 2-7. Type MMinimum NON-RESIDENTIAL USES 25% of lot not covered by building or parking shall be useable open space (e.g., public plazas, seating nodes, outdoor dining, pedestrian pathways). RESIDENTIAL USES Private Open Space 50 sf / unit Common Open Space 50 sf / unit PARKING RREQUIREMENTS The following parking requirements shown shall apply to new development within Planning Area 2- 5. Where feasible, shared parking is encouraged throughout Planning Area 2-7, as well as with adjacent parking areas with an approved Shared Parking Agreement in accordance with Section Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-40 Planning Area 2-7: MIXED USE 17.24.110 of the LLMC. Bike parking should be consolidated, and racks should be located in a convenient location. Type Minimum # of Spaces RESIDENTIAL USES Studio Unit 1.0 space / unit One-Bedroom Unit 1.5 spaces / unit Two-Bedroom Unit or Larger 2.0 spaces / unit NON--RESIDENTIAL USES Uses < 3,000 sf 1.6 spaces / 1,000 sf Uses > 3,000 sf 5 spaces / 1,000 sf BICYCLE RACKS 1 space / 25 required parking spaces with a minimum of 1 space / commercial tenant space SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 2-7. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. 2. Minimum Number of Uses: A minimum of 4 separate uses of the use types listed in Table 3.3 shall be included in Planning Area 2-7. 3. Primary Shared Access: A driveway from California Street is required to serve both Planning Area 2-7 and Planning Area 2-9 in order to minimize curb cuts. Planning for Planning Area 2-7 must be coordinated with Planning Area 2-9 to provide reciprocal access. 4. Secondary Reciprocal Access: Internal circulation should be provided between Planning Area 2-9 and Planning Area 2-7, and Planning Area 2-9 and Planning Area 2-10 via drive aisles, alleys, or internal roadways at least 25 feet in width. 5. Urban Trail: A walking trial at least 10 feet wide is required along California Street to provide pedestrian pathway and compliment the mixed-use orientation. 6. Active Uses: Active uses should front California Street and the urban trail to provide enhanced public spaces and active uses. 7. Corner Treatment at California Street and Park Avenue: As shown on Figure 4.1, Community Structure Plan, a Corner Treatment has been identified for the corner of California Street and Park Avenue. As one of the primary entrances to the Specific Plan area from California Street, the design of this corner is an essential element in branding the area. Buildings shall have a major presence at the corner to enhance the pedestrian experience and create THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-41 Planning Area 2-7: MIXED USE character and appropriate massing along the roadway. See Section X, Design Guidelines for architectural design standards for corner treatments. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-42 Planning Area 2-8: LOW DENSITY RESIDENTIAL PURPOSE AND INTENT Planning Area 2-8 is located north of Citrus Avenue and is envisioned as a community of low density residential homes. Planning Area 2-8 is surrounded by amenities, including the neighborhood park to the west and the mixed-use commercial to the east. The community will have access to trails that provide opportunities for walking to other parts of the Specific Plan area. Although Planning Area 2-8 has an approved tentative tract map, development standards are provided to assist in any subsequent reviews or any proposed changes to the map. DEVELOPMENT POTENTIAL SUMMARY The 13.5 total acres in Planning Area 2-8 include the following: x 54 dwelling units Non-residential development is not allowed within this planning area. DEVELOPMENT STANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-43 Planning Area 2-8: LOW DENSITY RESIDENTIAL Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size* 7,200 sf None Lot Width None None Building Lot Coverage None 40% SETBACK REQUIREMENTS Front: To Front Facing Garage 18 ft None Front: To Side-On Garage or Livable Space 12 ft None Front: To Door or Architectural Projections 10 ft None Interior Side 5 ft None Exterior Side 10 ft None Rear 15 ft None BUILDING DENSITY / INTENSITY Residential 0 du/ac 4 du/ac average BUILDING HEIGHTS Residential None 3 Stories and 35 Feet * Within the planning area, a maximum of 60% of lots between 7,200 – 7,400 sf and a minimum of 40% of lots may be greater than 7,4000 sf. PARKING REQUIREMENTS The following parking requirements shall apply to new development within Planning Area 2-8. Type Minimum # of Spaces RESIDENTIAL USES Enclosed Garage 2.0 spaces / unit SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 2-8. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. 2. Vehicular Access: Two primary access points should be provided to Planning Area 2-8 from Citrus Avenue. 3. Non-Vehicular Access: Access and connections should be provided to the trail in Planning Area 2-6. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-44 Planning Area 2-9, 2-10 and 2-11: MIXED USE PURPOSE AND INTENT Planning Area 2-9 is located along California Street and is envisioned as a neighborhood serving commercial area in a walkable setting. A walking trail along California Street will provide a link the internal areas of the Specific Plan area. Design standards and guidelines have been developed to address how the individual buildings interact with the street and create an active, pedestrian- friendly environment. DEVELOPMENT POTENTIAL SUMMARY The 3.1 total acres in Planning Area 2-9, Planning Area 2-10, and Planning Area 2-11 include the following: x No residential development potential is assumed as part of Planning Area 2-9, Planning Area 2-10, and Planning Area 2-11. Residential uses are permitted, but not required. x 67,515 square feet of non-residential Development rights for residential and additional non-residential may be transferred from another Planning Area. DEVELOPMENT STANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-45 Planning Area 2-9, 2-10 and 2-11: MIXED USE Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size – Non-Residential None None Lot Width 35ft None Building Lot Coverage None None SETBACK REQUIREMENTS From California Street: Commercial & Residential 10 ft 20 ft Private Drive or Street 5ft None Abutting Off-Site One-Story Building 10 ft None Abutting Off-Site Multi-Story Building 20 ft None Abutting Park/Open Space 5 ft None BUILDING DENSITY / INTENSITY Non-Residential .3 FAR .5 FAR Residential 20 du/ac averages 20 du/ac average Senior Housing 25 du/ac average 25 du/ac average BUILDING HEIGHTS Non-Residential None 3 Stories and 35 Feet Residential 2 Stories 3 Stories and 35 Feet OPEN SPACE AND LANDSCAPING REGULATIONS The following open space and landscaping requirements shall apply to new development within Planning Area 2-9, Planning Area 2-10, and Planning Area 2-11. Type MMinimum NON-RESIDENTIAL USES 25% of lot not covered by building or parking shall be useable open space (e.g., public plazas, seating nodes, outdoor dining, pedestrian pathways). RESIDENTIAL USES Private Open Space 50 sf / unit Common Open Space 50 sf / unit PARKING REQUIREMENTS The following parking requirements shall apply to new development within Planning Area 2-9, 2- 10, and 2-11. Where feasible, shared parking is encouraged throughout, as well as with adjacent parking areas with an approved Shared Parking Agreement in accordance with Section 17.24.110 of the LLMC. Bike parking should be consolidated, and racks should be located in a convenient Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-46 Planning Area 2-9, 2-10 and 2-11: MIXED USE location. Type Minimum # of Spaces RESIDENTIAL USES Studio Unit 1.0 space / unit One-Bedroom Unit 1.5 spaces / unit Two-Bedroom Unit or Larger 2.0 spaces / unit NON--RESIDENTIAL USES Uses < 3,000 sf 1.6 spaces / 1,000 sf Uses > 3,000 sf 5 spaces / 1,000 sf BICYCLE RACKS 1 space / 25 required parking spaces with a minimum of 1 space / commercial tenant space SPECIAL REQUIREMENTS 1. CComprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. 2. Minimum Number of Uses: A minimum of 2 separate uses of the use types listed in Table 3.3 shall be included in Planning Area 2-9. A minimum of 1 separate uses of the use types listed in Table 3.3 shall be included in Planning Area 2-11. 3. Primary Shared Access: A driveway from California Street is required to serve both Planning Area 2-7 and Planning Area 2-9 in order to minimize curb cuts. 4. Secondary Reciprocal Access: Internal circulation should be provided between Planning Area 2-9 and Planning Area 2-7, Planning Area 2-9 and Planning Area 2-10, and Planning Area 2-10 and Planning Area 2-11 via drive aisles, alleys, or internal roadways at least 25 feet in width. 5. Urban Trail: A walking trial at least 10 feet wide is required along California Street to provide pedestrian pathway and compliment the mixed-use orientation. 6. Active Uses: Active uses should front California Street and the urban trail to provide enhanced public spaces and active uses. 7. Entry Monumentation: As shown in Figure 4.1, Community Structure Plan, the entrance from California Street should include some type of entry monumentation that denotes the entrance to the Specific Plan area. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-47 Planning Area 2-12: LOW DENSITY RESIDENTIAL PURPOSE AND INTENT Planning Area 2-12 is located south of Citrus Avenue and is envisioned as a community of low density residential homes. The community will have access to trails that provide an opportunity for walking to other parts of the Specific Plan area. Although Planning Area 2-12 has an approved tentative tract map, development standards are provided to assist in any subsequent reviews or any proposed changes to the map. DEVELOPMENT POTENTIAL SUMMARY The 20.0 total acres in Planning Area 2-12 include the following: x 80 dwelling units No Non-residential development is allowed within this planning area. DEVELOPMENT STANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size* 7,200 sf None Lot Width None None Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-48 Planning Area 2-12: LOW DENSITY RESIDENTIAL Building Lot Coverage None 40% SETBACK REQUIREMENTS Front: To Front Facing Garage 18 ft None Front: To Side-On Garage or Livable Space 12 ft None Front: To Door or Architectural Projections 10 ft None Interior Side 5 ft None Exterior Side 10 ft None Rear 15 ft None BUILDING DENSITY / INTENSITY Residential 0 du/ac 4 du/ac average BUILDING HEIGHTS Residential None 3 Stories and 35 Feet * Within the planning area, a maximum of 60% of lots between 7,200 – 7,400 sf and a minimum of 40% of lots may be greater than 7,4000 sf. PARKING REQUIREMENTS The following parking requirements shall apply to new development within Planning Area 2-12. Type Minimum # of Spaces RESIDENTIAL USES Enclosed Garage 2.0 spaces / unit SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 2-12. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. 2. Trail: A 10-foot-wide decomposed trail is required on the north side of Planning Area 2-12 along Citrus Avenue. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-49 Planning Area 2-13: HIGH DENSITY RESIDENTIAL PURPOSE AND INTENT Planning Area 2-13 is located at the corner of Citrus Avenue and California Street and is envisioned as a neighborhood of multi-family homes. The high density residential designation allows for a variety of housing types, including walk-up townhomes, duplex or triplex units, courtyard and motor court products, and attached single-family housing. Although Planning Area 2-13 has an approved tentative tract map, development standards are provided to assist in any subsequent reviews or any proposed changes to the map. DEVELOPPMENT POTENTIAL SUMMARY The 5.5 total acres in Planning Area 2-12 include the following: x 33 dwelling units No Non-residential development is allowed within this planning area. DEVELOPMENT STANDARDS development by establishing standards for intensity, density, building height, open space, and other elements. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-50 Planning Area 2-13: HIGH DENSITY RESIDENTIAL Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size None None Lot Width None None Building Lot Coverage None None SETBACK REQUIREMENTS From California Street 20 ft None From Citrus Ave 10 ft None Private Street or Drive 10 ft None Building-to-Building Separation Per California Building Code Abutting Off-Site One-Story Building 10 Ft None Abutting Off-Site Multi-Story Building 15 ft None BUILDING DENSITY / INTENSITY Residential 6 du/ac 13 du/ac BUILDING HEIGHTS Residential 2 Stories 3 Stories and 35 Feet OPEN SPACE AND LANDSCAPING REGULATIONS The following open space and landscaping requirements shall apply to new development within Planning Area 2-13. Type MMinimum RESIDENTIAL USES Open Space 100 sf / unit PARKING REQUIREMENTS The following parking requirements shall apply to new development within Planning Area 2-13. Type Minimum # of Spaces RESIDENTIAL USES Studio Unit 1.0 space / unit One-Bedroom Unit 1.5 spaces / unit Two-Bedroom Unit or Larger 2.0 spaces / unit 0.5 spaces for each bedroom over 2 bedrooms Guest Parking 0.5 spaces / unit THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-51 Planning Area 2-13: HIGH DENSITY RESIDENTIAL SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 2-13. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. 2. Urban Trail: A walking trial at least 10 feet wide is required along California Street to provide pedestrian pathway and compliment the mixed-use orientation. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-52 Planning Area 2-14: LOW DENSITY RESIDENTIAL PURPOSE AND INTENT Planning Area 2-14 is located in the southwest portion of the Specific Plan area and is envisioned as a community of low density residential homes. Primary access will be provided by two locations on Orange Avenue. The planning area will be bordered on the south and west by a trail to provide access to other parts of the Specific Plan area. Although Planning Area 2-14 has an approved tentative tract map, development standards are provided to assist in any subsequent reviews or any proposed changes to the map. DEVELOPMENT POTENTIAL SUMMARY The 11.0 total acres in Planning Area 2-14 include the following: x 44 dwelling units No Non-residential development is allowed within this planning area. DEVELOPMENT STANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size* 7,200 sf None Lot Width None None Building Lot Coverage None 40% SETBACK REQUIREMENTS Front: To Front Facing Garage 18 ft None Front: To Side-On Garage or Livable Space 12 ft None THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-53 Planning Area 2-14: LOW DENSITY RESIDENTIAL Front: To Door or Architectural Projections 10 ft None Interior Side 5 ft None Exterior Side 10 ft None Rear 15 ft None BUILDING DENSITY / INTENSITY Residential 0 du/ac 4 du/ac average BUILDING HEIGHTS Residential None 3 Stories and 35 Feet * Within the planning area, a maximum of 60% of lots between 7,200 – 7,400 sf and a minimum of 40% of lots may be greater than 7,4000 sf. PARKING REQUIREMENTS The following parking requirements shall apply to new development within Planning Area 2-14. Type Minimum # of Spaces Enclosed Garage 2.0 spaces / unit SPECIAL RREQUIREMENTS The following requirements shall apply to new development within Planning Area 2-14. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-54 Planning Area 2-15: PARK PURPOSE AND INTENT Planning Area 2-15 includes the 4.0-acre South Park that provides convenient recreational opportunities for residents of THE GROVES and neighborhoods located south of Mission Road. The concept plan for South Park, features amenities for group use including a picnic shelter and gathering areas. Additional facilities include bocce ball courts, a children’s playground, and open play areas. A 10-foot wide decomposed granite trail, which leads past picnic benches and exercise stations, encircles South Park and ties into the pedestrian Paseo that leads to North Park. The Zanja Regional Trail, which bisects South Park and continues off-site along Mission Road, includes interpretive signage to educates users about the importance of the Zanja irrigation ditch to the history of the area. A parking lot and restrooms are also provided within South Park. Evergreen canopy trees and accent trees consistent with the landscape theme are located throughout South Park, creating a distinct community identity. DEVELOPMENT POTENTIAL SUMMARY Planning Area 2-15 includes the 4.0-acre park. No residential or non-residential development is not allowed within this planning area. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-55 Planning Area 2-16: LOW DENSITY RESIDENTIAL PURPOSE AND INTENT Planning Area 2-16 is in the southwest corner of the Specific Plan area and is envisioned as a community of low density residential homes. Primary access will be provided by two locations on Orange Avenue. The planning area will be bordered on the east by a trail along California Street. Although Planning Area 2-16 has an approved tentative tract map, development standards are provided to assist in any subsequent reviews or any proposed changes to the map. DEVELOPMENT POTENTIAL SUMMARY The 5.0 total acres in Planning Area 2-16 include the following: x 20 dwelling units No Non-residential development is allowed within this planning area. DEVELOPMENT STANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-56 Planning Area 2-16: LOW DENSITY RESIDENTIAL Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size* 7,200 sf None Lot Width None None Building Lot Coverage None 40% SETBACK REQUIREMENTS Front: To Front Facing Garage 18 ft None Front: To Side-On Garage or Livable Space 12 ft None Front: To Door or Architectural Projections 10 ft None Interior Side 5 ft None Exterior Side 10 ft None Rear 15 ft None BUILDING DENSITY / INTENSITY Residential 0 du/ac 4 du/ac average BUILDING HEIGHTS Residential None 3 Stories and 35 Feet * Within the planning area, a maximum of 60% of lots between 7,200 – 7,400 sf and a minimum of 40% of lots may be greater than 7,4000 sf. PARKING REQUIREMENTS The following parking requirements shall apply to new development within Planning Area 2-16. Type Minimum # of Spaces Enclosed Garage 2.0 spaces / unit SPECIAL RREQUIREMENTS The following requirements shall apply to new development within Planning Area 2-16. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. 2. Trail: A 10-foot-wide decomposed trail is required along California Street. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-57 Planning Area 2-17: PASEO PURPOSE AND INTENT Planning Area 2-17 includes 2.3-acre of open space / trail (paseo), which varies in width from 27 to 40 feet, provides a pedestrian amenity and facilitates access between North Park and South Park. The Paseo is located along the western boundary of Planning Area 2-12 and Planning Area 2-14 and features a 10-foot wide meandering decomposed granite trail surrounded by evergreen canopy and accent trees. Picnic tables and exercise stations are sited along the Paseo, adding to the function of this community amenity. Interpretive signage educates users of the Paseo about the history of the local area. DEVELOPMENT POTENTIAL SUMMARY The 2.3 total acres in Planning Area 2-17 are limited to open space / trail use. No residential or non-residential development is allowed within this planning area. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-58 Planning Area 2-18: TRAIL PURPOSE AND INTENT Planning Area 2-18 includes 1.1-acres of open space / trail (paseo) along California Street. It provides a pedestrian amenity and facilitates access along the eastern boundary of the Specific Plan abutting Planning Area 2-5, Planning Area 2-7, Planning Area 2-9, Planning Area 2-10, Planning Area 2-11, Planning Area 2-13, Planning Area 2-14, Planning Area 2-16. The paseo features a 10-foot wide meandering decomposed granite trail, enhancing the public realm for adjacent development that includes mixed use development and high, and low density residential. DEVELOPMENT POTENTIAL SUMMARY The 1.1 total acres in Planning Area 2-18 are limited to open space / trail use. No residential or non- residential development is allowed within this planning area. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-59 Planning Area 3-1: PARK PURPOSE AND INTENT Planning Area 3-1 includes a total of 6.6 acres of park area located on the eastern edge of THE GROVES just north of Mission Road. The existing Heritage Park includes the existing historic land mark, provides a vista point, and serves as a connecter between the Zanja Trail and SCE regional trail corridor. Further north, historic structures relocated to the site that will serve as an interpretive area and provide an office location for community-serving organization. To the north of the historic structures, Planning Area 3-1 should provide a designated-purpose park/recreation use, including the possibility of a nature center, educational outdoor amphitheater, archery center, community garden, or another use that is programmed for the use of small groups. DEVELOPMENT POTENTIAL SUMMARY The 6.6 total acres in Planning Area 3-1 are limited to open space / trail use. No residential or non- residential development is allowed within this planning area. DEVELOPMENT STANDARDS The following development standards regulate the apply to the development of Planning Area 3-1. x Trail: A trail should be provided on the northern edge of Planning Area 3-1 to provide an extension of the decomposed granite trail that extends from the northern side of Park Avenue. The trail will also connect to the SCE regional trail corridor. Citrus groves along the Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-60 Planning Area 3-1: PARK north side of the trail should be used to provide privacy and buffer from existing homes. x Community Overlay: A variety of community-serving uses including a fire station, community multi-purpose building/facility, concession areas or restaurants, and commercial recreation uses such as fitness studios and batting cages are allowed within the community overlay. This overlay provides an optional range of uses to be considered in the final design of the park. x Citrus Groves: A variety of community-serving uses including a fire station, community multi-purpose building. x View Corridor: Figure 4.1, Community Structure Plan, identifies a view corridor along the paseo in Planning Area 2-17 to provide a visual connection to the central park in Planning Area 3-4. x Parking: A parking study shall be prepared to determine the total number of space and location based on the mix of activities in the final Park Plan. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-61 Planning Area 3-2: HIGH DENSITY RESIDENTIAL PURPOSE AND INTENT Planning Area 3-2 is envisioned as a residential neighborhood across from the central park on Bryn Mawr Avenue. It is also located adjacent to the future RUSD school site and just south of the VA Center. This designation allows for a variety of product types, including: walk-up townhomes, duplex or triplex units, courtyard and motor court products, and attached single-family housing ranging from 6 to 13 dwelling units per acre. Dwelling units are required to front or side-on to Bryn Mawr Avenue to take advantage of views to the park, create an attractive street edge, and to eliminate the possibility of a residential wall along Bryn Mawr Avenue. This site contains an easement for the extension of Park Avenue along the northern edge of the property. Park Avenue will enable access to the future school as well as the residential neighborhood. DEVELOPMENT POTENTIAL SUMMARY The 4.6 total acres in Planning Area 3-2 include the following: x 60 dwelling units No Non-residential development is allowed within this planning area. DEVELOPMENT STANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size None None Lot Width None None Building Lot Coverage None None SETBACK REQUIREMENTS From Bryn Mawr Avenue 5 ft 10 ft Private Street or Drive 10 ft None Building-to-Building Separation Per California Building Code Abutting Off-Site One-Story Building 10 Ft None Abutting Off-Site Multi-Story Building 15 ft None BUILDING DENSITY / INTENSITY Residential 6 du/ac 13 du/ac BUILDING HEIGHTS Residential 2 Stories 3 Stories and 35 feet Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-62 Planning Area 3-2: HIGH DENSITY RESIDENTIAL FRONTAGE TYPE REQUIREMENTS Frontage types address the design elements of the building’s ground floor front façade and the area in front of it extending to the street. It is an essential element of urban design because it is the way a building relates to the sidewalk and either creates a walkable/welcoming environment, or not. All new development adjacent to a street with frontage requirements as shown in Figure 4.1, Community Structure Plan, shall have a primary building façade and entry from the identified street. These frontages dictate the relationship between the street (back of the right-of-way) and the façade of the ground-floor of the building (see Section 4.5.3, Building Design, for building frontage design guidelines). The following frontage types identify the distinct types of front facades that are permitted along Bryn Mawr Avenue. For streets where there is not a designated frontage (such as Park Avenue), all building sides abutting the public right-of-way shall require architectural treatment (see Section 4.5.3, Building Design). Type Permitted Frontage Types Along Bryn Mawr Avenue Residential Stoop, Terrace, Forecourt/Courtyard OPEN SPACE AAND LANDSCAPING REGULATIONS The following open space and landscaping requirements shall apply to new development within Planning Area 3-2. Type Minimum RESIDENTIAL USES Open Space 100 sf / unit PARKING REQUIREMENTS The following parking requirements shall apply to new development within Planning Area 3-2. Type Minimum # of Spaces RESIDENTIAL USES Enclosed Garage 2.0 spaces / unit SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 3-2. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-63 Planning Area 3-3: MIXED USE PURPOSE AND INTENT Planning Area 3-3 is envisioned as an active living, shopping, dining, and recreational environment. The standards are intended to result in an interconnected network of streets and drives the promote walkability within and to adjacent planning areas. The internal “Main Street” is expected to contain many of the retail and restaurant uses in either a stand-alone or mixed-use configuration with residential above. Live-work and walk-up townhomes may also be incorporated onto “Main Street”. Design standards and guidelines have been developed to address how the individual buildings interact with the street and create an active, pedestrian-friendly environment. This area also contains the Oak Woodland Overlay which requires preservation of a minimum of 3 acres of the existing oak trees. The Oak Woodland is expected to be incorporated into the design of any adjacent development project, with uses opening onto the open space area with a trail system as generally depicted in Figure 3.8. The final boundary of the Oak Woodland area shall include the necessary drainage area to ensure the health of the trees, as determined by an arborist. Improvements may include benches, picnic tables and additional native landscaping consistent with the coast oak woodland habitat. This area may also contain a public recreation/open space area that is an extension of the park south of Park Avenue. DEVELOPMENT POTENTIAL SUMMARY The 19.4 total acres in Planning Area 3-3 include the following. x 165 dwelling units x 175,000 square feet of commercial x Oak Woodland Overlay: Minimum 3 acres dedicated with a public easement x Public Open Space: Minimum 1 acre to be focused along Park Avenue and connected to the Oak Woodland Overlay. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-64 Planning Area 3-3: MIXED USE DEVELOPMENT STANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size None None Lot Width 35 ft None Building Lot Coverage None None SETBACK REQUIREMENTS From Bryn Mawr Avenue – Commercial 5 ft 20 ft From Bryn Mawr Avenue – Residential 10 ft 20 ft From Redlands Boulevard – Residential & Commercial 10 ft 20 ft From “Main Street” - Commercial 0 ft 15 ft From “Main Street” - Residential 5 ft 15 ft From Rhonda Street - Commercial 0 ft 15 ft From Rhonda Street – Residential 10 ft 15 ft From Park Avenue – Commercial, Residential, Open Space 10 ft 20 ft Private Drive or Street 5ft None Abutting Off-Site One-Story Building 10 ft None THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-65 Planning Area 3-3: MIXED USE Abutting Off-Site Multi-Story Building 20 ft None Abutting Park/Open Space 5 ft None BUILDING DENSITY / INTENSITY Non-Residential .3 FAR .5 FAR Residential 20 du/ac average 20 du/ac average Senior Housing 25 du/ac average 25 du/ac average BUILDING HEIGHTS Non-Residential None 3 Stories and 35 ft Residential 2 stories 3 Stories and 35 ft FRONTAGE TYPE REQUIREMENTS Frontage types address the design elements of the building’s ground floor front façade and the area in front of it extending to the street. It is an essential element of urban design because it is the way a building relates to the sidewalk and either creates a walkable/welcoming environment, or not. All new development within Planning Area 3-3 adjacent to “Main Street” and Bryn Mawr Avenue should have a primary building façade and entry from the identified street. These frontages dictate the relationship between the street (back of the right-of-way) and the façade of the ground-floor of the building (see Section 4.5.4, Building Design, for building frontage design guidelines). The following frontage types identify the distinct types of front facades that are recommended along “Main Street” and Bryn Mawr Avenue. For streets where there is not a designated frontage, all building sides abutting the public right-of-way shall require architectural treatment (see Section 4.5.4, Building Design). Type Permitted Frontage Types Along “Mainn Street” Permitted Frontage Types Along Bryn Mawr Avenue Ground Floor Residential Stoop, Terrace, Forecourt/Courtyard Stoop, Terrace, Forecourt/Courtyard, Porch, Yard Ground Floor Commercial Shopfront, Forecourt, Gallery/Arcade Shopfront, Forecourt, Gallery/Arcade OPEN SPACE AND LANDSCAPING REGULATIONS The following open space and landscaping requirements shall apply to new development within Planning Area 3-3. 1. Coast Live Oak Woodland Area: The boundary of the oak woodland area should contain the priority trees and the drip line area identified by an arborist or licensed landscape Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-66 Planning Area 3-3: MIXED USE architect. A detailed plan showing all improvements, including trails, fencing, other amenities shall be prepared by a licensed landscape architect and approved by the City. 2. Non-Residential Uses: For ground-floor commercial or live/work units, up to 80% of the setback area may be paved. 3. Development Adjacent to Park/Open Space: Landscaping within setback areas of private development adjacent to the Oak Woodland or public park should be designed to maximize views to the open space amenity. The landscape palette should be sensitive to the natural habitat or park landscaping. Type Minimum NON--RESIDENTIAL USES Open Space 25% of lot not covered by a building or parking shall be useable open space. RESIDENTIAL USES Private Open Space 50 sf / unit Common Open Space 50 sf / unit PARKING REQUIREMENTS The following parking requirements shall apply to new development within Planning Area 3-3. Type Minimum # of Spaces RESIDENTIAL USES Studio Unit 1.0 space / unit One-Bedroom Unit 1.5 spaces / unit Two-Bedroom Unit or Larger 2.0 spaces / unit 0.5 spaces for each bedroom over 2 bedrooms Guest Parking 0.5 spaces / unit NON--RESIDENTIAL USES Uses < 3,000 sf 1.6 spaces / 1,000 sf SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 3-3. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-67 Planning Area 3-3: MIXED USE parking. 2. View Corridor: Figure 4.1, Community Structure Plan, identifies a view corridor at Park Avenue and Bryn Mawr Avenue. People traveling south on Bryn Mawr will have an opportunity to view the large central park and amenities associated with Planning Area 3-4 and Planning Area 2-6. Future development within Planning Area 3-3 shall provide a view window at the north-east corner of Park Avenue and Bryn Mawr. This can be accomplished through the arrangement of buildings, a corner cut-off, a public plaza or landscape treatment at the corner. In addition, development along Park Avenue should include breaks in the building walls so that Main Street is visible from the public right of way on Park Avenue. 3. “Main Street”: “Main Street” shall be designed to connect to Planning Area 1-2 and Planning Area 2-1. 4. Primary Shared Access: The primary access point to Planning Area 3-3 from Redlands Boulevard shall be at Rhonda Street. This roadway shall be a shared access road with Planning Area 1-2 and Planning Area 2-1. 5. Trail: The existing trail in Planning Area 1-2 shall be extended along Bryn Mawr Avenue and interest with the trail planned for Park Avenue. 6. Reciprocal Pedestrian Access: Reciprocal pedestrian access should be provided between Planning Area 3-2 and Planning Area 3-5 as shown in Figure 4.1, Community Structure Plan. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-68 Planning Area 3-4: PARK PURPOSE AND INTENT In contrast to the emphasis on structured sports in North Park, the 15.9-acre Central Park is intended for multi-purpose areas for family picnics, tot lots, community fairs (arts/crafts, food festivals, etc.), annual concerts in the park, farmer’s market, biking and walking. The development of North Park is expected to occur prior to Central Park, therefore Central park should be designed and programmed in coordination with North Park in terms of shared parking, access between the two parks, and activities. At build-out, the two parks should function as one integrated community park. Figure 3.6, Conceptual Central Park Plan, identified a preferred solution for shared parking, and a layout of multipurpose fields, trails, and other uses that complement the conceptual plan for North Park. Like North Park, Figure 3.1, Land Use Plan, shows a Community Use Overlay which allows for a variety of community-serving uses including a fire station, community multi-purpose building/facility, small Amphitheatre, concession areas or restaurants. This overlay provides an optional range of uses to be considered in the final design of the park. Central Park may also be designed to accommodate storm water drainage from development within THE GROVES so that individual projects will not have to incorporate detention basins on-site (see Section 3.6 Grading, Drainage and Water Quality). This may be in the form of a permanent lake that is designed to handle annual run-off, or in the form of detention basin that also includes non-structural park uses, or even in the form of an improved drainage channel that winds through the park and incorporates trails and landscaping. Figures 3.6 below represent two alternative approaches to the design of Central Park based on the alternatives detention area options. DEVELOPMENT POTENTIAL SUMMARY The 15.9 total acres in Planning Area 3-4 have a development potential for public open space with additional uses allowed within the Community Overlay. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-69 Planning Area 3-4: PARK SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 3-4. 1. Community Overlay: A variety of community-serving uses including a fire station, community multi-purpose building/facility, concession areas or restaurants, and commercial recreation uses such as fitness studios and batting cages are allowed within the community overlay. This overlay provides an optional range of uses to be considered in the final design of the park. 2. Parking and Access: A parking study shall be prepared to determine the total number of space and location based on the mix of activities in the final Park Plan. Parking and access for Planning Area 3-4 shall be shared with Planning Area 2-6. Parking along the streets may account toward meeting the parking requirement. 3. Stormwater Management: Any required stormwater management facilities such as stormwater detention basins, should be integrated as functioning portions of the park that provide recreational amenities. 4. Buffer on Citrus Ave: Uses along Citrus Avenue should have a lower-intensity than other uses planned in Planning Area 3-4 to minimize adverse impacts to adjacent residential areas. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-70 Planning Area 3-5: MEDIUM DENSITY RESIDENTIAL PURPOSE AND INTENT Planning Area 3-5 is envisioned as a residential neighborhood across from the central park on Bryn Mawr Avenue. It is also located adjacent to the future RUSD school site. This designation allows for a variety of product types, including: walk-up townhomes, duplex or triplex units, courtyard and motor court products, and attached single-family housing up to 9 dwelling units per acre. Dwelling units are required to front or side-on to Bryn Mawr Avenue to take advantage of views to the park, create an attractive street edge, and to eliminate the possibility of a residential wall along Bryn Mawr Avenue. This site contains an easement for the extension of Citrus Avenue along the southern edge of the property. Citrus Avenue will enable access to the future school as well as the residential neighborhood. DEVELOPMENT POTENTIAL SUMMARY The 12.4 total acres in Planning Area 3-5 include the following: x 103 dwelling units No Non-residential development is allowed within this planning area. DEVELOPMENT STANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-71 Planning Area 3-5: MEDIUM DENSITY RESIDENTIAL Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size None None Lot Width None None Building Lot Coverage None None SETBACK REQUIREMENTS From Bryn Mawr Avenue 5 ft 10 ft Private Street or Drive 10 ft None Building-to-Building Separation Per California Building Code Abutting Off-Site One-Story Building 10 Ft None Abutting Off-Site Multi-Story Building 15 ft None BUILDING DENSITY / INTENSITY Residential 0 du/ac 7.5 du/ac BUILDING HEIGHTS Residential 2 Stories 3 Stories and 35 feet FRONTAGE TYPE REQUIREMENTS Frontage types address the design elements of the building’s ground floor front façade and the area in front of it extending to the street. It is an essential element of urban design because it is the way a building relates to the sidewalk and either creates a walkable/welcoming environment, or not. All new development adjacent to a street with frontage requirements as shown in Figure 4.1, Community Structure Plan, shall have a primary building façade and entry from the identified street. These frontages dictate the relationship between the street (back of the right-of-way) and the façade of the ground-floor of the building (see Section 4.5.3, Building Design, for building frontage design guidelines). The following frontage types in Table 4.52 identify the distinct types of front facades that are permitted along Bryn Mawr Avenue and the internal “Main Street”. For streets where there is not a designated frontage (such as Redlands Boulevard), all building sides abutting the public right-of-way shall require architectural treatment (see Section 4.5.3, Building Design). Type Permitted Frontage Types Along Bryn Mawr Avenue Residential Stoop, Terrace, Forecourt/Courtyard OPEN SPACE AND LANDSCAPING REGULATIONS The following open space and landscaping requirements shall apply to new development within Planning Area 3-5. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-72 Planning Area 3-5: MEDIUM DENSITY RESIDENTIAL Type Minimum RESIDENTIAL USES Open Space 100 sf / unit PARKING REQUIREMENTS The following parking requirements shall apply to new development within Planning Area 3-5. Type Minimum # of Spaces RESIDENTIAL USES Studio Unit 1.0 space / unit One-Bedroom Unit 1.5 spaces / unit Two-Bedroom Unit or Larger 2.0 spaces / unit 0.5 spaces for each bedroom over 2 bedrooms Guest Parking 0.5 spaces / unit NON--RESIDENTIAL USES Uses < 3,000 sf 1.6 spaces / 1,000 sf SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 3-5. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. 2. Reciprocal Pedestrian Access: Reciprocal pedestrian access should be provided between Planning Area 3-2 and Planning Area 3-5 as shown in Figure 4.1, Community Structure Plan. 3. Ground Level Open Space: Any open space provided within Planning Area 3-5 should be common open space. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-73 Planning Area 3-6: VERY LOW DENSITY RESIDENTIAL PURPOSE AND INTENT Planning Area 3-6 is envisioned as a residential neighborhood of large estates located along Mission Road and south of Citrus Avenue. It’s location and size provide an opportunity to create a secluded enclave of custom and semi-custom homes on large lots ranging from 10,000 square feet to a half-acre and larger. This 29-acre area serves a unique residential demand in Loma Linda, a location for doctors and other professionals to live and work in the community. Lot configurations should vary so that a more “rural” environment is created. Internal roads may be private streets and drives. Access into Planning Area 3-6 shall primarily be from Citrus Avenue. However, new estates along Mission Road are required to front onto Mission Road, similar to the cluster of existing homes within this area. No through access from Mission Road is allowed through Planning Area 3- 6. Other special requirements for Planning Area 3-6 include monumentation and trail connections, as defined below. DEVELOPMENT POTENTIAL SUMMARY The 29.3 total acres in Planning Area 3-6 include the following: x 60 dwelling units Non-residential development is not allowed within this planning area. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-74 Planning Area 3-6: VERY LOW DENSITY RESIDENTIAL DEVELOPMENT STANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. See Section 4.4.31 for certain deviations from building setbacks, building height, and the floor-area-ratio (FAR) standards shown below. Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size* 10,000 sf 1 acre BUILDING LOT COVERAGE Lots less than or equal to15,000 sf None 40% Lots between15,001 sf and 30,000 sf None 30% Lots greater than 30,000 sf None 25% SETBACK REQUIREMENTS From Mission Avenue 30 ft None From Citrus Avenue 30 ft None From Private Street or Drive 10 ft None From Paseo 25 ft None From: Future School 20 ft None Building-to-Building Separation 40 ft None BUILDING HEIGHTS Residential None 3 Stories and 35 Feet * No more than 25% of the total lots shall be 15,000 sf or less; and no more than 25% of the total lots shall be 40,000 sf or more PARKING REQUIREMENTS The following parking requirements shall apply to new development within Planning Area 3-6. Type Minimum # of Spaces RESIDENTIAL USES Enclosed Garage 2.0 spaces / unit Additional Parking for Additional Bedrooms After 2 0.5 spaces / bedroom SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 3-6. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-75 Planning Area 3-6: VERY LOW DENSITY RESIDENTIAL height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. 2. Non-Vehicular Access: A walking trail with a minimum width of 10 feet should be provided in the following locations: Mission Road, Citrus Avenue, and through the planning area starting at Mesquite and Mission Road. The trail through the planning area may be designed to follow internal drives or roads, as well as configured as a paseo. 3. Entry Monumentation: As shown in Figure 4.1, Community Structure Plan, the planning area will contain special monumentation to denote the estate neighborhood. The final location of this monumentation is flexible. It could be located at a primary entry off Citrus Avenue or at the east corner of the planning area. The purpose is to brand this special residential neighborhood. 4. Historic Preservation: There is an existing historic structure within this planning area. This structure may remain in place as a residence. If this structure is to be removed, it must be relocated. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-76 Planning Area 3-7: MIXED USE PURPOSE AND INTENT Planning Area 3-7 contains an existing RV Park and small restaurant along Redlands Boulevard. It is adjacent to Mission Elementary School and within a 5-minute walk of the future Redlands light rail station on California Street. In the future, this area may be redeveloped with higher density residential such as courtyard housing, townhomes, triplexes and other multifamily housing types. Restaurants and retail uses may be located along Redlands Boulevard. Access to Planning Area 3-7 from inside THE GROVES will be from the extension of “Main Street” and from a shared drive that serves the Senior Housing located to the south in Planning Area 2-4. Access from Redlands Boulevard will be from a shared access road with Planning Area 2-1. The standards are intended to create a high-quality residential project that provides convenient pedestrian connections to “Main Street” for shopping and dining, as well as Redlands Boulevard and the future transit station. Planning Area 3-7 must also provide for a trail along the southern boundary (see Section X for dedication requirements) that connects to the elementary school and the trail connecting to the Oak Woodlands and central park. DEVELOPMENT POTENTIAL SUMMARY The 4.6 total acres in Planning Area 3-7 include the following: x 93 dwelling units x 5,000 square feet of commercial. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-77 Planning Area 3-7: MIXED USE DEVELOPMENT STANDARDS The following development standards regulate new site and building development by establishing standards for intensity, density, building height, open space, and other elements. See Section 4.4.31 for certain deviations from building setbacks, building height, and the floor-area-ratio (FAR) standards shown below. Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size – Nonresidential None None Lot Width 35 ft None Building Lot Coverage None None SETBACK REQUIREMENTS From Redlands Boulevard–Commercial & Residential 10 ft 20 ft From Private Street or Drive 5 ft None From Adjacent Off-Site One-Story Building 10 ft None From Elementary School 20 ft None From Park/Open Space 5 ft None BUILDING DDENSITY/INTENSITY Non-Residential 0.3 FAR 0.5 FAR Residential 20 du/ac average 20 du/ac average Senior Housing 25 du/ac average 25 du/ac average BUILDING HEIGHTS Non-Residential None 3 Stories and 35 Feet Residential 2 stories 3 Stories and 35 Feet OPEN SPACE AND LANDSCAPING RREGULATIONS The following open space and landscape requirement shall apply to new development within Planning Area 3-7. 1. For ground-floor commercial, office, or live/work units, up to 80% of the setback area may be paved. Type MMinimum NON-RESIDENTIAL USES 25% of lot not covered by building or parking shall be useable open space (e.g., public plazas, seating nodes, outdoor dining, pedestrian pathways). RESIDENTIAL USES Private Open Space 50 sf / unit Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-78 Planning Area 3-7: MIXED USE Common Open Space 50 sf / unit PARKING RREQUIREMENTS The following parking requirements shown in Table 4.59 shall apply to new development within Planning Area 3-7. Type Minimum # of Spaces RESIDENTIAL USES Studio Unit 1.0 space / unit One-Bedroom Unit 1.5 spaces / unit Two-Bedroom Unit or Larger 2.0 spaces / unit Guest Parking 0.5 spaces / unit NON--RESIDENTIAL USES Uses < 3,000 sf 1.6 spaces / 1,000 sf Uses > 3,000 sf 5 spaces / 1,000 sf BICYCLE RACKS 1 space / 25 required parking spaces with a minimum of 1 space / commercial tenant space SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 3-7. 1. Comprehensive Planning: A conceptual plan and/or tentative map of the entire planning area shall be prepared as part of any development application to demonstrate the location, height, of proposed buildings, public space, landscaping, public rights-of-way, access, and parking. 2. Minimum Number of Uses: A minimum of 3 separate uses of the use types listed in Table 3.3 shall be included in Planning Area 3-7. 3. “Main Street”: “Main Street” will provide convenient access to the commercial, retail and other activities within THE GROVES. However, the extension of “Main Street” into Planning Area 3-7 may be flexible in terms of the alignment and how it serves the residential project. It may also function as a private drive, but must allow for convenient pedestrian access in and out of the project. 4. Non-Vehicular Access: A walking trail with a minimum width of 10 is required along the southern border of the planning area. The first site to be developed (either Planning Area 3-7 or Planning Area 2-4) will be required to provide the trail, unless an agreement is reached between both property owners to locate the trail on the boundary between both properties. The connection of the trail with a gate at the school property must be coordinated with RUSD. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-79 Planning Area 3-7: MIXED USE 5. Reciprocal Access: Reciprocal internal access is encouraged between Planning Area 3-7 and Planning Area 2-1 to minimize the number of access points from Redlands Boulevard. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-80 Planning Area 0-1: INSTITUTIONAL PURPOSE AND INTENT Planning Area 0-1 includes the existing Mission Elementary School located near the intersection of Redlands Boulevard and California Street. Although it is assumed that Mission Elementary School will remain over the long-term, development standards are also provided to guide any potential future reuse if it is ever proposed. Other standards, guidelines, and recommendations are provided for Planning Area 0-1 to ensure that the school is appropriately integrated with any new development nearby. Note that other planning areas that surround Planning Area 0-1 have specific requirements that address adjacency, compatibility, and access to provide special standards for development adjacent to the school. DEVELOPMENT POTENTIAL SUMMARY No development potential for the 11.6 acres of Planning Area 0-1 is incorporated within this Specific Plan. Any future development will require a Specific Plan Amendment and an update to the applicable development standards and design guidelines. A Specific Plan Amendment will also require a separate environmental review because potential future development in Planning Area 0- 1 is not included in this Specific Plan or the associated EIR. DEVELOPMENT STANDARDS Although Mission Elementary School is owned by Redlands Unified School District and may not be subject to the requirements of this Specific Plan, limited development standards and design guidelines are provided to serve as recommendations for future development and improvements. Planning Area 0-1 is designated as Institutional. If a use other than Institutional is ever proposed, Planning Area 0-1 will have a default land use of Mixed Use. Development standards regulate new development by establishing standards that control site THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-81 Planning Area 0-1: INSTITUTIONAL configuration (i.e., lot size and setbacks from adjacent streets and uses), and building form (i.e., density and intensity, and building heights). Development standards based on the Institutional- Health Care (I-HC) designation in the Loma Linda Zoning Code (Municipal Code 17.44.040) are applied to Planning Area 0-1 as shown in Table 4-1. See Section 4.4.31 for certain deviations from building setbacks, building height, and the floor-area-ratio (FAR) standards shown below. Type Minimum Maximum SITE CONFIGURATION REQUIREMENTS Lot Size None None Lot Width 100 ft None Building Lot Coverage 50% None SETBACK REQUIREMENTS From California St. or Redlands Blvd. 25 ft None Front 25 ft None Side - Abutting Parcel Zoned for Residential 2 ft None Side - Abutting Parcel Zoned for Non-Residential 10 ft None Side – Abutting Street 25 ft None Rear - Abutting Parcel Zoned for Residential 20 ft None Rear - Abutting Parcel Zoned for Non-Residential 10 ft None BUILDING DENSITY / INTENSITY Non-Residential None .5 FAR BUILDING HEIGHTS Non-Residential None 3 Stories SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 0-1. 1. Vehicular Access: Secondary access to Planning Area 0-1 should be provided via Park Avenue to reduce potential turning movement and safety conflicts at the entrances to Mission Elementary School along California Street. To provide secondary access to Planning Area 0-1, coordination is encouraged as part of any proposed development in Planning Area 2-5. 2. Non-Vehicular Access: Connections should be providing to trails and sidewalks in Planning Area 3-7 and Planning Area 2-4 to allow non-vehicular access to and from Planning Area 0-1. 3. Adaptive Reuse: Any future development shall include adaptive reuse of any historic structures on the site. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-82 Planning Area 0-2: INSTITUTIONAL PURPOSE AND INTENT Planning Area 0-2 is located along Mission Road and is owned by Redlands Unified School District. It is assumed that a future school is planned for the site, and future development may not be subject to the requirements of this Specific Plan. Limited development standards and design guidelines are provided to serve as recommendations for future development and improvements. Other standards, guidelines, and recommendations are provided for Planning Area 0-2 to ensure that the school is appropriately integrated with any new development nearby. Note that other planning areas that surround Planning Area 0-2 have specific requirements that address adjacency, compatibility, and access to provide special standards for development adjacent to the school. DEVELOPMENT POTENTIAL SUUMMARY No development potential for the 27.5 acres of Planning Area 0-2 is incorporated within this Specific Plan. Any future development will require a Specific Plan Amendment and an update to the applicable development standards and design guidelines. A Specific Plan Amendment will also require a separate environmental review because potential future uses in Planning Area 0-2 are not included in this Specific Plan or the associated EIR. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-83 Planning Area 0-2: INSTITUTIONAL DEVELOPMENT STANDARDS Although Planning Area 0-2 is owned by Redlands Unified School District and may not be subject to the requirements of this Specific Plan, limited development standards and design guidelines are provided to serve as recommendations for future development and improvements. Planning Area 0-2 is designated as Institutional. If a use other than Institutional is ever proposed, Planning Area 0- 2 will have a default land use of Low Density Residential. Development standards regulate new development by establishing standards that control site configuration (i.e., lot size and setbacks from adjacent streets and uses), and building form (i.e., density and intensity, and building heights). Development standards based on the Institutional- Health Care (I-HC) designation in the Loma Linda Zoning Code (Municipal Code 17.44.040) are applied to Planning Area 0-2 as shown in Table 4-2. See Section 4.4.31 for certain deviations from building setbacks, building height, and the floor-area-ratio (FAR) standards shown below. Type Minimum Maximum SITE CCONFIGURATION REQUIREMENTS Lot Size None None Lot Width 100 ft None Building Lot Coverage 50% None SETBACK REQUIREMENTS From Mission Rd. 25 ft None Front 25 ft None Side - Abutting Parcel Zoned for Residential 2 ft None Side - Abutting Parcel Zoned for Non- Residential 10 ft None Side – Abutting Street 25 ft None Rear - Abutting Parcel Zoned for Residential 20 ft None Rear - Abutting Parcel Zoned for Non- Residential 10 ft None BUILDING DENSITY / INTENSITY Non-Residential None .5 FAR BUILDING HEIGHTS Non-Residential None 3 Stories and 35 Feet SPECIAL REQUIREMENTS The following requirements shall apply to new development within Planning Area 0-1. 1. Vehicular Access: Vehicular access to Planning Area 0-2 is encouraged from both Park Avenue and Citrus Avenue. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-84 4.5 - DESIGN GUIDELINES 4.5.1 - Introduction 4.4.1(a) - Overall Design Theme for THE GROVES Design will be play a crucial role in implementing the Vision for THE GROVES at Loma Linda. The layout of blocks, site design, architectural character, outdoor spaces, landscaping, and views will contribute to the overall sense of place that will be uniquely THE GROVES. The design guidelines draw inspiration from the rich heritage of Loma Linda, consistent with the Historic Mission Overlay District ordinance adopted by the City. The architectural and landscape design guidelines are influenced by historic uses in the project area including a Mission storehouse, a Native American village, a Mexican rancho, Mormon settlements, and early citrus farming. Construction of the Mill Creek Zanja irrigation ditch, completed in 1820, was fundamental to initiating development and agriculture in the area surrounding what will soon be THE GROVES community. The single-family and multi-family residential neighborhoods will feature a complementary mix of modern interpretations of the historical architectural styles typical of the Loma Linda community, including Mediterranean Revival, Craftsman, Prairie, Monterey, and Italianate architecture. These styles are echoed in the Mixed Use and Non-Residential guidelines, in addition to other commercial styles including Art Deco, Streamline Moderne, and Googie style architecture. The community theme for THE GROVES is further expressed through the landscape elements, which include entry monumentation that identifies the Historic Mission District and parks that are designed to include historic references. Working in concert, Building Design Guidelines and the Landscape Design Guidelines will create an overall thematic design that embraces and reflects the historic character of Loma Linda and ensures a quality community. The Site Design Guidelines will further guide the layout of Planning Areas and how uses should work together to create great places within THE GROVES. 4.4.1(b) - Purpose and Intent The Design Guidelines are intended to provide: x Direction to developers, builders, engineers, architects and landscape architects for the design of precise development plans; x Guidance for city decision-makers in reviewing and approving future projects; x Consistency in expression among architectural and landscape architectural components as projects develop incrementally overtime; x Consistency with the Historic Mission Overlay District; x Reasonable flexibility in the final design of homes, non-residential uses, and parks; x Direction for building placement and orientation to shape the character of the area and ensure visually interesting, active streets for pedestrians and bicyclists; THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-85 x Be responsive to community values for development and the elements that create community: trails, parks, outdoor gathering areas, and preservation of natural and historic resources; and x A strong sense of community identity through the design of public spaces, streetscape treatments, and entry monumentation, which work in concert with the building architecture. 4.5.2 - Site Design The layout of buildings, entries, parking lot or garages, open spaces, and pedestrian and vehicular circulation within a site or Planning Area strongly influences the quality of the environment and desirability of the place to either live, work, shop, dine, relax or play. The following guidelines shall apply in the layout of a large site or Planning Area. 4.5.2(a) - Block Structure and Access Within each Planning Area, a new system of roads and/or private drives will be designed to support the planned development and provide connectivity to the backbone arterial system. This road/private drive network will result in a block structure that influences interconnectivity, walkability, and building types that can be developed. As future Planning Areas are subdivided into blocks, it is the City’s objective to achieve: x An interconnected network of streets composed of smaller blocks that create a walkable grid pattern. The Very-Low Density designation is an exception to this guideline. x Longer blocks should incorporate pedestrian pass-throughs or paseos. x Vehicular access to each site must be designed to minimize conflicts between pedestrians, cyclists, autos, and service vehicles. Entrance and exit points should be well marked with streetscape and landscape features. x Where new streets cross pedestrian and bicycle paths, high visibility crosswalks should be provided. 4.5.2(b) - Building Placement and Orientation Building placement and orientation have a large impact on the way people experience a site in terms of comfort, feeling of safety, views, and exposure to wind and sun movements. Visually interesting buildings that are oriented to the street shape the area’s character as well as the visitor’s experience. For commercial and mixed-use development, placing buildings closer to the public street edge, and placing most of active ground floor uses on the same frontage all contribute to making the public street more inviting to pedestrians. x Buildings should have a strong presence and encourage activity along the street frontage. Significant elements, such as clearly defined public entrances, should relate to the pedestrian scale. x Certain Planning Areas have street frontage requirements (see Figure 4.1, Community Structure Plan) and buildings should comply with the frontage type requirements defined in Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-86 the applicable Planning Area (see Section 4.4 Development Standards). Furthermore, the design of frontage should follow the guildelines provided for each frontage type in Section 4.5.3 and 4.5.4, Building Design Guidelines. x Where possible, buildings should be sited to capitalize on views of the mountains, parks, and other open space features, especially where view corridors are required as shown in Figure 4.1, Community Structure Plan. x Buildings should be oriented for energy efficiency (e.g., capture day lighting, minimize heat gain, take advantage of prevailing breezes for natural ventilation). x Plazas or outdoor common areas within a project should be located near building entrances or areas of high pedestrian traffic to ensure their use. x Building entries shall face the street and provide direct access from the sidewalk. For larger sites with multiple buildings, building entries may be oriented to face plazas, open spaces, and pedestrian pathways. x Multiple buildings on the same site should be designed and grouped to provide a cohesive, visual relationship among the buildings, with a well-connected system of pedestrian walkways, plazas, and other open space features. x For single-family residential, variation in front setbacks is strongly encouraged to create variety and interest along the street. 4.5.3 - Building Design Guidelines for Residential 4.5.3(a) - Mix Requirements for Elevations and Floor Plans To encourage a diverse and visually interesting street scene, single-family neighborhoods within THE GROVES community shall comply with the following plotting requirements: x Neither the same floor plan nor the same elevation style shall be plotted next to itself or directly across the street from itself. “Directly across the street” shall be defined as more than half of the narrower lot overlapping with the wider lot across the street. x Single-story or recessed living area elements shall be placed on street corners. x No two homes shall be exactly alike in the very low density planning area. 4.5.3(b) - Garage Placement and Design Single-family residential structures within THE GROVES community shall pay particular attention to the design, placement, and orientation of the garages on the lots to create a varied and interesting street scene. x Avoid repetitive patterns of garage placement. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-87 x A left or right side garage shall not be plotted more than three times in a row. x Garage setback greater than the house front setback is encouraged. x Garage door details should be consistent with each architectural style. x Limit the width of front-facing garages to 65 percent of the house width. x On corner lots, garages and driveways should be sited as far as possible from the corner so as not to impede traffic flow in the street. x Where a lot is located at the end of a street, garage placement should be carefully considered in order to facilitate traffic flow in the street and ensure that headlights from vehicles on the street are directed towards the garage or other appropriate area in order to avoid nuisance from headlights in livable spaces. 4.5.3(c) - Form, Massing, and Roof Lines Building scale and mass are two primary design components that affect how a structure is perceived. The following guidelines are intended to supplement the Architectural Design Guidelines in Section 4.5.4. x Articulation of building facades, and variation in vertical and horizontal planes should be used to reduce the visual mass of a building. x Roof forms of each building should use simple geometries that are appropriate to the architectural style and conducive to solar collection. x High quality roof materials, colors, and treatments should correspond to the individual character or style of the home or building. x To avoid a monotonous roof lines within a neighborhood, incorporate articulating elements such as roof overhangs, canopies, and other entry features to add interest. x General massing should vary noticeably among different floor plans. x Massing variation should be used together with variable setbacks to create visual interest along the street. 4.5.3(d) - Architectural Details x For corner lots, the architecture should wrap around the building. In addition, where appropriate, the garage should be turned to accommodate a side entry. x Special design features such as covered front porches, front courtyards, enhanced window and door trims, extended overhangs, and building edge treatment are encouraged as appropriate to the architectural style. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-88 x Style-appropriate grates, shutters, and tile surrounds are encouraged. x Windows should be designed in accordance with the architectural style. Highly reflective glazing is prohibited, and windows should be recessed a minimum of two inches. x Front door details should vary according to architectural style. Doors should be protected by a deep recess, porch, or other covered elements. x At least two photosensitive carriage lights that vary according to architectural style are required per house. 4.5.3(e) - Colors and Materials x Buildings shall use durable, high quality materials to develop long-lasting residences. x The finishes and textures should be compatible with the proposed architectural character of the building. x Individual single-family homes should not have identical color schemes adjacent to one another or across the street from one another. x A minimum of three colors is required for each elevation such as one field color, one trim color, and one or two accent colors. x A variety of color palettes for single-family homes is required. Color selection should be based on historical precedents for each of the allowed architectural styles. Different variations of beige do not satisfy the intent of this guideline. x Natural stone, approved manufactured or cultured stone, painted or natural brick, precast concrete, tile, and fire-resistant horizontal or vertical wood siding or manufactured siding are encouraged. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-89 4.5.3(f) - Building Frontage for Multifamily Residential Table 4.2 to 4.9 identify ground floor frontage types required for key street segments within the plan. Frontage type addresses the design elements of the building’s ground floor front façade and the area in front of it extending to the street. It is an important element of urban design because it is the way a building engages the public realm. The arrangement and design of building frontages largely determines the character of the area and the quality of the pedestrian environment. 4.5.3(g) - Residential Architectural Styles The architectural styles selected for THE GROVES at Loma Linda reflect the historic architecture prevalent in the region and are consistent with the Historic Overlay of the General Plan. The styles selected from the Historic Mission Overlay District include: Mediterranean Revival, Craftsman, Prairie, Monterey, and Italianate. Other styles, such as Modern Farmhouse or California Ranch, may be considered by the City and the Historic Commission; however, a General Plan Amendment may be required. Authenticity of style is a key to achieving a high-level of design quality. An accurate interpretation of the characteristics of each style is important. Simple massing and roof forms often lead to the most authentic expression of a style. The following guidelines regarding architectural styles shall be applied to all single-family and multifamily homes within The Grove: x Architectural styles should be accurate and appropriate for the building typology (e.g., row towns, courtyard building, single-family homes, etc.) x Architectural elements forming an integral part of the building should be used and ornamentation and features that appear to be inauthentic or tacked on shall be avoided. x Visual interest along streetscapes is to be achieved through the inclusion of a variety of architectural styles within a neighborhood. x The mix and placement of home styles along a street should be given attention to create variety and avoid the monotony of one style dominating the streetscape. x Contemporary interpretations of each style are allowed. The photographs provided in these architectural styles below are offered as general visual aids in understanding the basic intent of the design theme and its key implementing elements. These design components are communicated through a palette of characteristic architectural details, materials, and colors, which work together to shape the detailed design plans. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-90 THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-91 Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-92 THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-93 Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-94 4.5.4 - Building Design Guidelines for Mixed Use and Commercial 4.5.4(a) - Façade Design and Composition Façade generally refers to a building’s external wall which faces a public street or open space. The design and composition of façades involves the arrangement of architectural elements such as doors, windows, balconies, caps, and pilasters on the walls of buildings. The façade and ground floor of a building is the most visible component seen by pedestrians, bicyclists, and motorists. How the mass of the building “meets the street” should be well detailed. The design of the facade is what humans experience most intimately when on the sidewalk and is the biggest contributor to district character. x Buildings shall have a clear base, middle, and top by providing horizontal differentiating treatment. The base shall visibly anchor the building to the ground and the eave or parapet shall provide a visual termination of the building. x All sides of a building visible from a public street, paseo or open space should maintain the same level of architectural detail and visual quality used on a front façade to the extent possible. x The façade detailing of mixed-use buildings shall visually differentiate ground-floor uses from upper-story uses. The façade detailing of commercial or retail entries shall be differentiatex from residential entries. x Exterior building walls should have variation, recesses, and offsets in the surface especially at entries and important gateways. Long building walls shall be attractive and visually interesting by applying changes (by 2 to 4 feet to be read as a substantial change and provide a significant shadow line) in surface materials, colors, massing, fenestration, THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-95 storefronts, public art, or other architectural elements that are well composed. Pilasters or breaks in the wall plane are allowed where appropriate. x Large expanses of walls at the non-street facing sides of buildings (less public) may also integrate murals, trellises, or vines and espaliers to add texture and create visual interest. x Live-work or shopkeeper units should be designed to appear like a commercial storefront, gallery, or urban light industrial compatible to the area it is most affiliated with in character. 4.5.4(b) - Materials and Colors The colors and materials of buildings can effectively create a streetscape of interest when applied appropriately and in partnership with façade modulation. The use of quality materials not only last longer and wear better but also preserve the quality of the public realm. x Buildings shall use durable, high quality materials to develop long-lasting buildings that can be adaptively reused over time. x Architectural style and use of quality materials shall be consistent throughout the entire project; however, variations in materials and details may be used to differentiate between the residential and commercial portions of the project. x The finish, texture, and color of materials should be compatible with the proposed architectural character of the building. x Materials may vary in the vertical plane. Buildings shall exhibit greater detail and higher quality materials at the lower levels. x Materials and colors should be used to imply form changes, particularly for entrance lobbies, massing changes, and different uses or tenants. x Construction details should be authentic and applied with consistency. x Stucco finishes are acceptable, provided the stucco finish is smooth, rather than textured, lace, or rough sand finish. 4.5.4(c) - Architectural Details Windows and Doors Windows, the main source of natural light and fresh air into buildings, should be designed to maximize the light that enters and to take advantage of natural ventilation. x Buildings should be designed with a rhythm of windows and entrances that provide interest and engage pedestrians. x Commercial windows and doors should comprise at least 60 percent of a building’s street level façade. x For residential, to prevent residential wall surfaces from Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-96 being monotonously flat, windows and doors shall be recessed at least 3 inches from the face of the finished exterior wall to achieve a sufficient depth and shadow reading. Flush finish installations, especially with stucco, are not desirable. x Detailing of windows and doors should reflect the overall design idea of the building and be well crafted and constructed. Roofs x The roof or overhang shall enhance the architectural character of the building. The extent and type of roof detail should be appropriate to the architectural style. x Roof drains should be designed as an integral part of the structure. x Rooftop and other building mechanical equipment should be screened from public view and be housed within a penthouse structure that is consistent with the building’s architectural style. Awnings, Canopies, and Ma rquees Encroachments such as awnings, canopies, and marquees are encouraged but must be well designed and proportioned so they do not adversely impact the sidewalk environment. Canopies and awnings are encouraged along all retail street frontages. x The minimum vertical clearance between the ground or street level and the encroachment should be 8 feet. In areas of zero setbacks, awnings, canopies, and marquees should not project more than two-thirds the width of the sidewalk, subject to the California Building Code. At least 2 feet of clearance must be maintained from the street curb line. x Awnings or canopies that are designed to require ground support are prohibited on sidewalks. In areas where setbacks are required, awnings, canopies, and marquees should not project past the setback line. x Horizontal dimensions should relate to the bays of the building façade. x For awnings and canopies, the materials, shape, rigidity, reflectance, color, lighting, and signage should relate to the architectural design of the building. 4.5.4(d) - Building Frontages for Mixed-Use and Commercial Table 4.2-4.9 identifie ground floor frontage types required for key street segments within the plan. Frontage type addresses the design elements of the building’s ground floor front façade and the area in front of it extending to the street. It is an important element of urban design because it is the way a building engages the public realm. The arrangement and design of building frontages largely determines the character of the area and the quality of the pedestrian environment. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-97 Design guidelines for all the frontage types identified for THE GROVES are located on the following tables. Table 4.2 - Shopefront Frontage Type Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-98 Table 4.3 - Forecourt Frontage Type THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-99 Table 4.4 - Gallery Frontage Type Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-100 Table 4.5 - Arcade Frontage Type THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-101 Table 4.6 - Terrace Frontage Type Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-102 Table 4.7 - Stoop Frontage THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-103 Table 4.8 - Porch Frontage Type Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-104 Table 4.9 - Yard Frontage Type THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-105 4.5.4(e) - Mixed-Use and Non-Residential Architectural Styles The Historic Mission Overlay District defines the historical architectural styles that can be used within THE GROVES. For vertical mixed-use projects with residential above commercial, adaptations of the residential architectural styles identified in Section 4.5.3, above, are allowed. For stand-alone commercial development, adaptations of the any of the historic styles defined in the Historic Mission Overlay District are allowed. In addition, Art Deco, Art/Streamline Moderne, and Googie/50’s style architecture is allowed. “Franchise” architecture is not allowed and must be adapted to one of the allowed architectural styles. 4.5.4(f) - Signage Signage within the Commercial and Mixed Use Planning Areas should harmoniously blend with the architectural theme. Artistic flexibility is allowed; however, signage should maintain continuity and be of appropriate scale with the adjacent structures, and the community as a whole. Applicable provisions of the Loma Linda Municipal Code, Chapter 17.18, Signs, apply within THE GROVES community. Specifically, signs within the Commercial and Mixed Use Planning Areas shall conform to the Loma Linda Municipal Code, Section 17.18.140, Permitted signs—C-1, C-2, C-G, C-F, C- N, C-M, I-C and M-R zones, and the following guidelines. x Sign types are limited to project identification, company and building identification, direction, and temporary “for sale and lease” signs. x If businesses are located in a traditional downtown pattern, signage should be designed to be visible both to drivers on the street and pedestrians on the sidewalk. x In the case of a large development designed with “campus” style building orientation, signage for anchor tenants should be visible from the parking area(s) and a map with store directory should be provided to aid in wayfinding. x Signage within a “campus” style development should be pedestrian oriented in size, placement, and design. x Signs should be compatible with the building in terms of color, material, and placement, yet stand out in a way that enables easy recognition of the sign. x All ground-mounted signs should be well integrated into site landscaping, while assuring readability by drivers and pedestrians. The visible backs and sides of signs should be architecturally treated to blend with the exterior character of the building. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-106 4.5.5 - Functional Elements These provisions for functional elements apply to all land uses within THE GROVES. Examples of functional elements include loading doors, service areas, ground or wall-mounted equipment, rooftop equipment, and trash enclosures. The design and placement of these elements should minimize their prominence when viewed from surrounding development, public roadways within and adjacent to the community, pedestrian sidewalks, and parking lots. 4.5.5(a) - Loading Doors and Service Areas Service vehicles should have clear and convenient access into and within the Mixed Use and Senior Housing Planning Areas to minimize disruptions to vehicular and pedestrian circulation. Service and delivery/loading areas should be separated from general parking areas and pedestrian circulation areas (walkways, pathways, etc.). Loading doors, service areas, and equipment areas should be oriented or screened so they are not easily visible from residential areas and public roadways within and adjacent to the community. Screening may be accomplished with landscaping, walls, fences, or other architectural treatments. For screening of loading and service areas to be effective, a minimum treatment height of 6 feet is recommended. 4.5.5(b) - Ground or Wall-Mounted Equipment Examples of exterior ground-mounted equipment include, but are not limited to, mechanical equipment, electrical equipment, emergency generators, cellular telephone facilities, and satellite dishes. Ground-mounted equipment should be screened so as to not be visible from residential areas and public roadways within and adjacent to the community. Screening may be accomplished with walls that are designed as an integral part of the architecture or landscape elements that are consistent with the landscape concept. Electrical equipment rooms should be located within the building envelope. Pop-outs or shed-like additions are prohibited unless fully integrated into the building architecture. Wall-mounted items, such as roof ladders or electrical panels, should be located away from the street façade and painted, screened, or incorporated into the architectural elements of the building so as not to be visually apparent from residential areas and public roadways within and adjacent to the community. 4.5.5(c) - Rooftop Equipment Examples of rooftop equipment include mechanical equipment, electrical equipment, cellular telephone facilities, satellite dishes, skylights, vents, exhaust fans, and mechanical ducts. Mechanical equipment for single-family residences such as air conditioners, heaters, evaporative coolers, and other such devices should not be mounted on the roof. These types of equipment should be located behind privacy walls or landscape. All rooftop equipment for other types of buildings should be screened so as not to be visible from residential areas and public roadways within and adjacent to the CITRUS TRAILS community. Rooftop THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-107 screens should be integrated into and complement the architecture of the building. Wooden rooftop screens are prohibited. Solar panels may be mounted on building rooftops and are exempt from the rooftop equipment provisions related to visibility. 4.5.5(d) - Trash Enclosures Refuse collection areas (trash enclosures) should be located away from residences to minimize nuisance, when possible. In addition, refuse collection areas should be located behind or to the side of buildings, away from the building’s main entrance. All outdoor refuse containers should be screened within a permanent, durable enclosure. The design of the enclosure should reflect the architectural style of adjacent buildings and use similar, high-quality materials. Landscaping or trellis work should screen enclosures visible from a residential area, connecting walkway, or street and shall be permanently maintained. 4.5.5(e) - Vehicle Charging Stations In single-family residential neighborhoods, vehicle charging equipment shall be fully enclosed within the garage. 4.5.6 - Landscape Design Guidelines 4.5.6(a) - Introduction The Landscape Design Guidelines articulate the various landscape design components of THE GROVES, which draw inspiration from the rich heritage of Loma Linda. The landscape concept is influenced by the Mill Creek Zanja irrigation ditch and the historic uses that it enabled, which include: a Mission storehouse, a Native American village, a Mexican rancho, Mormon settlements, and early citrus farming. The landscape concept evokes the landscape theme through elements including entry monumentation that identifies the Historic Mission District and the historically themed parks and paseo. The Landscape Design Guidelines are also consistent with the Citrus Trails Master Plan. The landscape concept is established through the combination of each of the major thematic community elements listed below, which are discussed in more detail on the following pages. x Plant Palette x Entry Monumentation x Corner Treatment x Streetscapes x Walls and Fences x Landscape Interfaces The Landscape Design Guidelines, together with the Architectural Design Guidelines, establish a clear and coherent community identity that is indicative of the area’s past, visually appealing, and sensitive to the environment. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-108 4.5.6(b) - Plant Palette The Plant Palette for THE GROVES was selected to complement and enhance the setting of the community, while ensuring the conservation of water resources. The palette of tress and shrubs have been chosen to reflect the site’s rural setting and accentuate the community’s architectural styles and design elements (entry monumentation, walls and fences, etc.). To ensure the conservation of water resources and to alleviate long-term maintenance concerns, the Plant Palette is comprised of water-efficient species native to southern California or naturalized to the arid southern California climate. Furthermore, the Plant Palette is intended to work in concert with the hardscape materials to reinforce the landscape concept at major community focal points and gathering places, such as the parks and paseo. Table 4-10, Street Tree Palette, and Table 4-11, Shrub and Vine Palette, provide lists of the plant materials selected for THE GROVES. These provide a base palette for the community’s landscape design; other similar plant materials may be substituted provided the selected plant materials are water-efficient, complement the overall landscape concept, and are approved by Public Works. Plant selection for specific areas of the community shall have similar watering requirements so that irrigation systems can be designed to minimize water use and plant materials can thrive under optimal conditions. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-109 Table 4.10 - Street Tree Palattee Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-110 THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-111 Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-112 Table 4.11 - Shrub and Vine Palette BOTANICAL NAME COMMON NAME Abelia g. 'Edward Goucher' Pink Abelia Agave attenuata Fox Tail Agave Aloe arborescens Tree Aloe Anigozanthos flavidus 'Bush Ranger' Dwarf Kangaroo Paw Berberis thunbergii 'Golden Ring' Japanese Barberry Bougainvillea sp. Bougainvillea Buxus microphylla japonica Japanese Boxwood Caesalpinia gilliesii Desert Bird of Paradise Callistemon 'Little John' Dwarf Bottlebrush Cistis purpureus Orchid Rockrose Dalea greggii Trailing Indigo Bush Dietes vegeta Fortnite Lily Distictus buccinatoria Blood Red Trumpet Vine Escallonia x 'Compacta' Compact Escallonia Festuca mairei spp. Atlas Fescue Hemerocallis hybrid Evergreen Red Daylily Lavandula angustifolia English Lavender Lavandula spp. Lavender Lavatera bicolor Tree Mallow Leuciphyllum frutescens Texas Ranger Ligustrum japonicum Japanese Privet Liriope muscari Big Blue Leaf Turf Macfadyena unguys-cati Cat's Claw Muhlenbergia rigens Deer Grass Myoporum parvifolium Prostrate Myroporum Myrsine africana African Boxwood Myrtus communis 'Compacta' Dwarf Myrtle Nandina domestica Heavenly Bamboo THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-113 BOTANICAL NAME COMMON NAME Parthenocissus tricuspidata Boston Ivy Photinia fraseri Photinia Rosa species Rose (Hybrid) Salvia celcelandi Cleveland Sage Salvia greggii Dwarf Ciyite Bush Salvia leucantha Mexican Bush Sage Trachelospermum jasminoides Star Jasmine Westringia rosmarinafolius Coast Rosemary 4.5.6(c) - Entry Monumentation Conceptual entry monumentation has been prepared for THE GROVES. Entry monumentation for residential or mixed-use neighborhoods is intended to establish a strong sense of arrival for residents, guests, patrons, and passersby. The monumentation concept for primary entries into The Grove from California Street or Redlands Boulevard has been designed to reinforce the community theme and should include text identifying the “Historic Mission District” in addition to the name of the community mixed-use area (as illustrated in Figure 4.2). Locations for entry monumentation have been included in Figure 4.1, Community Character Map, and include locations at main entrances into THE GROVES. In addition, smaller entry monuments for individual neighborhoods are also allowed and can be adapted from the monumentation shown in Figure 4.3, Other Entry Monument. Smaller neighborhood monumentation may have a unique design that reflects the character of the project. Entry Monuments at Orange Avenue and Citrus Avenue (Concept A) Conceptual entry monumentation are located on California Street at Orange Avenue and Citrus Avenue entrances. It conveys to the users that they have entered THE GROVES. The entry monument is a combination of pilaster and monument wall with a major signage feature. Figure 4- 2, Entry Monument, illustrates the conceptual design for the monument, which is accompanied by public art sculptures, as discussed in Section 3.5.2 (b), Historic Resources. The design may be stand-alone or located on a residential perimeter wall, and may vary in size based on locational constraints and project design. Other Entry Monuments (Concept B) Other entry monuments either along California Streets, Redlands Boulevard, or within THE GROVES may be adapted from Figure 4-3, Other Entry Monument. The conceptual design includes a free- standing, 4-foot high natural stone monument, a granite-faced sign area, and a backdrop of California fan palms. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-114 Figure 4.2 - Entry Monument (Concept A) THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-115 Figure 4.3 - Other Entry Monument (Concept B) Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-116 4.5.6(d) - Corner Treatment Figure 4.1, Community Structure Plan, identifies several locations where special attention is required at the corner of the property. These locations are at the major entrances to THE GROVES. The design of the corner, in addition to any monumentation, is an essential element in branding the area. Figure 4-4, Corner Treatment shows some examples of the corner treatment. Buildings shall have a major presence at the corner to enhance the pedestrian experience and create character and appropriate massing along the roadway. This may include two buildings at the corner that “frames” the view into the site, or a single building with special architectural features such as: x Diagonal or curved walls at the corner x A tower element, spire or dome that can be a landmark or orientation point x A corner plaza or gathering area x A lobby canopy, overhang, or other architectural covering over the building entry x A two (2) story entrance height and twenty (20) foot entrance width x A public art installation x Decorative landscaping or landmark element such as a row of columnar trees x Corner entrance or an entrance oriented toward each adjacent street Figure 4.4 - Corner Treatment THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-117 4.5.6(e) - Streetscape Landscaping The design of roadway streetscapes are critical in enforcing a circulation hierarchy, creating a sense of place, and maintaining a high-quality community theme. The scale and proportion of the street scene reflects the street hierarchy and provides separation of vehicular and pedestrian travel. Larger streets contain larger parkways and are more extensively landscaped; in contrast, local roads are planned with slightly narrower parkways and less prominent landscaping. Varied streetscapes are intended to create a high quality, visually pleasing experience at the pedestrian and vehicular level. Streetscapes are planted with a combination of street trees, low shrubs, and masses of groundcover derived from the tree and shrub/vine palettes, providing visual continuity throughout the community. Streetscapes within THE GROVES are provided as follows: California Street Streetscape- Four-lane Undivided Roadway (144 - 152’ ROW) California Street serves as the eastern boundary of THE GROVES community. As depicted on Figure 4-5 and 4-6, the streetscape design buffers the single-family residences that back on to California Street, while the streetscape design north of Citrus Avenue complements the pedestrian oriented layout of the Mixed Use Planning Areas adjacent to California Street. California Street south of Citrus Avenue provides a 25-foot wide parkway that includes a 10-foot wide decomposed granite trail flanked on the west by a 6-foot high community theme wall planted with vines and on the east by Jacaranda mimosifolia and accent trees, shrubs, and groundcover. A 5-foot wide concrete sidewalk is located adjacent to the curb and an on-street painted bike lane is provided on California Street. The streetscape design for California Street north of Citrus Avenue complements the pedestrian oriented Mixed-Use planning areas. The streetscape includes a 9.5-foot wide curb-adjacent landscaped parkway planted with Jacaranda mimosifolia trees with a parkway-adjacent 15-foot wide hard surface trail, which provides for a wider walkway or space for outdoor dining to enhance the pedestrian orientation of the adjacent private properties. Redlands Boulevard Streetscape – Modified Four-lane Divided Roadway (102’ ROW) Redlands Boulevard serves as the northern boundary of the Specific Plan area and is developed as a 102-foot wide public right-of-way. As illustrated on Figure 4-7, the street includes a 13-foot wide parkway on the south side of the street. The parkway is planted with Pinus pinea trees and includes a 5-foot wide meandering sidewalk. Mission Road Streetscape – Two-lane Divided Roadway (84 - 104 ROW) Mission Road is located along the southern edge of THE GROVES and facilitates access to the properties adjacent to it within the Specific Plan area. As depicted on Figure 4.8, there will be a 22- foot wide parkway including a 10-foot wide meandering decomposed granite trail on the north side of the street. The 10-foot trail is intended to be an extension of the Zanja Trail provided within South Park. The trail will connect to Heritage Park and the historic uses within the park. The parkway landscaping includes street trees and drought-tolerant shrubs and groundcover. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-118 Park Avenue Streetscape - Entry Road (88’ ROW) Park Avenue is a primary access from into THE GROVES from California Street. It is designed as an 88-foot wide right-of-way that provides an aesthetically pleasing, pedestrian-friendly experience. As shown on Figure 4-9 to 4-12, there will be four different configurations for Park Avenue. 1. Adjacent to Planning Areas 2-5 and 2-7, Park Avenue is developed with 12-foot wide landscaped parkway including 5-foot wide inset sidewalks on both sides of the street. 2. The north side of the street adjacent to Planning Areas 2-3 and 2-4 provides a 12-foot wide parkway including an inset 5-foot wide sidewalk. The south side of the street adjacent to North Park (PA2-6) features a 12-foot wide landscaped parkway with an adjacent 10-foot wide decomposed granite trail that meanders into the parkway in lieu of a sidewalk. 3. Adjacent to Panning Area 3-3 and 3-4, the 10-foot wide devomposed granite trail will be developed on both sides of street. 4. Park Avenue west of Bryn Mawr Avenue, 5-foot wide sidewalk will be on the south side and a 10-foot wide decomposed granite trail will be developed on the north side. A 13 feet trail easement will be developed betwee Park Avenue and Planning Area 1-1. The parkways feature street trees underplanted with shrubs and groundcovers that are native to southern California or naturalized to the southern California climate. Citrus Avenue Streetscape - Entry Road (64’ ROW) Citrus Avenue provides primary access to the single-family areas in THE GROVES, as well as Central Park and North Park. As illustrated on Figure 4-13 and 4-14, the north side of Citrus Avenue provide a 20-foot wide travel lane and 12-foot wide landscaped parkway, including a 5-foot wide inset sidewalk. The south side of the street features a 12-foot wide landscaped parkway with an adjacent 10-foot wide decomposed granite trail that meanders into the parkway in lieu of a sidewalk. Adjacent to Planning Area 3-4 and Planning Area 3-6, 10-foot wide decomposed granite trail will be developed on both. The landscaped parkways feature street trees with shrubs and groundcovers. Orange Avenue Streetscape (88’ ROW) Orange Avenue connects with Mission Road to provide access to the residences within the southern portion of community. As depicted on Figure 4-15 to 4-17, the streetscape provides 5- foot wide curb-adjacent sidewalks within 12-foot wide parkways on both sides of the street; however, adjacent to South Park, a 10-foot wide decomposed granite trail that meanders from the park into the parkway is provided in lieu of a sidewalk. On the north side of Orange Avenue near California Street, the landscaped parkway merges with the front yard landscaping of the adjacent single-family residences. On the south side of the street, a 6-foot high masonry screen wall located next to the parkway at the edge of the right-of-way buffers the adjacent residences from the street. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-119 Bryn Mawr Streetscape (118’ ROW) Bryn Mawr provides north and south connections from Redlands Boulevard to Citrus Avenue. It is a 4-lane divided corrector street with a 20-foot raised median. As depicted on Figure 4-18, the west side of the street provides a 12-foot wide landscaped parkway, including a 5-foot wide inset sidewalk. The east side of the street features a 22-foot wide parkway with a 10-foot wide meandering decomposed granite trail. Internal Main Street (86’ ROW) Internal Main Street will be planned to support commercial and mixed use development on Planning Area 1-2, Planning Area 3-3 and Planning Area 2-1. As depicted on Figure 4-19, it features with two undivided travel lanes and diagonal parking on both sides. The parkway is replaced with a 15-foot wide sidewalk and an amenity zone for street furniture, tree grates. The building is located near the street right-of-way. Local Road Streetscape (60’ ROW) To provide vehicular access to individual neighborhoods, a network of Local Roads is provided. Within the 60-foot wide public right-of-way, Local Roads feature 12-foot wide landscaped parkways including 5-foot wide curb-adjacent sidewalks on both sides of the street, as indicated on Figure 4-20 and 4-21. The landscaped parkways are planted with street trees and groundcovers that complement the community’s landscape theme and merge with the residential front yards that face on to the street. The parkways and sidewalks provide a pleasant environment to encourage pedestrian circulation within the community. Where Local Roads are located adjacent to North Park, Central Park, or South Park, 10-foot wide decomposed granite trails located at the edge of the parks meander into the right-of-way in lieu of sidewalks. Where Local Roads are situated adjacent to the pedestrian Paseo, which provides a 27 to 40-foot wide alignment connecting North Park to South Park , the 7-foot wide parkway on the western side of the Local Road merges with the adjacent landscaped Paseo to provide an attractive wide buffer from the street. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-120 California Street-Citrus North to Boundary (144’ ROW) Figure 4.5 - THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-121 California Street-Citrus South to Boundary (144’-152’ ROW) Figure 4.6 - Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-122 Redlands Boulevard (102’ ROW) Figure 4.7 - THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-123 Mission Road (104’ ROW) Figure 4.8 - Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-124 Park Avenue-Fronting Planning Area 2-6 (88’ ROW) Figure 4.9 - THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-125 Park Avenue-Fronting Planning Area 2-7 (88’ ROW) Figure 4.10 - Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-126 Park Avenue-Fronting Planning Area 3-4 (88’ ROW) Figure 4.11 - THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-127 Park Avenue-Fronting Planning Area 3-2 (88’ ROW) Figure 4.12 - Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-128 Citrus Avenue-Typical (64’ ROW) Figure 4.13 - THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-129 Citrus Avenue-Fronting Planning Area 3-4 (64’ ROW) Figure 4.14 - Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-130 Orange Avenue-Typical (64’-88’ ROW) Figure 4.15 - THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-131 Orange Avenue @ South Park/Residential Figure 4.16 - Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-132 Orange Avenue @ South Park/Mission Road Figure 4.17 - THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-133 Bryn Mawr Avenue (118’ ROW) Figure 4.18 - Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-134 Internal Main Street (86’ ROW) Figure 4.19 - THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-135 Local Street (60’ ROW) Figure 4.20 - Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-136 Paseo at Local Street Figure 4.21 - THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-137 4.5.7 - Wall and Fence THE GROVES has been designed to limit the need for block walls by orienting the residential development to face the street whenever feasible. Walls and fences are located where residential uses interface with California Street, parks, mixed use areas, or off-site land uses. A Wall and Fence Plan is not prescribed for the remainder of the Specific Plan area. However, where walls and fences are used, the following design guidelines shall apply. The walls and fencing within THE GROVES are major visual elements carefully designed to complement the overall theme. Visual cohesion is achieved through the design of “community walls” and general wall guidelines. Community walls and fences are designed as an integral component and extension of the building design and surrounding landscape. Periphery walls integrate into the adjacent structure and extend into the landscape to help integrate the building into its environment. Walls and fences feature materials, colors, and textures that are harmonious with the architecture and gates are complementary in style and color to the fence or wall. The walls and fencing are designed for easy maintenance to provide a durable, long-term edge. The types of walls and fencing allowed are described below and conceptually depicted on Figure 4-22, Wall and Fence Details. x Community Theme Split Face Block Wall: The Community Theme Split Face Block Walls shall consist of 6-foot high block walls with split-faced finish and 2-inch cap. Cobble stone- clad pilasters with concrete caps accent the theme wall at regular intervals. x Community Theme Pilaster: The Community Theme Pilasters shall consist of cobble stone veneer over a 16-inch square Concrete Masonry Unit (CMU) pilaster with a precast concrete cap similar to the existing cap found at Mission Elementary School to the north. The Community Theme Pilaster primarily occurs along the Community Theme Split Face Block Wall adjacent to California Street. x Split Face Block Wall/Steel View Fence: The Split Face Block Wall/Steel View Fences consist of a maximum 4-foot high combination fence with 18-inch high split face concrete block on the lower section and tubular steel posts with top and bottom rails on the upper section to provide for views. x Tubular Steel View Fence: The Tubular Steel View Fences provide a minimum 6-foot high barrier made of tubular steel posts, top rails, and bottom rails that allow for views. x One Sided Split Face Block Lateral Wall Return: Each single-family residence provides a block wall return separating the front yard from the private rear yard. This requirement does not apply to Planning Area 3-6, Very Low Residential, where fencing may be customized by lot. x Interior Vinyl Fence: Vinyl fencing is used along the interior property lines of the single- family residential lots. The vinyl fencing is 5-foot high and tan in color. It is designed with a tongue and groove pattern with top rails, bottom rails, and posts with domed caps. This requirement does not apply to Planning Area 3-6, Very Low Residential, where fencing may be customized by lot. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-138 x Vinyl Gate: Along the lateral wall return separating the front yard from the rear yard, each single-family residence provides pedestrian access to the rear yard via a vinyl gate. This requirement does not apply to Planning Area 3-6, Very Low Residential, where fencing may be customized by lot. Figure 4.22 - Wall and Fence Details THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-139 4.5.8 - Landscape Interface Landscape transitions between land uses are necessary to separate the variety of on-site and off- site land uses. The following conceptual landscape interfaces are to be used in guiding the site planning of individual planning areas and projects, based on the mix of uses within the planning area and the existing or future surrounding context. a. Single-Family Residential to Park Interface Figure 4-23, Interface – Single-Family Residential/Park, illustrates the interface between single- family residential uses and a park such as North Park or South Park, where rear yards of the residential lots abut the adjacent park. In this condition, a 6-foot high masonry wall should separate the residential lots from the park. Adjacent to the masonry wall, the park should contain a 20 to 40-foot landscape buffer, which includes evergreen canopy trees. The single-family residential lots may be further separated from the active areas of the park by a 10-foot wide meandering decomposed granite trail adjacent to the perimeter landscaping. b. Single-Family Residential to Mixed Use Interface Figure 4-24, Interface – Single-Family Residential/Mixed Use, illustrates the interface between low density residential land uses, such as in Planning Area 2-8 and Mixed Use land uses in Planning Area 2-9, 2-10, and 2-11. In this condition, a 6-foot high masonry wall separates the single-family residential lots from the Mixed Use Planning Areas. The Mixed Use Planning Areas require a 10 to 30-foot wide building setback, depending on the height of the Mixed Use building(s). This setback area is used to provide a landscape buffer of evergreen trees, but may also contain parking and drive aisles. c. Senior Housing to Mixed Use Interface Figure 4-25, Interface – Senior Housing/Mixed Use, illustrates the interface between the Senior Housing residential use in Planning Area 2-3 and the adjacent Mixed Use Planning Areas. Where Senior Housing and Mixed Use Planning Areas abut, no minimum building setback from the property line is required, except as specified by the Fire Department. Landscaping, parking, and drive aisles are allowed within a setback area. Pedestrian circulation between Senior Housing and the retail/services in the Mixed Use areas is facilitated by limiting the use of walls and/or ensuring adequate pedestrian access. d. Senior Housing to Water Quality Basin Interface Figure 4-26, Interface – Senior Housing/Water Quality Basin, illustrates the interface between the Senior Housing land use and the water quality basin located in the northwest corner of Planning Area 2-3. In this condition, the building(s) within Senior Housing provide a 10 to 20-foot wide (depending on the height of the buildings) landscaped setback area. The water quality basin landscaping, which will serve water quality functions, helps to provide buffering and adds visual interest. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-140 e. Mixed Use to Off-Site RV Park Interface Figure 4-27, Interface – Mixed Use/Off-Site RV Park, illustrates the interface between the Mixed Use in Planning Areas 2-1 and 2-4 and the RV park community located in Planning Area 3-7. In this condition, a 6-foot high masonry wall separates the Mixed Use Planning Areas from the off-site RV park. Within the Mixed Use Planning Areas, a 10 to 20-foot wide (depending on the height of the Mixed Use buildings) landscaped setback area that includes evergreen screen trees provides buffering between the uses. Parking and drive aisles are allowed within the setback area in the Mixed Use Planning Areas. f. Mixed Use to Off-Site School Interface Figure 4-28, Interface – Mixed Use/Off-Site School, illustrates the interface between the Mixed Use in Planning Areas 2-4 and2-5 5 and Mission Elementary School located at the corner of Redlands Boulevard and California Street. In this condition, a 6-foot high masonry wall separates the Mixed Use Planning Areas from the off-site school. Within the Mixed Use Planning Areas, a 10 to 20-foot wide (depending on the height of the building(s) in the Mixed Use areas) landscaped setback area that includes evergreen screen trees provides buffering between the uses. Parking and drive aisles are allowed within the setback area in the Mixed Use Planning Areas. On the Mission Elementary School site, landscaping, drive aisles, and a parking lot are located adjacent their western boundary, providing further buffering between the Mixed Use buildings and active student areas. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-141 Figure 4.23 - Interface-Single Family Residential Park Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-142 Figure 4.24 - Interface-Single Family Residential/Mixed Use THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-143 Figure 4.25 - Interface-Senior Housing/Mixed Use Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-144 Figure 4.26 - Interface-Senior Housing/Water Quality Basin THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-145 Figure 4.27 - Interface-Mixed Use/Off-Site RV Park Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-146 Figure 4.28 - Interface-Mixed Use/Off-Site School THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 4 44-147 4.6 - PROPERTY MAINTENANCE AND MANAGEMENT All improvements within The Groves shall be constructed to standards acceptable to the City of Loma Linda and as specified in this Specific Plan. Each developer, property owner, and/or business operator, shall be responsible for maintenance of its respective area of The Groves community, unless otherwise specifically determined here in or by the City of Loma Linda. See also Section 5.13 of this Specific Plan. 4.7 - REQUIRED REVIEW, APPROVALS AND PERMITS [In taking action on the Specific Plan, the City Council may provide direction to City staff for revisions to the Pubic Hearing Draft, dated June 2018, and for incorporation into the final adopted version of the Specific Plan. This section will be completed and finalized by the Community Development Director as directed by the City Council.] Administration of this Specific Plan shall be through the Precise Plan of Design and/or Subdivision application process as established by the Department of Community Development. Development plans to implement this Specific Plan shall be submitted to the Community Development Director to ensure that the proposed development plans comply with all provisions of this Specific Plan. All such submittals shall be accompanied by a City-approved application form, all required supplemental information materials, as well as all the applicable filing and other fees specified by the City’s adopted Fee Schedule and/or as specified in this Specific Plan. Chapter 4 THE GROVES AT LOMA LINDA SPECIFIC PLAN 44-148 This page is intentionally left blank. IMPLEMENTATION 5 THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 5 55-1 Chapter 5 - Implementation and Administration This Chapter contains the procedures for administration of the provisions included herein, including procedures for amendments if needed. Other information covered in this Chapter pertains to general administration, permitting, monitoring, reporting, amendment procedures, and the linkage between and among these elements. This Chapter also provides discussion of this Specific Plan’s relationship to the General Plan, the Loma Linda Municipal Code (LLMC) (including Title 17, Zoning) and other regulatory codes, and consistency with such. The City of Loma Linda will work toward the effective and efficient implementation of the Specific Plan. Decisions with regard to permit applications and improvements within THE GROVES shall be guided by this Specific Plan, including its Development Plan (i.e., land use concept, open space and recreation plan, etc.), development standards and landscaping guidelines. Specific Plan implementation will be reviewed by the Director of Community Development, the Director of Public Works, the Fire Chief and/or the City Council, as indicated below. 5.1 - GENERAL PLAN CONSISTENCY California state law requires a Specific Plan to be consistent with the corresponding General Plan. The Loma Linda General Plan land use designation for the Specific Plan area is Special Planning Area D (SPA-D). The General Plan intends that SPA-D be characterized by horizontal and vertical mixed uses, including commercial, office, structured parking and high-density residential, developed along the frontages of Redlands Boulevard and California Street. Single-family, medium-density residential (multi-family) and recreational uses are intended within the central, western and southern portions of the Planning Area. The General Plan’s vision for SPA-D is as a “livable, walkable community” with a high level of amenities for residents, including parks, trails/paseos, and other recreational uses, while also exhibiting a high level of design quality Adoption of the Specific Plan as a comprehensive plan for the future development of THE GROVES maintains the current land use relationships and establishes appropriate development standards and guidelines to ensure that development of THE GROVES will occur in a manner consistent with the guiding policies of the City’s General Plan. Specific General Plan policies that THE GROVES Specific Plan will implement and/or facilitate are provided in Appendix B. Projects and/or development/land use activities which are found consistent with this Specific Plan will be deemed consistent with the City’s General Plan and its adopted elements and policies. Chapter 5 THE GROVES AT LOMA LINDA SPECIFIC PLAN 55-2 5.2 - RELATIONSHIP TO CITY ZONING CODE THE GROVES is zoned predominantly Planned Community (PC), which is intended to accommodate flexibility in development, encourage creative and imaginative design, and provide for development of parcels of land as coordinated projects involving a mixture of residential densities and housing types, community facilities both public and private and commercial areas. The PC zone allows for creation of unique use regulations and development standards for a development project, provided the regulations and standards clearly implement general plan policy and subsequent project proposals under the planned community zone reflect the character envisioned by the city at the time of planned community zone approval. Consistent with the intent of the PC zone, THE GROVES Specific Plan establishes the unique use regulations and development standards, consistent with General Plan policy, for future development projects within the Specific Plan boundary. The PC also can be used to implement the special planning area designation established under the General Plan. THE GROVES also includes three planning areas not zoned as PC, but having other “special purpose” zoning. This includes Planning Areas (PA) 0-1 and 0-2, both currently owned/managed/occupied by the Redlands Unified School District (RUSD). Both of these PAs are zoned Institutional-Health Care (I-HC), which accommodates educational institutions consistent with the RUSD’s purpose. PA 3-1, which is represents city-owned/managed Heritage Park, is zoned Open Space (OS). The nature of THE GROVES, and its origin and role as a “special planning area,” necessitates and justifies some deviation from certain zoning development standards that are required for more traditional non-planned community developments or uses, especially those that are oriented to singular uses. This Specific Plan establishes site-specific standards that are appropriate to shape the General Plan’s vision for a “livable, walkable community” offering integrated mixed uses and a high level of amenities for residents, while also exhibiting a high level of design quality Except as specifically addressed in this Specific Plan, development and operation of THE GROVES is subject to all other development standards of the LLMC. Where Specific Plan regulations differ from provisions of the LLMC, this Specific Plan supersedes those provisions. When an issue, condition or situation occurs that is not covered or provided for in this Specific Plan, the regulation(s) of the LLMC that is most applicable to the issue, condition or situation shall apply. This Specific Plan, when adopted by ordinance, becomes the Plan that serves as the planning document for THE GROVES and establishes the use-specific regulations for future development and land use activities within the Specific Plan area. All other City codes and ordinances shall continue to be applicable, unless expressly superseded by the terms of this Specific Plan or unless they are inconsistent with this Specific Plan, in which case they are superseded. THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 5 55-3 5.3 - SPECIFIC PLAN INTERPRETATION The Community Development Director shall have the responsibility and authority to interpret the provisions of this Specific Plan when there is a need for clarity in the meaning of its regulations. If there is a conflicting requirement for building standards in regards to uniform building code, the most stringent standard will prevail. All such interpretations shall be reduced to written form and permanently maintained as part of the Specific Plan record. 5.4 - COMPLIANCE WITH GOVERNMENT CODE All development, construction, operations and maintenance within THE GROVES Specific Plan area shall comply with the applicable codes of all governmental agencies having jurisdiction on such matters including, but not limited to building, mechanical, fire and electrical codes and codes pertaining to drainage, wastewater, public utilities, grading, hazardous materials, conservation and air quality. 5.5 - SPECIFIC PLAN DEVELOPMENT PHASING AND SEQUENCING Construction of physical improvements within THE GROVES, including development tied to the Phase Two Concept Area Citrus Trails Master Plan, is expected to be initiated as early as 2018 and continued over an estimated 15 year period. This Specific Plan does not specify an order for build out of project improvements. Development may occur in any order determined by market factors, provided that all required provisions for infrastructure and fair share requirements are met. The planning and design of each Planning Area shall address construction issues such as drainage, storm water management, utilities and parking, as described in this Specific Plan and required by the Environmental Impact Report as development mitigation. Each Planning Area shall be planned as a complete site plan unit. This Specific Plan does not have an expiration period and shall remain in effect until otherwise repealed. The Groves does not specify any particular phasing or sequencing of development projects. However, construction and implementation of any development project and/or Planning Area shall demonstrate that all required infrastructure and facilities shall be timed to adequately service each individual development project. This may require construction of the facilities both on-site (within or adjacent to the Planning Area) and/or off-site (within other Planning Areas or outside of the Specific Plan area) to connect with existing facilities that will service that development. To ensure coordination of the provision of required services regardless of the order or sequence of development, The Groves development area is divided into Infrastructure Implementation Improvement Districts, which serve to establish a means for coordinating improvements for areas that share common infrastructure components. All development shall coordinate improvements per the improvement districts program set forth in Sections 3.3.3 and 3.6.3 of this Specific Plan. Chapter 5 THE GROVES AT LOMA LINDA SPECIFIC PLAN 55-4 5.6 - SPECIFIC PLAN EXEMPTIONS The following is a list of activities, not described in the Specific Plan, that are exempted from any further review process and are by-right with no further approval required, except as required by the building codes. This list is not all-inclusive and the Community Development Director may exempt other similar de minimus activities not included herein. x All interior changes to buildings. x All alterations and construction projects that do not result in an increase of gross building square footage of existing buildings and are not visible from the public right-of-way. x Re-painting using substantially the same exterior colors to the existing building colors or colors previously approved by the Historical Commission, as determined by the Community Development Director. x Partial repainting for de minimus repair, touch-up maintenance of graffiti removal with substantially similar paint color. x Re-glazing of windows or replacement of doors and windows with comparable materials or energy-efficient upgrades, when also consistent with historic preservation standards, if appropriate. x Re-landscaping of any area of an existing approved development consistent with existing landscaping when not associated with major development projects that otherwise require an approved landscape plan. x Re-roofing or roofing repairs when using comparable materials of essentially the same color and type of the existing building or roof materials previously approved by the Historical Commission, as determined by the Community Development Director. x Exterior repairs to existing buildings. x Any resurfacing or repainting of a parking or pedestrian area included in the Specific Plan and previously approved by the Historical Commission, Planning Commission, City Council or Community Development Director. 5.7 - SPECIFIC PLAN MODIFICATIONS AND ADJUSTMENTS [In taking action on the Specific Plan, the City Council may provide direction to City staff for revisions to the Pubic Hearing Draft, dated June 2018, and for incorporation into the final adopted version of the Specific Plan. This section will be completed and finalized by the Community Development Director as directed by the City Council.] 5.8 - SPECIFIC PLAN IMPROVEMENTS AMENDMENTS The Community Development Director shall have the authority to make recommendations for Amendments to the Specific Plan, and the City Council shall make the final determination. An Amendment to the Specific Plan shall be required for any of the following proposals: THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 5 55-5 x To permit establishment of a new principal use or a change of use that the Specific Plan does not authorize; x To permit a use or change in the Specific Plan which would result in an increase in the intensity of uses beyond that authorized by General Plan Table 2B; x To make changes to environmental mitigation measures which were adopted as part of the environmental clearance for the Specific Plan and which would result in new significant environmental impacts or make substantially more severe significant environmental impacts than identified in the adopted THE GROVES Specific Plan EIR; x To make changes to the outer boundary of the Specific Plan area; x To add, move the location, or make substantial changes to the boundary or spatial area of any Planning Area; x Any request which causes an inconsistency between the General Plan and the Specific Plan; or x Other significant policy changes or modifications to Specific Plan regulations which affect the entire Specific Plan area, as determined by the Director. Specific Plan amendments are governed by Government Code Section 65453, which specifies notification, public hearings and similar requirements. In addition, all requests for Specific Plan Amendments shall adhere to all submittal, review and approval requirements established by the City of Loma Linda. In making recommendations relative to a proposed Specific Plan Amendment, the following principles shall be considered: x Modified conditions, either within THE GROVES or adjacent community uses, warrant a revision to the Specific Plan; x The proposed modification is appropriate for the proposed location or use within THE GROVES; x The proposed modification does not detrimentally affect the interest of public health, safety and general welfare and is in conformance with standard zoning, planning, safety, health and public welfare practices; and x The proposed modification does not cause an inconsistency with the General Plan. In making a decision to adopt an Amendment to the Specific Plan, the City Council shall make a finding that the proposed Specific Plan, as amended, is consistent with the objectives, policies, general land uses, and programs of the General Plan and other adopted goals and policies of the City. Chapter 5 THE GROVES AT LOMA LINDA SPECIFIC PLAN 55-6 5.9 - PERIODIC REVIEW, REPORTING, AND MONITORING As identified throughout this Specific Plan, each new Planning Area development proposal shall provide the city of Loma Linda with documentation demonstrating compliance with the provisions herein. Specifically, each Planning Area Applicant/Developer shall provide the following: x Affordable/Special Needs Housing Requirement – XXXX . x Park Implementation – XXXX . x Energy Conservation Compliance – XXXX . x Mixed Use Compliance – XXXX . The format and requested detail of each Report shall be as determined by the Community Development Director. These Reports shall be made available for review to any member of the public upon request from the City. 5.10 - SPECIFIC PLAN IMPROVEMENTS FINANCING [In taking action on the Specific Plan, the City Council may provide direction to City staff for revisions to the Pubic Hearing Draft, dated June 2018, and for incorporation into the final adopted version of the Specific Plan. This section will be completed and finalized by the Community Development Director as directed by the City Council.] As identified throughout this Specific Plan, each new Planning Area development proposal shall provide the City of Loma Linda with documentation demonstrating compliance with the provisions herein. Specifically, each Planning Area Applicant/Developer shall provide the following: x Affordable/Special Needs Housing Requirement x Park Implementation x Energy Conservation Compliance x Mixed Use Compliance The format and requested detail of each Report shall be as determined by the Community Development Director. These Reports shall be made available for review to any member of the public upon request from the City. 5.11 - NOTIFICATIONS Notices of public hearings and decisions shall be made in accordance with the noticing requirements identified in this Specific Plan and/or the LLMC (as applicable). THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 5 55-7 5.12 - MAINTENANCE AND OPERATION All improvements within the Specific Plan boundary shall be constructed to standards acceptable to the City of Loma Linda and as specified in this Specific Plan. As established, each Homeowner’s Association or Business District Association (or equivalent maintenance entity) shall be responsible for maintenance of its respective portion of the Specific Plan area unless otherwise determined by the City of Loma Linda. 5.13 - TRANSFER OF RESIDENTIAL DEVELOPMENT REQUIREMENTS/ RIGHTS Purpose The ability to transfer residential development rights between Planning Areas provides flexibility to respond to site constraints and market demands, yet ensures that the overall goals of THE GROVES Specific Plan are maintained. General Provisions Allocations of residential units may be transferred between Planning Areas in compliance with the process outlined in this Section. a. Residential - Transfer of residential units between Planning Areas may be permitted, provided that each transferred unit is identified as either affordable or market rate and a “sending” site (the Planning Area seeking to divest its residential unit obligation) and a “receiving” site (the Planning Area seeking to obtain the divested residential units) are determined. The identified receiving site shall be within THE GROVES Specific (i.e., within Special Planning Area “D”). The sending Planning Area may transfer up to the number of dwelling units allocated to the Planning Area indicated in Table III-1, Description of Land Use by Planning Area. Under no circumstance shall THE GROVES provide less than 299 residential units in compliance with the affordable housing provisions in Section II.A.b(3), Consistency with General Plan Housing Element (unless such units are transferred outside of the Master Plan boundary elsewhere within Special Planning Area D in compliance with Section II.A.b(6), Mixed Use Exemptions), nor the maximum number of residential units in the Master Plan exceed 581 units. b. Responsibility for Associated Improvements and Obligations - The receiving site shall be responsible for all improvements and obligations associated with the transferred units, which may include, but are not limited to, on-site and off-site infrastructure, other improvements, park requirements, and fees. Furthermore, the receiving site shall be responsible for all improvements and infrastructure required to adequately serve a project, as determined by the City. Chapter 5 THE GROVES AT LOMA LINDA SPECIFIC PLAN 55-8 c. Consistency with Development Standards and Design Guidelines - Transfer of development may occur only if the resulting project is consistent with the Development Standards and Design Guidelines of this Master Plan, except as otherwise provided in Section II.H.3.b(2), Deviation from Master Plan Development Standards. Each Mixed Use Planning Area shall provide a mix of uses, except as authorized in Section II.A.b(6), Mixed Use Exemptions. Process for Transferring Development Rights The process for transferring residential development rights between Planning Areas shall include, at a minimum, the following steps: a. A letter requesting a transfer of development rights permit must be filed with the City of Loma Linda Planning Division by the owner of either the sending or receiving Planning Area in conjunction with the application for the associated development project. b. The decision-making body for the transfer of development rights permit shall be the same body as for the accompanying development project, and both the transfer of development rights permit and the development project shall be reviewed concurrently. However, a transfer of development rights consistent with the provisions of this Section does not constitute an amendment to the Specific Plan. c. The letter requesting a transfer of development rights permit shall include, at a minimum, the following information: 1) Written and notarized consent to the transfer from the owner(s) of record of all property subject to the transfer of development rights. 2) Calculation of the number of affordable and market rate residential units available to be transferred from the sending Planning Area and the number of affordable and market rate residential units requested to be transferred to the receiving Planning Area or site. 3) The applicable Specific Plan Planning Area numbers and Assessor Parcel Numbers. 4) A revised Specific Plan Land Use Plan depicting the requested transfer of development rights. d. A binding agreement to transfer the density shall be executed between the land owners of the sending and receiving Planning Areas and recorded via an instrument THE GROVES AT LOMA LINDA SPECIFIC PLAN Chapter 5 55-9 legally sufficient in both form and content to affect such development rights transfer. e. A recorded restriction or other instrument tied to the land shall be recorded on both the sending and receiving Planning Area or property stating the number of affordable and market rate residential units resulting from approval of a transfer of development rights permit. f. To ensure that development does not exceed the maximum residential unit count permitted by this Specific Plan, a monitoring report and tracking system shall be used by the City of Loma Linda to track transfers of development rights within THE GROVES. 5.14 - PUBLIC USE SITE RESERVATION Each development project within The Groves will comply with the LLMC Section 16.04.240, Public use site reservation-Standards, which requires: “Where a park, recreational facilities, fire station, library, or other public use is shown on an adopted specific plan or adopted general plan containing a community facilities element, recreation and parks element and/or a public building element, the subdivider may be required by the city council to reserve sites as so determined by the city or county in accordance with the definite principals and standards contained in the above specific plan or general plan. The reserved area must be of such size and shape as to permit the balance of the property within which the reservation is located to develop in an orderly and efficient manner. The amount of land to be reserved shall not make development of the remaining land held by the subdivider economically unfeasible. The reserved area shall conform to the adopted specific plan or general plan and shall be in such multiples of streets and parcels as to permit an efficient division of the reserved area in the event that it is not acquired within the prescribed period. (Ord. 109 § 15(B), 1975)” The City has determined that a new fire station shall be located within The Groves. Prior issuance of a certificate of occupancy for the one-hundredth residential unit within The Groves, a location for an interim or permanent fire station within the Specific Plan area (either Phase Two or Phase Three) shall be offered to the City. If the City chooses to develop an interim fire station, the Fire Department retains the right of first refusal in locating a site for a permanent fire station. 5.15 - PARKS AND OPEN SPACE IMPLEMENTATION Each development project within The Groves will comply with the LLMC Section 16.04.240, Public use site reservation-Standards, see Section 5.15, Public Use Site Reservation, above. Chapter 5 THE GROVES AT LOMA LINDA SPECIFIC PLAN 55-10 In addition, each development project within The Groves shall provide for park facility implementation in compliance with Section 3.4, Parks, Open Space, and Recreation Plan. The process for determining each development project and/or Planning Area responsibility for the funding, design, and construction of park facilities within The Groves is defined in Section 3.4.3 of this Specific Plan. More specifically, the responsibility for park facilities are proportionally allocated to each Planning Area based on the type of residential development and the number of residential units (assigned or ultimately built) within the Planning Area using the residential unit-to-parkland ratios set forth in Section 3.4.3 of this Specific Plan. Design and construction of the park facilities may be undertaken by the Planning Area property owners under a private cost sharing reimbursement agreement. Such an agreement is required to establish the proportional allocation of the expenses associated with the design, construction, and dedication of park facilities, and to determine in advance the specific improvements that will count toward fulfilling the City’s park credit. Cost sharing and reimbursement agreements shall be as set forth in Section 5.12, Specific Plan Improvements Financing, above. GENERAL PLAN CONSISTENCY A THE GROVES AT LOMA LINDA SPECIFIC PLAN Appendix A AA-1 A. General Plan Consistency A.1 - OVERVIEW The Groves Specific Plan has been prepared pursuant to the provisions of the California Government Code, Sections 65450 through 65457. This Specific Plan also follows the California Office of Planning and Research Guidelines. In addition, The Groves Specific Plan is consistent with other elements and components of the Loma Linda General Plan (General Plan). The Specific Plan reflects extensive technical analysis, input from the City, input from the land owners and surrounding property owners, input from the community, and applicable goals, objectives and policies of the General Plan, culminating in a functional program and vision for SPA-D (SPA-D) as a vibrant mixed-use community rooted in values important to the citizens of Loma Linda. Included in the Specific Plan document are land use regulations, infrastructure plans, zoning and development standards, design guidelines and implementation measures to ensure that buildout of The Groves will be implemented in accordance with the goals and objectives established for the Specific Plan area, and consistent with the General Plan. This Specific Plan, when adopted by ordinance, becomes the Plan that serves as the zoning ordinance for the subject property. All other City codes and ordinances shall continue to be applicable, unless expressly superseded by the terms of this Specific Plan or unless they are inconsistent with this Specific Plan, in which case they are superseded. Any proposed parcel or subdivision maps, site plans, agreements or any other development approvals must be consistent with this Specific Plan. Projects which are found consistent with this Specific Plan will be deemed consistent with the City’s General Plan and its adopted elements. At the time of preparation of this Specific Plan, two projects have been previously approved for SPA-D, the “Phase One Concept” and “Phase Two Concept”. The “Phase One Concept” involves a +46-acre area within SPA-D to accommodate the Veterans Affairs (VA) Ambulatory Care Center, 5 acres of commercial property and the southerly extension of Bryn Mawr Avenue. The VA facility has been constructed, but the commercial parcel remains vacant. The “Phase Two Concept“ involves the 111.7-acre Citrus Trails Master Plan project, which will accommodate development of up to 581 residential units, a maximum of 562,000 square feet of commercial/office uses, and almost 22 acres Appendix A THE GROVES AT LOMA LINDA SPECIFIC PLAN AA-2 of parks, open space and trails. The balance of SPA-D includes approximately 79 acres managed by the Successor Agency to the City of Loma Linda Redevelopment Agency (Successor Agency), approximately 6.5 acres designated as “Heritage Park” and approximately 18 acres owned by other multiple property owners. Also included within the area is approximately 39 acres owned by the Redlands Unified School District (RUSD) (i.e., 11.5 acres associated with the Mission Elementary School and 27.5 acres set aside for a future middle school). The following General Plan policies are the relevant policies for this Specific Plan and illustrate consistency between the General Plan and The Groves Specific Plan. A.2 - LAND USE PLAN The following General Plan policies influence the Land Use Plan for THE GROVES Specific Plan. Guiding Policy for Residentia l La nd Use (2.2.2.1) Ensure quality single-family and multi-family residential development in order to create and preserve residential neighborhoods that embody the strengths and accomplishments of the community and to preserve both the economic investment of new and existing individual property owners and the community’s natural resources. Residential Land Use Implementing Policies (2.2.2.1 ) a. Encourage a mixture of dwelling sizes, layouts, and ownership types (consistent with the corresponding land use designation, density range, and applicable General Plan requirements), especially within large-scale residential development projects, in order to provide housing opportunities for a range of incomes and households. e. Provide the citizens of Loma with a choice of areas of varying densities and housing with a range of costs. h. Require that all new detached single-family residences shall have a minimum lot size of 7,200 sf, regardless of the underlying land use designation or zone. Guiding Policy for Commercial/Office (2.2.4.1) Attract new, and maintain existing, commercial and office uses to better serve the retail and service needs of the community, to keep the sales tax revenues from purchases by the Loma Linda community from going elsewhere, to reduce the length of trips necessary to meet retail and service needs, and to expand employment opportunities within the community. Commercia l/Office Implementing Policies (2.2.4.1) a. Encourage commercial uses that are currently underrepresented within Loma Linda (e.g., membership bulk-merchandise stores, home improvement warehouses, discount general THE GROVES AT LOMA LINDA SPECIFIC PLAN Appendix A AA-3 merchandisers, electronics, pet supplies, office supplies, sporting goods, linens, furniture, books, toys, family clothing, baby and children’s clothing, discount designer clothing, etc.). b. Encourage pedestrian-oriented development and small-scale development that feature specialty stores and boutiques to create vibrant areas for people to gather and socialize and to better serve the community by providing a greater range of commercial uses (e.g., sit-down restaurants, upscale apparel, stores related to hobbies or collectibles, gifts, etc.). c. Encourage a greater variety of visitor/service commercial uses to better serve the community (e.g., hotels and extended-stay suites that include special event facilities to hold conventions, corporate events, weddings, etc., particularly along Redlands Boulevard, car wash/detailing facilities, service stations, etc.). On sites where a proposed hotel facility cannot feasibly provide appropriate and desirable amenities and parking with an FAR of 0.50 or less, the City may permit an increase in the allowable floor area ratio up to a maximum FAR of 0.75, if the City determines that the resulting development would be compatible with surrounding existing and planned development. d. Encourage more commercial leisure activities (e.g., family-oriented commercial recreation facilities, kids’ entertainment restaurants, day spas, sit-down restaurants that not only provide food but are oriented around family gatherings and appreciation of nature through their settings). f. Place commercial and office development so that it has a strong relationship with the street, such as by siting the buildings so that they are close to the street, or for buildings that need to be set back from the street with a large parking lot, locate pad buildings along the street to maintain an attractive street edge and visually buffer the parking lot. g. Ensure that new commercial/office developments are designed to provide for reciprocal access, where feasible, along commercial corridors to minimize the number of driveway entries necessary, limit the need to use the street to gain access to nearby uses, and provide a unified street edge. Guiding Policy for the Redlands Boulevard/California Street Specia l Planning Area D (2.2.7.4) This area is intended to be characterized by a horizontal and vertical mixed uses developed along the frontages of Redlands Boulevard and California Street, including commercial, office, structured parking, and up to 400 very high density residential dwelling units. Religious assembly uses are also anticipated along Redlands Boulevard and California Street. Single-family residential uses should be placed towards the central, western, and southern portions of the Redlands Boulevard/California Street Special Planning Area, with multi-family development permitted toward the interior of the area. New residential uses in proximity to existing, historical residential uses along Mission Road should be compatible in density and scale to the historic residential uses (although not necessarily the same), since the General Plan intends for these Appendix A THE GROVES AT LOMA LINDA SPECIFIC PLAN AA-4 existing residences to remain. Overall, the pattern of land use should reflect the pattern and mix of uses identified below. The General Plan envisions establishment of a heritage park within the Redlands Boulevard/California Street Special Planning Area, providing passive recreational uses within an historic setting, consisting of examples of local historic architecture. This vision includes relocating historic homes into the park, and establishing a local heritage/cultural museum, as well as adapting the structures for use for civic and cultural events, as well as for use by local civic and cultural organizations. The General Plan’s vision for this area is a “livable, walkable community” with a high level of amenities for residents, such as parks, trails and paseos, and other recreational uses, exhibiting a high level of design quality. Another key concept for this area is development of a large, sports oriented community park to assist Loma Linda in achieving its desired park acreage to population ratio. Redlands Boulevard/California Street Specia l Planning Area D Implementing Policies (2.2.7.4) a. Allow retail and service commercial, office, institutional, single-family residential, multi- family residential, senior housing, and public open space uses in SPA-D consistent with Table 2.B (of the General Plan). g. Provide residential uses with easy access to the planned recreation trail running north and south through the city (located approximately one half mile east of Mountain View Avenue), such as by placing trail connections at the end of cul-de-sacs. h. Provide public open space in proximity to residential uses, either in concert with (and in addition to) the planned recreation trail running north and south through the city (located approximately one half mile east of Mountain View Avenue), or in a separate area. k. The maximum allowable number of residential units within SPA-D shall be 1,067. m. New residential uses in proximity to existing residential uses that will remain along Mission Road shall be compatible in density (generally, low density residential 0 to 4 dwelling units per acre) and scale. A gradation of lot sizes shall be provided from large lots along Mission Road to the north and east. n. The appropriate density for shopping centers, business parks, and office buildings shall be 0.5 FAR. The appropriate density for small institutional uses (e.g., religious assembly uses and schools) shall also be 0.5 FAR. r. Pursue establishment of a heritage park to preserve the existing reminders of Loma Linda’s history; establish a location to which historic structures can be relocated, restored, and protected; and provide a location for the operation of historical preservation organizations and passive recreation in an historic setting. s. Within planned open space and park areas, provide active sports facilities. THE GROVES AT LOMA LINDA SPECIFIC PLAN Appendix A AA-5 Guiding Policy for Commercial a nd Industrial Land (4.6.2) Protect fiscal and financial health of the City of Loma Linda. Guiding Policy for Ma intaining and Improving Fisca l Hea lth (4.6.3) Development of commercial/industrial uses with “point of sale: retail sales tax revenues should be located in mixed-use areas such as along California Avenue and in the business park on Redlands Boulevard. Guiding Policy for Ma intaining and Improving Fisca l Hea lth (4.6.3) Provide sufficient land to accommodate planned development, with office, business park, and commercial areas complementing residential and public development in location, access, mix of uses, attractiveness, and design quality. Housing Element Goa l 1: Enhance housing opportunities for all Loma Linda residents (5.3.1 ) Policy 1 .1 Provide a range of different housing types and unit sizes for varying income ranges and lifestyles. Policy 1 .2 Encourage the provision for housing which meets the needs of residents with special housing needs, including the elderly, disabled, developmentally disabled, large families, the homeless, and students. Policy 1 .3 Encourage mixed use development and student and workforce housing in appropriate locations to allow for increased housing opportunities. Housing Element Goal 2: Assist in the provision of adequate housing to meet the needs of the community (5.3.1) Policy 2.1 Facilitate the development of extremely low, very low, low and moderate income housing by offering developers incentives such as density bonuses, City participation in on and off- site public improvements, and flexibility in zoning and development standards. Housing Element Goa l 5: Promote equa l housing opportunity for all residents (5.3.1) Policy 5.2 Encourage and facilitate the development of residential units that are accessible to handicapped persons or are adaptable for conversion to housing for handicapped persons. Growth Ma na gement Principle One (2A.A) New development within the planning area and sphere of influence of the City of Loma Linda shall conform to City development standards that promote environmentally sensitive development designed to preserve and enhance the quality of life now experienced in the City. Appendix A THE GROVES AT LOMA LINDA SPECIFIC PLAN AA-6 Growth Ma na gemen Principle Four (2A.D) Preservation of open space and agricultural land areas is a priority in the City of Loma Linda, its planning area and its sphere of influence, and dedication of open space in perpetuity shall be a requirement for certain development as well as for the City. a. Planned Residential Developments and Planned Communities shall meet one of the following open space standards as described below: b. Properties under Fifteen Percent Slope. Not less than twenty percent of the gross land area shall be held in common as landscaped, recreational open space. Such open space shall contain a minimum dimension of fifty square feet, and be accessible to each lot through a system of public or private walkways. Open space areas may include swimming pools, putting greens, court games, and other recreational leisure facilities, as well as landscaped areas or areas with native vegetation. Such areas shall be identified as permanent open space on the final tract map. Open space calculations shall not include buildings, private patios, balconies, driveways, and off-street parking areas. A.3 - MOBILITY PLAN The following General Plan policies influence the Mobility Plan for THE GROVES Specific Plan. Guiding Policy for Transportation a nd Circula tion (6.10) Provide a balanced, convenient, energy-efficient, and safe transportation system that incorporates all feasible modes of transportation. Transportation and Circula tion Implementing Policies – Vehicular Circulation (6.10.1) a. Maintain long-term traffic levels of service at LOS C. (1) In those locations where maintaining LOS C is not feasible and Measure V permits a lower level of service, implement all feasible mitigation measures. b. Require all development projects to provide their fair share (in the form of physical improvements and/or fee payment) for all feasible improvements needed to implement Policy “a,” above. f. Promote the design of arterial and collector roadways to optimize safe traffic flow within established roadway configurations by minimizing driveways and intersections, uncontrolled access to adjacent parcels, on-street parking, and frequent stops to the extent consistent with the character of adjacent land uses. k. Require the design of new developments to focus through traffic onto arterial streets, and away from local neighborhoods. THE GROVES AT LOMA LINDA SPECIFIC PLAN Appendix A AA-7 v. As part of the development of the mixed-use area west of California Street, realign Mission Road to connect to Orange Street. West of California Street, design the realigned Mission Road to maximize access to lands north of Barton Road. w. Place ultimate responsibility for mitigating the impacts of future growth and development, including construction of a new and widened roadways, as well as intersection improvements, with individual development projects. The City’s Capital Improvements Program will be used primarily to address the impacts of the existing development, and to facilitate adopted economic development programs. Transportation and Circula tion Implementing Policies – Non-motorized Transportation (6.10.2) a. Design new residential neighborhoods to provide safe pedestrian and bicycle access to schools, parks and neighborhood commercial facilities through explicit development requirements for such amenities. c. Maintain roadway designs that maintain mobility and accessibility for bicyclists and pedestrians through incorporation of sidewalks and bicycle lanes, where appropriate. e. Where shopping facilities are located adjacent to residential areas, provide direct access between residential and commercial uses without requiring pedestrians and bicyclists to travel completely around the commercial development through stipulations in the design review process. f. Require the construction of attractive walkways in new residential, commercial, office, and industrial developments, through the use of landscaping which includes shading for pedestrian paths. g. Orient site design in non-residential areas to allow for safe and convenient pedestrian access from sidewalks, transit and bus stops, and other pedestrian facilities, in addition to access through required parking facilities. Transportation and Circula tion Implementing Policies – Transit (6.10.3) a. Ensure that the site design of new developments provides for pedestrian access to existing and future transit routes and transit centers through specific review during the development review process. Redlands Boulevard/California Street Specia l Planning Area D Implementing Policies (2.2.7.4) c. Design multiple building developments that might not include “pad” buildings, such as an office building or business park complex to feature a strong street presence by placing buildings so that they side on to the street and by placing parking lots so that they are easily accessed but not dominating the street frontage. f. Design vehicular and pedestrian circulation patterns in the residential areas to facilitate access to the commercial uses along Redlands Boulevard and California Street via the residential collector streets behind the commercial uses. Thus, nearby residents should not Appendix A THE GROVES AT LOMA LINDA SPECIFIC PLAN AA-8 need to drive or walk along Redlands Boulevard or California Street to access the commercial and service uses. g. Provide residential uses with easy access to the planned recreation trail running north and south through the city (located approximately one half mile east of Mountain View Avenue), such as by placing trail connections at the end of cul-de-sacs. Growth Ma na gement Principle Six (2A.F) Traffic levels of service throughout the City of Loma Linda shall be maintained at current levels and new development shall be required to fully mitigate any impact on traffic resulting from that development. h. To assure the adequacy of various public services and to prevent degradation of the quality of life experienced by the residents of Loma Linda, all new development projects shall assure by implementation of appropriate mitigation measures that, at a minimum, traffic levels of service (LOS) are maintained at a minimum of LOS C throughout the City, except where the current level of service is lower than LOS C. In any location where the level of service is below LOS C at the time an application for a development project is submitted, mitigation measures shall be imposed on that development project to assure, at a minimum, that the level of traffic service is maintained at levels of service that are no worse than those existing at the time an application for development is filed. In any location where the Level of Service is LOS F at the time an application for a development project is submitted, mitigation measures shall be imposed on that development project to assure, at a minimum, that the volume to capacity ratio is maintained at a volume to capacity ratio that is no worse than that existing at the time an application for development is filed. Projects where sufficient mitigation to achieve the above stated objectives is infeasible shall not be approved unless and until the necessary mitigation measures are identified and implemented. A.4 - PARKS, OPEN SPACE AND RECREATION PLAN The following General Plan policies influence the Parks, Open Space and Recreation Plan for THE GROVES Specific Plan. Guiding Policy for Open Spa ce (9.2.10.2) Acquire, preserve and maintain open space and its natural resources for future generations. Open Space Implementing Policies (9.2.10.2) i. Continue to require through development standards, the integration of open space and recreational uses and facilities in all multi-family residential projects Guiding Policy for Tra ils (9.2.10.6) THE GROVES AT LOMA LINDA SPECIFIC PLAN Appendix A AA-9 Maximize the benefits of open space through the provision of recreational trails. Trails Implementing Policies (9.2.1 0.6) b. Coordinate with public and private entitles to link open spaces with the network of paths and trails to create a system of connecting open space Residential Land Use Implementing Policies (2.2.2.1) f. Require that new residential development provide for construction of infrastructure and provision of open space and/or construction of recreational facilities in order to reduce the public cost associated with such uses. Guiding Policy for the Redlands Boulevard/California Street Specia l Planning Area D 2.2.7.4 …The General Plan envisions establishment of a heritage park within the Redlands Boulevard/California Street Special Planning Area, providing passive recreational uses within an historic setting, consisting of examples of local historic architecture…The General Plan’s vision for this area is a “livable, walkable community” with a high level of amenities for residents, such as parks, trails and paseos, and other recreational uses, exhibiting a high level of design quality. Another key concept for this area is development of a large, sports oriented community park to assist Loma Linda in achieving its desired park acreage to population ratio. Redlands Boulevard/California Street Specia l Planning Area D Implementing Policies (2.2.7.4) g. Provide residential uses with easy access to the planned recreation trail running north and south through the city (located approximately one half mile east of Mountain View Avenue), such as by placing trail connections at the end of cul-de-sacs. h. Provide public open space in proximity to residential uses, either in concert with (and in addition to) the planned recreation trail running north and south through the city (located approximately one half mile east of Mountain View Avenue), or in a separate area. i. Multi-family and senior housing products shall be provided with sufficient usable open space within the development. The internal open space provided within such developments may not be counted toward meeting minimum requirements for public park area, but shall be considered to be an added amenity pursuant to General Plan policy “o,” below. o. Implementation of development within SPA-D shall be through a master plan prepared by the City so that specific siting of land uses/buildings, architectural design, landscaping, road infrastructure, utilities, and other elements can be planned in a comprehensive, rather than piecemeal, manner throughout the Special Planning Area. Such specific plans shall provide development standards and guidelines to: x Maintain a feeling of “openness” within the area; x Provide for varying front yard setbacks and a mix of one- and two-story residential dwelling units; Appendix A THE GROVES AT LOMA LINDA SPECIFIC PLAN AA-10 x Development of an area of lots larger than those found in a typical suburban subdivision; and x Preserve existing oak trees and provide for replacement at an appropriate ratio of those trees than cannot feasibly be preserved. p. The design of development within SPA-D must encompass a variety of amenities to serve the project. Development of residential product types other than single family detached dwelling units on minimum 7,200 square foot lots shall require the provision of a strong package of project amenities within the overall Specific Plan or planned development, including, but not limited to: x 25 percent usable open space; x Trails and paseos; x Fountains and water features; x Public art; x Amphitheaters and public gathering places; x Homeowner-owned parks and recreational facilities, such as sports fields, ball courts, tot lots, putting greens, pools, lakes, and community center buildings; x Public facilities/parks substantially in excess of that required by Quimby Act provisions; x Provision of one or more high density, walkable village areas and/or x Public facilities with a recognizable connection to the project that are substantially in excess of the city’s minimum requirements. q. Development of commercial, office, and business park development within the Redlands Boulevard/ California Street Special Planning Area shall comply with the following. 1) Provide plazas, pocket parks, public art, and similar amenities to create gathering places with a high level of visual interest. 3) Encourage a pedestrian-oriented character through detailed, pedestrian oriented architecture;pedestrian amenities such as seating areas, landscaping, and lighting; water features such as fountains and public art; signs that are placed and scaled to the pedestrian; wide sidewalks and/or pathways to link buildings; and open areas such as plazas to encourage gathering. r. Pursue establishment of a heritage park to preserve the existing reminders of Loma Linda’s history; establish a location to which historic structures can be relocated, restored, and protected; and provide a location for the operation of historical preservation organizations and passive recreation in an historic setting. s. Within planned open space and park areas, provide active sports facilities. Growth Ma na gement Principle Four (2A.D) THE GROVES AT LOMA LINDA SPECIFIC PLAN Appendix A AA-11 Preservation of open space and agricultural land areas is a priority in the City of Loma Linda, its planning area and its sphere of influence, and dedication of open space in perpetuity shall be a requirement for certain development as well as for the City. t. Planned Residential Developments and Planned Communities shall meet one of the following open space standards as described below: u. Properties under Fifteen Percent Slope. Not less than twenty percent of the gross land area shall be held in common as landscaped, recreational open space. Such open space shall contain a minimum dimension of fifty square feet, and be accessible to each lot through a system of public or private walkways. Open space areas may include swimming pools, putting greens, court games, and other recreational leisure facilities, as well as landscaped areas or areas with native vegetation. Such areas shall be identified as permanent open space on the final tract map. Open space calculations shall not include buildings, private patios, balconies, driveways, and off-street parking areas. v. Preservation of Citrus Groves. The City recognizes the desire to maintain citrus and avocado groves and other agricultural uses as a means to provide open space, to provide and maintain a balanced economy, and to maintain green space and vegetation that will consume carbon dioxide and improve air quality. The open space requirement of paragraphs (a) and (b) of this section may be met by preserving citrus and/or avocado groves or other agricultural uses determined appropriate by the City Council, and assuring ongoing maintenance through a conservation easement or other legal mechanism, provided that the minimum percentage open space requirement of (a) and (b) are met. w. Common Open Space. Common open space may include areas held in common by associations where the perpetual open space is guaranteed by acceptable legal mechanisms including public and private easements and conservation easements and other open space conditions, restrictions and covenants guaranteed in perpetuity by similar mechanisms. If an applicant proposes to dedicate a portion of a site as public park lands, this area may be considered as common open space by the affirmative vote of a majority of the City Council. x. Maintenance of Common Open Space. Maintenance of common open space areas within Planned Residential Developments and Planned Communities shall be the responsibility of the developer and the residents. In no event shall the City be responsible for such maintenance. Guiding Policy for Parkland Acquisition (8.6.5) The City will acquire and/or gain control of sufficient parkland to develop a system of park, recreational, and open space lands of sufficient size and in the appropriate locations, including provision of a range of Appendix A THE GROVES AT LOMA LINDA SPECIFIC PLAN AA-12 recreational facilities, to serve the needs of Loma Linda residents of all ages and attain a population-to- parkland acreage ratio of 5 acres per 1,000 population. Parkland Acquisition Implementing Policies (8.6.5.1) a. Provide a range of public parklands for use by the community including the following: x Neighborhood Park. A park or playground generally 5 to 10 acres in size primarily developed to meet the recreational needs of citizens living within 0.5 to 1 mile. x Joint School/Park. A neighborhood park development, improved, and maintained on or adjacent to school grounds by the City. Joint school/park facilities are utilized jointly by students and residents from the surrounding neighborhoods. Since school facilities are only available for use by the general public when school in not in session, only half of the total acreage is to be applied to the City’s park standard. x Community Park. A larger park facility developed to meet the park and recreational needs of those living or working within a 3- to 5-mile radius. Community parks generally range in size from 10 to 60 acres. x Sports Park. A park development designed to serve the needs of organized sports activities including youth and adult leagues. Generally ranges in size from 5 to 30 acres. x Specialized Recreational Area. These include linear parks (trails), community centers, and preservation areas or structures. These facilities vary in size depending on use. d. Encourage the preservation of significant natural features and development of landscaped parkways and trail systems in new development in addition to the required park develop. j. Require the provision of private play space for children in attached residential developments Guiding Policy for Park Improvement (8.6.6) Provide for the orderly and comprehensive planning of parklands and resources through specific planning and Master Plan procedures. Park Improvement Implementing Policies (8.6.6.1) c. Ensure that neighborhood and community parks are developed with facilities appropriate to all ages and interests including athletic fields; active play areas, passive open space, tot lots, and picnic areas. d. Park design shall conform to standards developed by the National Recreation and Parks Association for access, safety, health and protection of humans and domestic animal species. e. Provide for the needs of special populations including the physically and mentally challenged in park facility and program design. THE GROVES AT LOMA LINDA SPECIFIC PLAN Appendix A AA-13 f. Seek partnership opportunities with the private sector and with other public agencies to enhance park facilities and provide leisure time activities through mechanisms such as zoning, donation, purchase of easement, management strategies, or establishment of resource conservation and recreation authorities with coordinated taxing and management roles. Recreation Programs and Services Implementing Policies (8.6.7.1) g. Promote historical and cultural education through special programs, the operation of museums, preservation of historical sites, and promotion of special events. A.5 - CONSERVATION AND PRESERVATION PLAN The following General Plan policies influence the Land Use Plan for THE GROVES Specific Plan. Guiding Policy for Visual Resources (9.2.10.1) Protect views and unique landforms. Guiding Policy for Open Spa ce (9.2.10.2) Acquire, preserve and maintain open space and its natural resources for future generations. Open Space Implementing Policies (9.2.10.2) i. Continue to require through development standards, the integration of open space and recreational uses and facilities in all multi-family residential projects Guiding Policy for Biological Resources 9.4.4 Preserve habitats supporting rare and endangered species of plants and animals including wildlife corridors. Biological Resources Implementing Policies (9.4.4) c. Preserve, as feasible, the oak woodland areas within the City by requiring development to incorporate the trees into the development design. Guiding Policy for Wa ter Qua lity a nd Availa bility (9.6.2) Water quality and availability are critical to the current and future residents of the City of Loma Linda, its planning area, and its sphere of influence. No new development shall be approved that endangers the quality or quantity of water delivered to households within the City. Water Qua lity a nd Ava ilability Implementing Policies (9.6.2) d. Encourage sustainable landscapes or landscapes that require little irrigation through the use of drought-tolerant and native vegetation in new development. Appendix A THE GROVES AT LOMA LINDA SPECIFIC PLAN AA-14 f. Pursue the use of reclaimed water for the irrigation of all appropriate open space facilities and City projects, and encourage existing and new developments to tie to the reclaim water system when available and recommended by the San Bernardino Municipal Water Department (wastewater provider) to reduce demand on municipal water supplies. g. Through the development review process, encourage water conservation in all new and rehabilitated development through the use of water conserving fixtures in all new residential and commercial development. Guiding Policy for Wa ter Efficiency (9.6.1.2) Maximize water efficiency, water reuse, and the beneficial use of stormwater, including groundwater recharge and water quality improvement. Water Efficiency Implementing Policies (9.6.1 .2) d. Require site-appropriate, drought-tolerant low water use landscaping and efficient irrigation systems where appropriate for new development. For parcels adjacent to publicly managed open space, appropriate landscaping will also be non-invasive and have low flammability. Limit the amount of water intensive landscaping, particularly lawn area allowed, in order to reduce the amount of water needed for irrigation. e. Encourage use of irrigation technologies such as evapo-transpiration systems—where real- time weather data are transmitted to installed controllers to automate water needs—that save water, promote greater plant health, and reduce runoff. Encourage water agencies to conduct irrigation training workshops for homeowners and professionals. f. Encourage use of on-site rainwater capture, storage, and infiltration for irrigation and other nonpotable uses, and work with appropriate authorities to establish standards for rainwater quality and use. Ensure that catchments do not adversely affect habitat dependent on in- stream flow. Guiding Policy for Cultura l Resources (9.7.5) Preserve and protect the City’s historic structures and neighborhoods. Identify and preserve the archaeological and paleontological resources in Loma Linda. Cultura l Resources Implementing Policies (9.7.5) d. Preserve significant historic structures through review of demolition permits or alterations to such structures by the Historic Commission. Permit adaptive reuse of historic landmark structures for institutional, office, or commercial uses, where improvements to the structure retain the integrity of the historic landmark (see Community Design Element, Section 3.2). e. Where new development occurs around an historic structure, ensure that the surrounding setting is compatible with the historic structure (see Community Design Element). THE GROVES AT LOMA LINDA SPECIFIC PLAN Appendix A AA-15 Guiding Policy for Greenhouse Gas Reduction (9.8.1) Minimize greenhouse gas emissions that are reasonably attributable to the City’s discretionary land use decisions and internal government operations, with the goal of reducing Loma Linda’s greenhouse gas emissions to 1990 levels by 2020. Greenhouse Gas Reduction Implementing Policies – Compact Community Measures (9.8.1 ) Encourage patterns of commercial development that support use of public transit, including modifying development regulations to facilitate commercial and/or mixed use projects at sites near transit stops. Greenhouse Ga s Reduction Implementing Policies – Energy Conservation and Air Quality Measures (9.8.1 ) d. Encourage energy-efficient landscaping for resource conservation by developing guidelines that emphasize proper irrigation techniques and sustainable landscaping (organic fertilizers and pesticides). e. Consider light-colored surfacing on pavements and rooftops where feasible to reduce heat absorption. f. As part of the development review process, work with builders to maximize energy conservation benefits in the placement of buildings on a site with regard to sun and natural breezes. l. Preserve and encourage planting trees in neighborhoods to provide shade in summer and reduce heat loss in winter. Successful methods include placing trees to the west and northwest of houses to shade from the hot summer sun and grouping trees to protect them from harsh elements and support their longevity. Trees can reduce air temperatures 5–10° F from shading and evapotranspiration (water in leaves converting into vapor, cooling the air). Greenhouse Gas Reduction Implementing Policies – Transportation Measures (9.8.1) o. Require new development to incorporate features that reduce energy used for transportation, including pedestrian and bicycle pathways, and access to transit (where available). s. As appropriate, require new development and redevelopment projects to address the following: bicycle and pedestrian access internally and to other areas; safe access to public transportation and construction of paths that connect with other non-motorized routes; safe road crossings at major intersections for school children and seniors; and secure, weatherproof bicycle storage facilities. Ensure that such facilities will have ongoing maintenance. Appendix A THE GROVES AT LOMA LINDA SPECIFIC PLAN AA-16 Guiding Policy for Solid Wa ste Ma na gement (8.9.2) Reduce the amount of solid waste requiring disposal at landfills, enhancing the potential for recycling of the City’s solid wastes. Solid Wa ste Ma nagement Implementing Policies (8.9.2.1 ) d. Require provision of attractive, convenient recycling bins and trash enclosures in new multi- family residential and non-residential development. e. Continue and expand public education programs involving waste reduction, recycling, composting, waste to energy, zero-waste programs, and household hazardous waste. f. Require builders to incorporate interior and exterior storage areas for recyclables into new commercial, industrial, and public buildings. Guiding Policy for the Redlands Boulevard/California Street Specia l Planning Area D (2.2.7.4) …New residential uses in proximity to existing, historical residential uses along Mission Road should be compatible in density and scale to the historic residential uses (although not necessarily the same), since the General Plan intends for these existing residences to remain…The General Plan envisions establishment of a heritage park within the Redlands Boulevard/California Street Special Planning Area, providing passive recreational uses within an historic setting, consisting of examples of local historic architecture. This vision includes relocating historic homes into the park, and establishing a local heritage/cultural museum, as well as adapting the structures for use for civic and cultural events, as well as for use by local civic and cultural organizations… Redlands Boulevard/California Street Specia l Planning Area D Implementing Policies (2.2.7.4) d. Pursue adaptive reuse of the large residences associated with the citrus groves to the greatest extent feasible in order to maintain elements from the community’s history; potential new uses for these historic structures may include restaurants, offices, and bed and breakfast establishments. New adjacent uses/buildings should be sensitively sited and designed in order to preserve historic buildings, allow for viable access to them, and create a cohesive architectural character that reflects, and is compatible with, the historic buildings. New development shall be consistent with the City’s Historic Mission Overlay District. o. Implementation of development within SPA-D shall be through a master plan prepared by the City so that specific siting of land uses/buildings, architectural design, landscaping, road infrastructure, utilities, and other elements can be planned in a comprehensive, rather than piecemeal, manner throughout the Special Planning Area. Such specific plans shall provide development standards and guidelines to: x Maintain a feeling of “openness” within the area; THE GROVES AT LOMA LINDA SPECIFIC PLAN Appendix A AA-17 x Preserve existing oak trees and provide for replacement at an appropriate ratio of those trees than cannot feasibly be preserved. r. Pursue establishment of a heritage park to preserve the existing reminders of Loma Linda’s history; establish a location to which historic structures can be relocated, restored, and protected; and provide a location for the operation of historical preservation organizations and passive recreation in an historic setting. A.6 - INFRASTRUCTURE, UTILITES, SERVICES AND WATER QUALITY PLAN The following General Plan policies influence the Infrastructure, Utilites, Services and Water Quality Plan for THE GROVES Specific Plan. Visua l Resources Implementing Policies (9.2.1 0.1) c. Require new development to be designed to conserve soil and avoid erosion by limiting cut and fill areas and the exporting of soil from the development site. Guiding Policy for Wa ter Qua lity a nd Availa bility (9.6.2) Water quality and availability are critical to the current and future residents of the City of Loma Linda, its planning area, and its sphere of influence. No new development shall be approved that endangers the quality or quantity of water delivered to households within the City. Water Qua lity a nd Ava ilability Implementing Policies (9.6.2) a. No development project shall be approved which would cause the quality of water delivered to Loma Linda households to fail to meet State and/or Federal water quality standards, or which would cause an increase in residential rates, or which would result in a restriction of water usage, except for those projects exempt under State and/or Federal law. d. Encourage sustainable landscapes or landscapes that require little irrigation through the use of drought-tolerant and native vegetation in new development. e. Through the development review process require that water supply capacity is available or will be available prior to approval of a development project. Do not approve projects for which assured water supply is not available. f. Pursue the use of reclaimed water for the irrigation of all appropriate open space facilities and City projects, and encourage existing and new developments to tie to the reclaim water system when available and recommended by the San Bernardino Municipal Water Department (wastewater provider) to reduce demand on municipal water supplies. g. Through the development review process, encourage water conservation in all new and rehabilitated development through the use of water conserving fixtures in all new residential and commercial development. h. Require implementation of Best Management Practices to reduce drainage system discharge of non-point source pollutants originating from streets, parking lots, residential Appendix A THE GROVES AT LOMA LINDA SPECIFIC PLAN AA-18 areas, businesses, industrial operations, and those open space areas involved with pesticide application. Water Efficiency Implementing Policies (9.6.1 .2) f. Encourage use of on-site rainwater capture, storage, and infiltration for irrigation and other nonpotable uses, and work with appropriate authorities to establish standards for rainwater quality and use. Ensure that catchments do not adversely affect habitat dependent on in- stream flow. Guiding Policy for Flooding Ha zards (10.2.3) Protect the community from risks to lives and property created by flooding and stormwater runoff. Flooding Hazards Implementing Policies (10.2.3) c. Require new development to provide for the perpetual maintenance of detention basins, if necessary to support the new development. d. Require new development to incorporate features into drainage plans that would reduce impermeable surface area, increase surface water infiltration, and minimize surface water runoff during storms. Guiding Policy for Fire Protection Services (8.1.2) Provide an adequate number of fire stations, along with fire fighting personnel and equipment to protect the residents and businesses of Loma Linda. Fire Protection Services Implementing Policies (8.1.2.1) b. All discretionary development projects shall be reviewed by the Department of Public Safety to ensure that a five-minute response time (including three-minute running time) can be maintained for 80 percent of emergency fire, medical, and hazardous materials calls on a Citywide response area basis. Guiding Policy for Police Protection Services (8.2.2) Provide for the protection of Loma Linda citizens and businesses from crime through maintenance of an adequate force of police officers, appropriate physical planning of new development, and a high level of public involvement in crime prevention. Police Protection Services Implementing Policies (8.2.2.1) h. Require design features in new development to reduce potential for crime. x Provide well-lighted and visible streets and street names, building entrances and addresses, recreation areas, and parking areas. THE GROVES AT LOMA LINDA SPECIFIC PLAN Appendix A AA-19 x Limit access into and between buildings to reduce escape routes and to make undetected entry difficult. x Landscape development sites to permit surveillance of open areas and entryways, and avoid creating places for concealment. x Within multi-family and non-residential developments, provide emergency vehicle access around buildings to the extent feasible. x Within multi-family and non-residential developments, eliminate the potential for access to roofs by pallets, flag poles, etc. Guiding Policy for Medical and Social Services (8.5.2) Encourage the continuance and the development of private and public medical facilities and human and social services in Loma Linda. Medical and Socia l Services Implementing Policies (8.5.2.1) a. Encourage the development of a variety of housing and recreational options for senior citizens in areas close to services and transportation. Guiding Policy for Wa ter Utilities (8.7.2) Provide a water system that supplies high quality water to serve existing and future needs of the City during peak use conditions, with sufficient water in storage reservoirs for emergency and fire protection. Water quality and availability are critical to the current and future residents of the City of Loma Linda, its planning area, and its sphere of influence. No new development shall be approved that endangers the quality or quantity of water delivered to households within the City. Water Utilities Implementing Policies (8.7.2) a. Ensure that adequate water supply capacity and infrastructure is in place prior to occupancy of new development. Guiding Policy for Wa stewa ter Ma nagement (8.8.2) Ensure a wastewater collection, treatment, and disposal system is available to serve existing and future residences, businesses, institutions, and other uses within the City of Loma Linda. Wastewa ter Management Implementing Policies (8.8.2.1) d. Investigate the use of reclaimed wastewater. Where reclaimed wastewater can be economically delivered, require the installation of dual water system supplies for irrigation purposes and industrial purposes. Guiding Policy for Utilities, Telecommunica tions, a nd Cable Television (8.10.7) Ensure the provision of adequate communication and utility systems for existing and future residents and the business community. Appendix A THE GROVES AT LOMA LINDA SPECIFIC PLAN AA-20 Utilities, Telecommunications, a nd Ca ble Television Implementing Policies (8.10.7.1) b. Require all new development projects and building additions exceeding 50 percent (50%) of the original structure that are within a fiber-optic master plan area to participate in the Loma Linda Connected Communities Program. c. Require new development to underground all utility lines needed to serve future buildings and their occupants, and work with Southern California Edison to underground utilities in existing neighborhoods. f. Encourage all new development to provide the technology to support multiple telecommunications facilities and providers such as multi-media products, wireless technologies, and satellite communications. Growth Ma na gement Principle Five (2A.E) Water quality and availability are critical to the current and future residents of the City of Loma Linda, its planning area and its sphere of influence. No new development shall be approved that endangers the quality or quantity of water delivered to households within the City. g. No development project shall be approved which would cause the quality of water delivered to Loma Linda households to fail to meet State and/or Federal water quality standards, or which would cause an increase in residential rates, or which would result in a restriction of water usage, except for those projects exempt under State and/or Federal law. A.7 - DESIGN GUIDELINES The following General Plan policies influence the Design Guidelines for THE GROVES Specific Plan. Guiding Policy for Pedestria n-Oriented Development (3.1.1.1) For pedestrian-oriented development (located within commercial or mixed-use land use designations as indicated in the Land Use Element) ensure that the features that make for attractive and functional pedestrian-oriented development are provided. Pedestria n-Oriented Development Implementing Policies (3.1 .1.2) a. Design buildings to be from one to three stories in height. b. Locate retail uses on the first floor in order to benefit from street activity and to generate activity themselves by providing convenient shopping opportunities and attractive window displays. Service uses, such as hair salons and dry cleaning drop-off/pick-up, should only be placed on the first floor if the interior tenant spaces are designed to present an attractive, active image that adds to the vitality of the street life. c. Within horizontally mixed-use buildings, provide professional services offered directly to the public on the first floor with other office-based employment reserved office uses for the THE GROVES AT LOMA LINDA SPECIFIC PLAN Appendix A AA-21 second floor of pedestrian-oriented buildings. Residential uses are appropriate on the second and third floors. d. Orient buildings so that they are always the primary element as seen from the street, as opposed to parking areas. e. Design streets to accommodate slow to moderate moving local traffic (e.g., two lanes maximum each direction) or close streets to provide for pedestrian use only. Thus, through traffic on arterials would be provide on the periphery of pedestrian oriented development. f. Though pedestrian access is the focus, also provide convenient vehicular parking via nearby parking in an adjacent parking lot located to the side or rear of the building and/or on- street parking (where feasible considering traffic). Permit off-street parking standards to be met with a convenient off-site parking structure or lot that serves the area. g. Provide wide sidewalks/walkways for pedestrian circulation and bicycle lanes or paths for bicycle travel. h. Scale buildings to the human user and feature detail that is an appropriate level and scale for close up viewing. i. Keep private residential areas on the upper floors of mixed-use buildings distinct from public spaces and public uses, providing separate entries where feasible. j. Feature prominent display windows on the first floor of buildings with commercial and commercial service uses. k. Employ awnings, covered archways, covered patios, arcades, or trees to provide shade and to offer protection from sun and rain. l. Use traditional materials such as stucco, brick, stone, wood siding, terra cotta roof tiles, and wood-look shingles. m. Avoid the use of extremely bright or fluorescent hues (e.g., neon orange). n. Provide seating areas (e.g., benches, tables and chairs, low walled planters) and trash receptacles. These items should complement the building in style, material, and color. o. Encourage public open areas such as plazas that are designed for gathering and ancillary outdoor uses such as outdoor dining. p. Provide abundant landscaping (e.g., street trees, walled planters, window boxes, and/or pots along the building) to add color, fragrance, and soften the appearance of the building. Plant materials and sizes should be appropriate to their placement. q. Design lighting so that it provides adequate levels of lighting for security and safety, and to create a “comfortable” atmosphere. Use lighting to highlight landscaping. r. Place signs so pedestrians can easily see them. s. Encourage the provision of amenities such as water features (e.g., fountains), public art, and enhanced paving (e.g., colored paving, special paving designs). Appendix A THE GROVES AT LOMA LINDA SPECIFIC PLAN AA-22 t. Incorporate appropriate design details, such as street furniture (e.g., benches, trash enclosures and receptacles), fencing, and placement of murals and sculpture in public locations. u. Utilize streetlights that are pedestrian-oriented, attractively designed, compatible in design with other street furniture, and provide adequate visibility and security. v. Install “street furniture” (benches, bus shelters, planters, bike racks, trash receptacles, newspaper racks, water fountains, and bollards) within streetscapes to enhance the pedestrian experience and embellish pedestrian gathering places (places for sitting, meeting people, relaxing, people watching, etc.). It should be compatible with the streetscape theme, durable, easily maintained and easily replaced. w. The design and location of street furniture should avoid conflicts with driver sight lines and utilities. x. As pedestrian furniture is both in the public right-of-way and on private property, the style and placement of furniture should be coordinated on public and private property, and should avoid blocking travel on the sidewalk. Guiding Policy for Residentia l Development (3.1.9.1) Ensure quality of design for single-family and multi-family residential development in order to create and preserve functional and attractive residential neighborhoods that embody the strengths and accomplishments of the community and to preserve the economic investment of new and existing individual property owners. Residential Development Implementing Policies (3.1 .9.2) a. Neighborhood streets should be quiet, safe, and amenable to bicycle and pedestrian use. b. Locate parks and recreational areas as close to the center of the neighborhoods they serve as feasible. c. Provide individual neighborhoods with pathways and open spaces that connect residences to school and recreational facilities, thereby facilitating pedestrian and bicycle access. d. Create a distinct character for each residential neighborhood through the use of neighborhood signage, streetscapes and landscape buffers, a palette of various complementary architectural styles/materials, a complementary variety of dwelling setbacks and placement on the lot, and lot patterns that reflect the existing topography. e. Provide quality design and visual interest within a development by alternating the massing, layout, architectural details, accent materials, and colors so that adjacent dwelling units are not nearly identical. f. To reduce architectural massing, orient the shortest and lowest side of a corner residential dwelling unit toward the side street. THE GROVES AT LOMA LINDA SPECIFIC PLAN Appendix A AA-23 g. Where feasible, orient garages so that garage doors do not directly face the street (e.g., use of alleys, “side-on” garage configuration, and side loaded corner lots). Garage doors should be set back from the front face of the house so that residential tracts are more pedestrian/neighborhood friendly. h. Within multi-family developments, cluster residential buildings around open space and/or recreational features. i. Design the common space associated with each cluster of multi-family dwelling units to provide differences in size, dimensions, grading, amenities, and site furniture in order to create variety. j. In higher density projects with tuck-under parking and/or opposing garages, avoid the monotony of long parking corridors by turning individual units, staggering parking areas, and/or using an interesting variety of landscaping within parking areas. k. Provide each unit of a multi-family development project with some unique elements to create a sense of place and identity. Individual units within a multi-family development project should be distinguishable from each other, and should have separate entrances and entry paths, where feasible. l. Where residential infill development is proposed, ensure that the scale and massing of dwellings as well as the architectural character of new development is compatible with the existing residential neighborhood. x Setbacks for new residential units should continue the prevailing setback pattern, unless a different setback standard is required. x New development should incorporate representative characteristics of the surrounding area when the area exhibits a positive, distinctive site layout and/or established pattern. m. Structures that are historic or are otherwise distinctive should be preserved and incorporated into the design of new development. n. Variation in setbacks should be provided within single-family residential neighborhoods. Within multi-family developments, buildings should be oriented to avoid instances where the living spaces of one unit face the living spaces of another and significantly reduce indoor privacy. o. Ensure that applications for new single-family or multi-family residential projects require the submittal of site plans, elevations, and color and material boards. p. Residential developments should be oriented toward major streets so as not to give the impression of an enclave/compound. q. Promote and facilitate the development of custom and semi-custom home projects for move-up housing. Appendix A THE GROVES AT LOMA LINDA SPECIFIC PLAN AA-24 r. Reduced front setbacks should be encouraged with mixed housing types. Density in these developments should not be tiered but integrated throughout. s. Implement traffic calming on residential streets subject to high speed through travel in order to improve neighborhood livability. Traffic calming techniques such as narrower than standard streets, speed humps, neck-downs and traffic diverters, rough-paved crosswalks, roundabouts, and planted median islands at the entries into neighborhoods can successfully reduce undesirable through traffic within residential neighborhoods. t. The maximum residential building height shall not exceed thirty-five (35) feet. u. The minimum lot size for a single-family residence, regardless of density bonuses, shall not be less than seven thousand, two hundred (7,200) square feet in any planning area or zone. Guiding Policy for Adaptive Reuse a nd Preserva tion with New Development (3.2.1) Employ adaptive reuse of structures that have local historic value because of their scientific, aesthetic, educational, cultural, architectural, or historical significance in order to incorporate them into any new adjacent development and prevent their demolition. Also, preserve other physical elements that are cultural resources by incorporating them (either in their entirety or through a representative sample/re-creation if it would carry the same merit) into any future development of the area. Adaptive Reuse and Preservation with New Development Implementing Policies (3.2.1 .1) a. Retain the historic and architectural integrity when pursuing adaptive reuse of buildings, while aiming to meet the design policies set forth within the applicable category of the intended new use (i.e., auto-oriented commercial) to the greatest extent feasible. b. Sensitively site and design new adjacent buildings in order to preserve historic buildings, allow for viable access to them, and create a cohesive architectural character that reflects, and is compatible with, the historic building. c. Preserve the character of the existing citrus groves by preserving and incorporating strategically located existing trees or rows of existing trees into new development (i.e., in the form of landscaped setbacks and/or landscape treatments). Having accomplished this, the remaining grove may be removed. d. Include new citrus trees of a hearty variety and/or other species that are similar to resemble citrus trees within appropriate new or re-landscaped City rights-of-way. e. Encourage private development to use new citrus trees as landscape materials on any private property when feasible.