Loading...
HomeMy WebLinkAbout2019 09 17 Council CITY COUNCIL AGENDA 1 SETPTEMBER 17, 2019 CITY COUNCIL AGENDA CITY HALL COUNCIL CHAMBER 78495 Calle Tampico, La Quinta REGULAR MEETING ON TUESDAY, SEPTEMBER 17, 2019 3:00 P.M. CLOSED SESSION | 4:00 P.M. OPEN SESSION CALL TO ORDER ROLL CALL: Councilmembers: Fitzpatrick, Peña, Radi, Sanchez, Mayor Evans PUBLIC COMMENT ON MATTERS NOT ON THE AGENDA At this time, members of the public may address the City Council on any matter not listed on the agenda. Please complete a "Request to Speak" form and limit your comments to three minutes. The City Council values your comments; however in accordance with State law, no action shall be taken on any item not appearing on the agenda unless it is an emergency item authorized by GC 54954.2(b). CONFIRMATION OF AGENDA CLOSED SESSION 1. CONFERENCE WITH LEGAL COUNSEL – EXISTING LITIGATION PURSUANT TO PARAGRAPH (1) OF SUBDIVISION (d) of GOVERNMENT CODE SECTION 54956.9; NAME OF CASE: WASHINGTON-111, LTD., CLAIMANT, V. CITY OF LA QUINTA, RESPONDENT, JUDICATE WEST ALTERNATIVE DISPUTE RESOLUTION CASE NO. A257070. 2. CONFERENCE WITH LEGAL COUNSEL – ANTICIPATED LITIGATION SIGNIFICANT EXPOSURE TO LITIGATION PURSUANT TO PARAGRAPH (2) OR (3) OF SUBDIVISION (d) OF GOVERNMENT CODE SECTION 54956.9 (NUMBER OF POTENTIAL CASES: 1) 3. CONFERENCE WITH LEGAL COUNSEL – ANTICIPATED LITIGATION SIGNIFICANT EXPOSURE TO LITIGATION PURSUANT TO PARAGRAPH (2) OR (3) OF SUBDIVISION (d) OF GOVERNMENT CODE SECTION 54956.9 (NUMBER OF POTENTIAL CASES: 1) City Council agendas and staff reports are available on the City’s web page: www.LaQuintaCA.gov CITY COUNCIL AGENDA 2 SETPTEMBER 17, 2019 4. CONFERENCE WITH LABOR NEGOTIATORS PURSUANT TO GOVERNMENT CODE SECTION 54957.6; CITY DESIGNATED REPRESENTATIVE: CHRIS ESCOBEDO, DIRECTOR OF COMMUNITY RESOURCES; AND EMPLOYEE ORGANIZATION: LA QUINTA CITY EMPLOYEES’ ASSOCIATION RECESS TO CLOSED SESSION RECONVENE AT 4:00 P.M. REPORT ON ACTIONS(S) TAKEN IN CLOSED SESSION PLEDGE OF ALLEGIANCE PUBLIC COMMENT ON MATTERS NOT ON THE AGENDA At this time, members of the public may address the City Council on any matter not listed on the agenda. Please complete a "Request to Speak" form and limit your comments to three minutes. The City Council values your comments; however in accordance with State law, no action shall be taken on any item not appearing on the agenda unless it is an emergency item authorized by GC 54954.2(b). ANNOUNCEMENTS, PRESENTATIONS, AND WRITTEN COMMUNICATIONS 1. LEADERSHIP INVESTMENT AND KNOWLEDGE SHARING (LINKS) – CITY OF LA QUINTA ACADEMY RECOGNITION 2. PROCLAMATION IN RECOGNITION OF CONSTITUTION WEEK – SEPTEMBER 17-23, 2019, COMMEMORATING THE SIGNING OF THE U. S. CONSTITUTION CONSENT CALENDAR NOTE: Consent Calendar items are routine in nature and can be approved by one motion. PAGE 1. APPROVE MINUTES OF AUGUST 6, 2019 7 2. AUTHORIZE OVERNIGHT TRAVEL FOR THE FINANCE DIRECTOR AND TWO FINANCE DEPARTMENT EMPLOYEES TO ATTEND THE CALIFORNIA SOCIETY OF MUNICIPAL FINANCE OFFICERS (CSMFO) CONFERENCE IN ANAHEIM, CALIFORNIA, JANUARY 28 – 31, 2020 21 3. AUTHORIZE OVERNIGHT TRAVEL FOR ACCOUNTANT TECHNICIAN TO ATTEND THE CALIFORNIA ASSOCIATION OF PUBLIC PROCUREMENT OFFICIALS (CAPPO) ANNUAL CONFERENCE IN SAN DIEGO, CALIFORNIA, FEBRUARY 17 – 21, 2020 23 CITY COUNCIL AGENDA 3 SETPTEMBER 17, 2019 4. AUTHORIZE OVERNIGHT TRAVEL FOR THE COMMUNITY RESOURCES DIRECTOR TO ATTEND THE CALIFORNIA PUBLIC EMPLOYERS LABOR RELATIONS ASSOCIATION TRAINING CONFERENCE IN MONTEREY, CALIFORNIA, NOVEMBER 19 – 22, 2019 25 5. AUTHORIZE OVERNIGHT TRAVEL FOR FACILITIES MAINTENANCE WORKER I TO ATTEND THE INTERNATIONAL MUNICIPAL SIGNAL ASSOCIATION COURSE IN ONTARIO, CALIFORNIA, NOVEMBER 4 – 7, 2019 27 6. EXCUSE ABSENCES FOR PLANNING COMMISSIONERS McCUNE AND PROCTOR FROM THE SEPTEMBER 24, 2019 MEETING, AND PLANNING COMMISSIONER CALDWELL FROM THE OCTOBER 8, 2019 MEETING 29 7. ADOPT RESOLUTION TO AUTHORIZE THE ADOPTION OF CALTRANS’ LOCAL ASSISTANCE PROCEDURES MANUAL CHAPTER 10 [RESOLUTION NO. 2019-034] 31 8. ADOPT RESOLUTION TO APPROVE TIME EXTENSION TO COMPLETE ON-SITE IMPROVEMENTS FOR THE CAPISTRANO RESIDENTIAL DEVELOPMENT (TRACT MAP NO. 31910) LOCATED ON THE WEST SIDE OF MONROE STREET APPROXIMATELY 1,300 FEET NORTH OF AVENUE 58 [RESOLUTION NO. 2019-035] 117 9. ADOPT RESOLUTION TO APPROVE TIME EXTENSION TO COMPLETE ON-SITE IMPROVEMENTS FOR GRIFFIN RANCH RESIDENTIAL DEVELOPMENT (TRACT MAP NO. 32879) LOCATED AT THE SOUTHEAST CORNER OF AVENUE 54 AND MADISON STREET [RESOLUTION NO. 2019-036] 125 10. APPROPRIATE FUNDS, APPROVE PLANS, SPECIFICATIONS, ENGINEER’S ESTIMATE, AND ADVERTISE FOR BID THE FRITZ BURNS PARK SIDEWALK AND PARKING PROJECT LOCATED ON THE NORTH SIDE OF FRANCIS HACK LANE ALONG THE SKATE PARK (PROJECT NO. 2017-22) 139 11. ACCEPT OFF-SITE AND ON-SITE IMPROVEMENTS ASSOCIATED WITH THE MONTERRA RESIDENTIAL DEVELOPMENT (TRACT MAP NO. 32742 LOCATED ON MONROE STREET BETWEEN AVENUE 54 AND AIRPORT BOULEVARD 143 12. APPROVE AGREEMENT FOR CONTRACT SERVICES WITH CASC ENGINEERING AND CONSULTING FOR ON-CALL STORMWATER COMPLIANCE INSPECTION SERVICES 147 CITY COUNCIL AGENDA 4 SETPTEMBER 17, 2019 13.APPROVE AGREEMENT FOR CONTRACT SERVICES WITH ST. FRANCIS ELECTRIC FOR ON-CALL TRAFFIC SIGNAL REPAIR SERVICES 185 14.APPROVE DEMAND REGISTERS DATED AUGUST 2, 9, 16, 23, AND 30, 2019 223 15. RECEIVE AND FILE FOURTH QUARTER 2018/19 TREASURY REPORTS FOR APRIL, MAY, AND JUNE 2019, WITH FISCAL YEAR-END SUMMARY 265 16. AWARD AGREEMENT FOR CONTRACT SERVICES TO DESERT LIMNOLOGISTS, INC., DBA SOUTHWEST AQUATICS FOR CIVIC CENTER CAMPUS LAKE MAINTENANCE SERVICES (PROJECT NO. 2019-11) 291 BUSINESS SESSION - NONE STUDY SESSION PAGE 1. DISCUSS SHORT-TERM VACATION RENTAL PROGRAM AND CODE COMPLIANCE UPDATES 329 PUBLIC HEARINGS – after 5:00 p.m. For all Public Hearings on the agenda, a completed “Request to Speak” form must be filed with the City Clerk prior to consideration of that item. A person may submit written comments to City Council before a public hearing or appear in support or opposition to the approval of a project(s). If you challenge a project(s) in court, you may be limited to raising only those issues you or someone else raised at the public hearing or in written correspondence delivered to the City at, or prior to the public hearing. PAGE 1.ADOPT RESOLUTION TO APPROVE AND ADOPT THE RELOCATION PLAN PREPARED FOR THE ACQUISITION OF PERMANENT ROADWAY AND PUBLIC UTILITY EASEMENT INTERESTS IN A PORTION OF CERTAIN REAL PROPERTY IDENTIFIED AS ASSESSOR PARCEL NO. 600-030-010, 46400 DUNE PALMS ROAD, LOCATED IN LA QUINTA, RIVERSIDE COUNTY, CALIFORNIA, FOR THE DUNE PALMS ROAD BRIDGE PROJECT (PROJECT NO. 2011-05/111205) [RESOLUTION NO. 2019-037] 333 2. ADOPT RESOLUTIONS DECLARING THE PUBLIC INTEREST AND NECESSITY TO ACQUIRE PORTIONS OF PROPERTIES LOCATED AT: (1) 46400 DUNE PALMS ROAD; (2) 79440 CORPORATE CENTER DRIVE; AND (3) ASSESSOR PARCEL NUMBER 600-030-018, FOR THE DUNE PALMS ROAD BRIDGE PROJECT (PROJECT NO. 2011-05/111205) THROUGH EMINENT DOMAIN [RESOLUTION NOS. 2019-038, 2019-039, AND 2019-040] 407 CITY COUNCIL AGENDA 5 SETPTEMBER 17, 2019 DEPARTMENTAL REPORTS PAGE 1. CITY MANAGER 2. CITY ATTORNEY 3. CITY CLERK 4. COMMUNITY RESOURCES 5. DESIGN AND DEVELOPMENT A. MONTHLY DEPARTMENT REPORT – JULY 2019 B. MONTHLY DEPARTMENT REPORT – AUGUST 2019 451 455 6. FACILITIES A. MONTHLY DEPARTMENT REPORT – JULY 2019 B. MONTHLY DEPARTMENT REPORT – AUGUST 2019 459 493 7. FINANCE MAYOR’S AND COUNCIL MEMBERS’ ITEMS REPORTS AND INFORMATIONAL ITEMS 1. CVAG COACHELLA VALLEY CONSERVATION COMMISSION (Evans) 2. CVAG ENERGY AND ENVIRONMENTAL RESOURCES COMMITTEE (Evans) 3. CVAG EXECUTIVE COMMITTEE (Evans) 4. GREATER PALM SPRINGS CONVENTION AND VISITORS BUREAU (Evans) 5. LEAGUE OF CALIFORNIA CITIES DELEGATE (Evans) 6. COACHELLA VALLEY WATER DISTRICT JOINT POLICY COMMITTEE (Evans) 7. SOUTHERN CALIFORNIA ASSOCIATION OF GOVERNMENTS (Evans) 8. ECONOMIC DEVELOPMENT SUBCOMMITTEE (Evans & Radi) 9. COACHELLA VALLEY MOUNTAINS CONSERVANCY (Fitzpatrick) 10. DESERT RECREATION DISTRICT COMMITTEE (Fitzpatrick and Radi) 11. COACHELLA VALLEY UNIFIED SCHOOL DISTRICT COMMITTEE (Fitzpatrick & Peña) 12. RIVERSIDE COUNTY TRANSPORTATION COMMISSION (Fitzpatrick) 13. SILVERROCK EVENT SITE AD HOC COMMITTEE (Fitzpatrick) 14. CANNABIS AD HOC COMMITTEE (Peña and Sanchez) 15. CVAG PUBLIC SAFETY COMMITTEE (Peña) 16. EAST VALLEY COALITION (Peña) 17. CVAG VALLEY-WIDE HOMELESSNESS COMMITTEE (Peña) 18. LEAGUE OF CALIFORNIA CITIES – PUBLIC SAFETY POLICY COMMITTEE (Peña) 19. CHAMBER OF COMMERCE INFO EXCHANGE COMMITTEE (Peña) 20. CVAG TRANSPORTATION COMMITTEE (Radi) 21. SUNLINE TRANSIT AGENCY (Radi) 22. CITYWIDE SECURITY CAMERAS AD HOC COMMITTEE (Radi) 23. DESERT SANDS UNIFIED SCHOOL DISTRICT COMMITTEE (Radi and Sanchez) 24. ANIMAL CAMPUS COMMISSION (Sanchez) 25. COACHELLA VALLEY ECONOMIC PARTNERSHIP (Sanchez) 26. LEAGUE OF CALIFORNIA CITIES – GOVERNANCE, TRANSPARENCY AND LABOR POLICY COMMITTEE (Sanchez) CITY COUNCIL AGENDA 6 SETPTEMBER 17, 2019 27. RIVERSIDE LOCAL AGENCY FORMATION COMMISSION (Sanchez) 28. FINANCIAL ADVISORY COMMISSION SPECIAL MEETING MINUTES DATED JUNE 5, 2019 527 ADJOURNMENT ********************************* The next regular meeting of the City Council will be held on October 1, 2019 at 4:00 p.m. at the City Hall Council Chambers, 78495 Calle Tampico, La Quinta, CA 92253. DECLARATION OF POSTING I, Monika Radeva, City Clerk, of the City of La Quinta, do hereby declare that the foregoing Agenda for the La Quinta City Council meeting was posted on the City’s website, near the entrance to the Council Chambers at 78495 Calle Tampico, and the bulletin boards at the Stater Brothers Supermarket at 78630 Highway 111, and the La Quinta Cove Post Office at 51321 Avenida Bermudas, on September 13, 2019. DATED: September 13, 2019 MONIKA RADEVA, City Clerk City of La Quinta, California Public Notices  The La Quinta City Council Chamber is handicapped accessible. If special equipment is needed for the hearing impaired, please call the City Clerk’s office at (760) 777-7092, twenty-four (24) hours in advance of the meeting and accommodations will be made.  If special electronic equipment is needed to make presentations to the City Council, arrangements should be made in advance by contacting the City Clerk’s office at (760) 777-7092. A one (1) week notice is required.  If background material is to be presented to the Councilmembers during a City Council meeting, please be advised that eight (8) copies of all documents, exhibits, etc., must be supplied to the City Clerk for distribution. It is requested that this take place prior to the beginning of the meeting.  Any writings or documents provided to a majority of the City Council regarding any item(s) on this agenda will be made available for public inspection at the Community Development counter at City Hall located at 78495 Calle Tampico, La Quinta, California, 92253, during normal business hours. CITY COUNCIL MINUTES Page 1 of 14 AUGUST 6, 2019 CITY COUNCIL MINUTES TUESDAY, AUGUST 6, 2019 CALL TO ORDER A regular meeting of the La Quinta City Council was called to order at 3:00 p.m. by Mayor Evans. PRESENT: Councilmembers Fitzpatrick, Peña, Radi, Sanchez, Mayor Evans ABSENT: None PUBLIC COMMENT ON MATTERS NOT ON THE AGENDA – None CONFIRMATION OF AGENDA Councilmember Sanchez requested to pull Consent Calendar Item Nos. 6 and 8 for comments and separate vote. Councilmember Sanchez requested to comment on Consent Calendar Item No. 18. Councilmember Peña requested to pull for separate vote Consent Calendar Item No. 15. Council concurred. CLOSED SESSION 1. CONFERENCE WITH LEGAL COUNSEL—EXISTING LITIGATION PURSUANT TO GOVERNMENT CODE SECTION 54956.9(d)(1); NAME OF CASE: LA QUINTA POLO ESTATES ASSOCIATION, INC. V CITY OF LA QUINTA, ET AL. RIVERSIDE COUNTY SUPERIOR COURT CASE NO. PSC1900574 2. CONFERENCE WITH REAL PROPERTY NEGOTIATORS PURSUANT TO GOVERNMENT CODE SECTION 54956.8 FOR PROPERTIES LISTED BELOW; CITY NEGOTIATOR: JON MCMILLEN, CITY MANAGER NEGOTIATING PARTIES: OWNERS LISTED BELOW UNDER CONSIDERATION: PRICE AND TERMS OF PAYMENT 46400 DUNE PALMS ROAD; APN 600-030-010 (PORTION) – CHIN FAMILY PROPERTIES LP – OWNER CONSENT CALENDAR ITEM NO. 1 7 CITY COUNCIL MINUTES Page 2 of 14 AUGUST 6, 2019  2. 46400 DUNE PALMS ROAD; APN 600-030-010 (SPACE 1 MOBILE HOME COACH) – IVETTE ONTIVEROS – OWNER  3. 46400 DUNE PALMS ROAD, APN 600-030-010 (SPACE 31 MOBILE HOME COACH) – HILDA BEDOLLA – OWNER  4. APN 600-030-018 (PORTION) – DWCG1, LLC – OWNER  5. 79440 CORPORATE CENTER DRIVE; APN 600-390-033 (PORTION) – JAMES R. PAUL AND SHARON L. PAUL, TRUSTEES – OWNER 3. CONFERENCE WITH LEGAL COUNSEL – ANTICIPATED LITIGATION SIGNIFICANT EXPOSURE TO LITIGATION PURSUANT TO PARAGRAPH (2) OR (3) OF SUBDIVISION (d) OF GOVERNMENT CODE SECTION 54956.9 (NUMBER OF POTENTIAL CASES: 1) COUNCIL RECESSED THE OPEN SESSION PORTION OF THE MEETING AND MOVED INTO CLOSED SESSION AT 3:02 P.M. MAYOR EVANS RECONVENED THE OPEN SESSION PORTION OF THE CITY COUNCIL MEETING AT 4:01 P.M. WITH ALL MEMBERS PRESENT REPORT ON ACTION(S) TAKEN IN CLOSED SESSION: City Attorney Ihrke reported the following pursuant to Government Code section 54957.1 (Brown Act):  Closed Session Item No. 1 – no action was taken that require reporting;  Closed Session Item No. 2  As reported on May 21, 2019, from Closed Session Item No. 4, Council voted unanimously to approve amounts as just compensation for real properties or portions hereof, which are identified in Closed Session Item No. 2 for this meeting; and authorized the City’s Negotiators to make offers to the owners and execute contracts for acquisition for the real properties or portions thereof;  Pursuant to Government Code Section 54957.1 (a)(1)(A) and 54956.8, the City Council voted unanimously today to approve and offer to acquire a portion of real property at 79440 Corporate Center Drive, identified as property No. 5 under this agenda item. The general terms of the agreement are to acquire a permanent slope easement for a price that was mutually agreed upon; the sellers are the trustees of the James Paul & Sharon Paul Charitable Remainder Trust, dated March 15, 2019, and the buyer is the City of La Quinta;  Council voted unanimously to authorize the City’s Negotiator to execute relocation settlement agreements with persons who may be displaced by the acquisition of any of the remaining properties identified under this agenda item, with estimated amounts for relocation costs determined pursuant to Government Code section 8 CITY COUNCIL MINUTES Page 3 of 14 AUGUST 6, 2019 7260 et. seq and implementing regulations. If and when any contract for a negotiated acquisition and relocation settlement agreement is executed, it will be a public record pursuant to state law; and  Closed Session Item No. 3 – no action was taken that require reporting. PLEDGE OF ALLEGIANCE Councilmember Peña led the audience in the Pledge of Allegiance. PUBLIC COMMENT ON MATTERS NOT ON THE AGENDA PUBLIC SPEAKER: Dale Tyreman, La Quinta – welcomed new City Manager McMillen; spoke about a newspaper article regarding the potential development of a public surf park on Madison Street, related inquiries with the property owners and other parties, and possible resident concerns. Mayor Evans noted that currently no application for a public surf park has been submitted to the City. PUBLIC SPEAKER: John Gamlin, Project Executive, SilverRock Development Co. – gave a presentation on the SilverRock site development progress, design and construction timeline. ANNOUNCEMENTS, PRESENTATIONS AND WRITTEN COMMUNICATIONS City Manager McMillen introduced the following new City staff members:  Sandra Laureano, Junior Accountant in the Finance Department  Natasha Cousins, Administrative Assistant in the City Clerk Department  Sijifredo Fernandez, Associate Planner in the Planning Department 1. CITY OF LA QUINTA’S CALIFORNIA JOINT POWERS INSURANCE AUTHORITY (CJPIA) 2019 RISK MANAGEMENT AWARD FOR BEST OVERALL PERFORMANCE WORKERS’ COMPENSATION PROGRAM Councilmember Radi said the City received “2019 Best Overall Performance Workers’ Compensation Program” award from CJPIA; commended Staff for their work and mitigating risk for the City; and asked Community Resources Director Escobedo, Human Resources Manager Scott, and Management Specialist Nieto to come up to the podium to accept the award. Alex Mellor, City’s Regional Manager with CJPIA explained the criteria used to select a winner for this award, and the City’s effective efforts to mitigate risk over the last few years. 9 CITY COUNCIL MINUTES Page 4 of 14 AUGUST 6, 2019 2. DESERT CENTER LEGAL PUBLIC EDUCATION NON-PROFIT PRESENTATION BY PATRICK DOLAN, ESQ. Patrick Dolan, Dean of the California Desert Trial Academy College of Law (CDTA), gave a brief presentation about the programs; provided student pass rate statistics; and encouraged Council to visit. 3. INTRODUCE SUMMER INTERN PROGRAM PARTICIPANTS Human Resources Analyst Triplett explained the City’s Summer Internship Program and introduced the City’s interns; and each spoke briefly about their education, background, experience interning for the City, and future aspirations:  Yaelin Padilla, Economic Development Intern in the City Manager’s Office;  Jacob Garcia, Management Analyst Intern in the Community Resources Department;  Adrian Moreno, Planning Intern in the Design and Development Department; and  Aeysha Khalid, Account Technician Intern in the Finance Department. Councilmember Peña asked Council and the audience for a moment of silence for the victims from the August 3, 2019, El Paso, Texas, mass shooting at a Walmart store. CONSENT CALENDAR 1. APPROVE SPECIAL MEETING – COMMUNITY WORKSHOP “FUTURE ART EVENT” MINUTES OF JULY 10, 2019 2. APPROVE MINUTES OF JULY 16, 2019 3. AUTHORIZE OVERNIGHT TRAVEL FOR MARKETING SPECIALIST TO ATTEND RAGAN COMMUNICATIONS’ BRAND STORYTELLING AND CONTENT MARKETING CONFERENCE IN ANAHEIM, CALIFORNIA, SEPTEMBER 18-20, 2019 4. APPROVE DEMAND REGISTERS DATED JULY 12, 19, AND 26, 2019 5. APPROVE PLANS, SPECIFICATIONS, ENGINEER’S ESTIMATE, AND ADVERTISE FOR BID THE FISCAL YEAR 2019/20 PAVEMENT MANAGEMENT PLAN SLURRY SEAL IMPROVEMENTS LOCATED ON AVENUE 54, MADISON STREET, AND AVENUE 58 (PROJECT NO. 2019-10) 10 CITY COUNCIL MINUTES Page 5 of 14 AUGUST 6, 2019 6. pulled for separate vote by Councilmember Sanchez >>> AWARD CONTRACT TO DBX, INC IN THE AMOUNT OF $1,612,316 FOR THE HIGHWAY SAFETY IMPROVEMENT PROGRAM CITYWIDE FIBER OPTIC SIGNAL INTERCONNECT PROJECT (PROJECT NO. 2016- 02) FOR FIBER OPTIC INTERCONNECT CONSTRUCTION SERVICES TO UPGRADE TRAFFIC SIGNAL COMMUNICATION 7. AWARD CONTRACT TO HARDY & HARPER, INC IN THE AMOUNT OF $227,006 FOR THE HIGHWAY 111 SIDEWALK IMPROVEMENTS PROJECT LOCATED ON THE SOUTH SIDE OF HIGHWAY 111, BETWEEN ADAMS STREET AND LA QUINTA DRIVE (PROJECT NO. 2018-03) 8. pulled for separate vote by Councilmember Sanchez >>> AWARD CONTRACT TO URBAN HABITAT IN THE AMOUNT OF $4,218,880; AND APPROVE CITY RESTROOM PURCHASE TO ROMTEC IN THE AMOUNT OF $234,138 FOR THE SILVERROCK PARK VENUE PROJECT LOCATED ON THE SOUTHEAST CORNER OF SILVERROCK WAY AND AVENUE 52 (PROJECT NO. 2016-08) 9. ACCEPT PAVEMENT MANAGEMENT PLAN FISCAL YEAR 2018/19 AVENUE 52 PAVEMENT REHABILITATION AND MISCELLANEOUS STRIPING MODIFICATIONS PROJECT LOCATED ON AVENUE 52(PROJECT NO. 2018-07) 10. AUTHROIZE PURCHASES WITH PALMS TO PINES PRINTING FOR UP TO $90,000 FOR FISCAL YEAR 2019/20 11. AUTHORIZE CONTRACTING WITH VINTAGE ASSOCIATES, INC FOR UP TO $184,200 OF ADDITIONAL WORK FOR FISCAL YEAR 2019/20, WHEN VINTAGE ASSOCIATES, INC IS THE QUALIFIED AND/OR LOWEST BID 12. AUTHORIZE CONTRACTING WITH PWLC II, INC FOR UP TO $150,000 OF ADDITIONAL WORK FOR FISCAL YEAR 2019/20, WHEN PWLC II, INC IS THE QUALIFIED AND/OR LOWEST BID 13. AUTHORIZE CONTRACTING WITH CREATIVE LIGHTING & ELECTRICAL, INC. FOR UP TO $150,000 OF ADDITIONAL WORK FOR FISCAL YEAR 2019/20, WHEN CREATIVE LIGHTING & ELECTRICAL, INC. IS THE QUALIFIED AND/OR LOWEST BID 11 CITY COUNCIL MINUTES Page 6 of 14 AUGUST 6, 2019 14. APPROVE AGREEMENT FOR CONTRACT SERVICES WITH TERRA NOVA PLANNING & RESEARCH, INC. FOR ON-CALL PLANNING SERVICES 15. pulled for separate vote by Councilmember Peña >>> ADOPT RESOLUTION TO APPROVE SECOND EXTENSION OF TIME FOR SITE DEVELOPMENT PERMIT 2014-1003 AND TENTATIVE TRACT MAP 36744, FOR THE ESTATES AT GRIFFIN LAKE DEVELOPMENT, LOCATED ON THE SOUTH SIDE OF AVENUE 54, ONE QUARTER MILE EAST OF MADISON STREET [RESOLUTION NO. 2019-032] 16. AUTHORIZE SUBMISSION OF GRANT APPLICATION FOR NATIONAL ENDOWMENT FOR THE ARTS’ OUR TOWN CREATIVE PLACEMAKING PROGRAM TO INTEGRATE ART AND CULTURE INTO COMMUNITY PROJECTS 17. APPROVE GRANT OF EASEMENT TO SOUTHERN CALIFORNIA GAS COMPANY FOR GAS LINES TO THE ADJOINING PROPERTY FOR THE CONSTRUCTION OF THE RESIDENTS INN BY MARRIOTT 18. pulled for separate vote by Mayor Evans >>> APPROVE PLANS, SPECIFICATIONS, ENGINEER’S ESTIMATE, AND ADVERTISE FOR BID THE CALLE TECATE PARKING LOT IMPROVEMENTS (PROJECT NO. 2019-13) MOTION – A motion was made and seconded by Councilmembers Peña/Fitzpatrick to approve Consent Calendar Item Nos. 1-5, 7, 9-14, and 16- 17. Motion passed unanimously. CONSENT CALENDAR ITEM NO. 6 Traffic Operations Analyst Gunterson presented the staff report, which is on file in the Clerk’s Office; and explained the need to upgrade City’s current traffic signal infrastructure. Council discussed the importance of broadband; the need to invest in fiber optic to bring the City’s traffic infrastructure into the 21st century; how La Quinta compares with the other Coachella Valley cities; this project will benefit not only La Quinta, but all valley cities as it will tie in with the Highway 111 traffic synchronization project spearheaded by the Coachella Valley Association of Governments; $1.9 million of this project is funded by federal grants, and commended Staff for securing the grant funding and executing the project. 12 CITY COUNCIL MINUTES Page 7 of 14 AUGUST 6, 2019 MOTION – A motion was made and seconded by Councilmembers Radi/Fitzpatrick to approve the Consent Calendar Item No. 6. Motion passed unanimously. CONSENT CALENDAR ITEM NO. 8 Council discussed the SilverRock Park Venue project components; noted Urban Habitat has worked on many capital improvement projects for the City; the project is partially funded with Measure G revenues; the site is a potential expansion opportunity for future art festivals and events, and will provide an additional venue for activities to the Pendry and Montage hotels. MOTION – A motion was made and seconded by Councilmembers Radi/Fitzpatrick to approve Consent Calendar Item No. 8 as recommended. Motion passed unanimously. CONSENT CALENDAR ITEM NO. 15 Councilmember Peña said he voted against the first extension for this residential development (Estates at Griffin Lake) back in 2017, and his vote will remain the same for the second extension. Councilmember Radi expressed concerns that the project is being extended again, but will vote in support of the extension. MOTION – A motion was made and seconded by Councilmembers Fitzpatrick/Radi to approve Consent Calendar Item No. 15 as recommended, adopting Resolution No. 2019-032. Motion passed: ayes 4, noes 1 (Peña), absent 0. CONSENT CALENDAR ITEM NO. 18 >>> pulled for a separate vote by Mayor Evans due to a request to speak from the public. Mayor Evans said this item would approve the plans and bid advertisement for the Calle Tecate Parking Lot project and briefly explained the history of this item. Councilmember Sanchez said the City is able to provide solutions to the parking concerns along Calle Tecate because citizens brought awareness to this item; and encouraged citizen engagement to help resolve issues, concerns, or express ideas. PUBLIC SPEAKER: William Cranham, La Quinta – spoke about the safety concerns of the existing parking situation; said he is in support of the proposed additional parking lot; and requested that the street parking along Calle Tecate be removed sooner than December, when the new parking lot is anticipated to be completed, due to safety concerns. 13 CITY COUNCIL MINUTES Page 8 of 14 AUGUST 6, 2019 Council inquired about the process and timeline to remove the street striping allowing parking along Calle Tecate. Staff said Calle Tecate street striping would be added to the City’s fiscal year 2019/20 Pavement Management Plan project, approved under Consent Calendar Item No. 5 tonight; and removal can be initiated in October 2019. MOTION – A motion was made and seconded by Councilmembers Radi/Peña to approve Consent Calendar Item No. 18 as recommended. Motion passed unanimously. BUSINESS SESSION 1. INTERVIEW AND SELECT AN EVENT PRODUCER TO PRODUCE A SIGNATURE ART EVENT ON MARCH 5-8, 2020 AND AUTHORIZE THE CITY MANAGER TO EXECUTE THE CONTRACT FOR SERVICES Community Resources Director Escobedo commended Staff and the Art Committee members for their efforts to get this event underway. Council and Staff thanked the Art Committee members for their time, hard work, and engagement:  Shelley Glickstein, Producer of Art on Main Street  Kathy Caldwell, Artist  Kathleen Hughes, retired Fine Art Event Director  Sherrell Blakeley, Community Services Commissioner  Kay Wolf, long time La Quinta resident Management Analyst Torres, Community Resources Manager Calderon, and Community Resources Director Escobedo presented the staff report, which is on file in the Clerk’s Office. Community Resources Director Escobedo conducted a random drawing resulting in the following interview order: 1. Thunderbird Artists 2. Paul Anderson Denise Colter, President of Thunderbird Artists gave a presentation of the company’s history, experience, qualifications, past event rankings, artists selection process, and plan to produce La Quinta’s art event. Council and Ms. Colter discussed the producer’s ability to attract new buyers; ability to respond to unexpected weather challenges; ensure compliance and properly set up the event site; event site size comparison with other shows they have produced; securing alternative parking options if needed; what makes their show stand out; volunteer participation and training; artist 14 CITY COUNCIL MINUTES Page 9 of 14 AUGUST 6, 2019 selection and pool; securing ABC license for the event; average number of art events they produce annually is six to seven; availability of staff resources; collaboration with non-profit organizations to recruit volunteers and donations; cost per boot and sales commission; importance to maintain the number one spot for La Quinta and making the event stand out; juried process; balancing music and entertainment with the art component; marketing efforts and advertising to ensure attendees; and ticket cost for attending the event. COUNCIL RECESSED THE MEETING FOR A SHORT BREAK AT 5:50 P.M. MAYOR EVANS RECONVENED THE CITY COUNCIL MEETING AT 5:57 P.M. WITH ALL MEMBERS PRESENT Paul Anderson gave a presentation on his background, experience, qualifications; spoke of the importance of the artists and patrons to produce a quality art event; and how he plans to produce La Quinta’s art event. Council and Mr. Anderson discussed the producer’s ability to attract new patrons; need to add a digital art pavilion into the event to keep up with changing demographics and technology; importance to emulate the La Quinta Arts Festival, and enhance the experience; friends of the art VIP lounge; art must evoke emotion; working with a local non-profit organization, Tools For Tomorrow, which offers after school programs, and promotes cognitive, emotional, and social skills by offering children a hands-on experience in art, music, etc.; to facilitate volunteers for the event; opening night gathering for the artists; working with school groups to provide opportunities for local students to visit the event, and offer digital interactive features that can provide information on the art and artists via phone applications; importance to implement set up procedures to ensure safety; having alternative plans to mitigated unexpected weather challenges; commended the efforts and hard work of the past art director; cost per booth and sales commission; most common artists’ complaints, and the importance that the producer takes care of the artists; current location size; parking challenges and available solutions; potential usage of the future SilverRock event site; use of volunteers; patrons advertise the event by wearing clothing and accessories with the event name; producer’s team, their qualifications and commitment to organize and produce the event; importance to collaborate with all involved; having a local office and local contact; possible challenges from the Village Complete Streets project underway in the village; use of off-site parking sites and offering shuttle transportation to the event site; estimated cost to produce the event and financial stability; average number of attendees per event; balancing entertainment with the art component and the patrons; approximately 40% of the artists that have participated in the La Quinta Art Festival, also participate in the Sausalito Art Festival; the importance to have a dedicated 15 CITY COUNCIL MINUTES Page 10 of 14 AUGUST 6, 2019 team to produce this event based on the aggressive timeline; and a summary report outlining the event statistics, such as revenues and expenses by category, number of volunteers, etc. Council invited the Art Committee members to share their experience and provide comments. Committee Members Blakeley, Caldwell, Hughes, and Glickstein spoke about their background; their experience with the art producer interview, and guiding principles in the selection process; and commended Staff for facilitating and organizing the process so well. Committee Member Blakeley noted Committee Member Hughes recused herself from discussion and vote on the art producer selection because both art producer finalists listed in their proposals that they would potentially try to procure her services as a consultant or employee. Council asked Staff to elaborate on the comments received from the Art Committee. Staff noted that Paul Anderson was the Committee’s top choice, but that proof of financial stability had not been confirmed until earlier that day. Council thanked the community for their input and commended Staff for all the hard work to keep the aggressive timeline. Mayor Evans announced that Council will cast their votes by ballot. Results of the Ballot Vote: Councilmember Fitzpatrick – Paul Anderson Councilmember Peña – Paul Anderson Councilmember Radi – Paul Anderson Councilmember Sanchez – Paul Anderson Mayor Evans – Paul Anderson MOTION – A motion was made and seconded by Councilmembers Sanchez/Radi to select Paul Anderson to produce the signature art event for the City of La Quinta on March 5-8, 2020; and authorize the City Manager to execute the contract for services as recommended. Motion passed unanimously. PUBLIC COMMENT ON MATTERS NOT ON THE AGENDA >>> Added PUBLIC SPEAKER: Mary Borneman, La Quinta – said she is a resident at Seasons at Miraflores senior apartments; the apartment accommodations are lovely; expressed concerns that landscape maintenance starts very early in 16 CITY COUNCIL MINUTES Page 11 of 14 AUGUST 6, 2019 the morning, and interrupts senior residents’ sleep; and requested that Council consider granting an exemption, so that landscape maintenance starts at a later time, to better accommodate the needs of senior residents. 2. APPROPRIATE FUNDS AND AWARD CONTRACT TO SHARK POOLS FOR CLEANING AND MAINTENANCE SERVICES FOR FRITZ BURNS POOL, LA QUINTA PARK WATER FEATURE, AND MISTER SYSTEMS Community Resources Manager Calderon and Maintenance and Operations Superintendent Ambriz presented the staff report, which is on file in the Clerk’s Office. Council discussed notification and remedy process to address any potential vandalism at the La Quinta Park water feature; the request for additional funds is due to costs related to the Fritz Burns pool increased operations and additional services to maintain the park mister systems; historically Shark Pools was maintaining the pool and related costs, and park maintenance Staff was maintaining the park mister systems; established City procurement procedures for contract services; Desert Recreation District’s performance and progress on the pool operations and aquatics programming; pool cleaning and maintenance will be conducted twice per day under this contract; and importance to monitor pool maintenance and operational costs and revenues. MOTION – A motion was made and seconded by Councilmembers Peña/Fitzpatrick to appropriate $22,900 from the General Fund to Fritz Burns Pool and La Quinta Park Water Feature budgets; Award a Contract Services Agreement with Shark Pools to provide year-round cleaning and maintenance of Fritz Burns Pool, La Quinta Park Water Feature, and mister systems; and authorize the City Manager to execute the Agreement as recommended. Motion passed unanimously. 3. APPROPRIATE FUNDS TO LEASE A NEW PUBLIC WORKS MAINTENANCE TRAILER FROM PACIFIC MOBILE, INC. Assistant to the City Manager Villalpando introduced Interim Management Analyst Hansen and Facilities Analyst Berumen who presented the staff report, which is on file in the Clerk’s Office. Council discussed the quality of the proposed new trailer, its holding capacity, and lease costs; considering purchasing a new trailer instead of leasing it to meet the City’s long term needs for a new office space at the maintenance yard, versus building a permanent structure; ability to customize the trailer to match the City’s operational needs, and add showers, kitchen, reception area, offices, conference room for meetings and classes, and provide larger occupancy space; currently underway are efforts to complete the design and 17 CITY COUNCIL MINUTES Page 12 of 14 AUGUST 6, 2019 space assessment of the Corporate Yard Campus as part of the City’s Capital Improvement Program; this item will ensure a functional and safe facility for the maintenance crew, while the Corporate Yard Campus study and assessment is completed, and a proposed build-out plan is prepared; the Corporate Yard Campus aims to address a multitude of items, including the maintenance crew office space, storage, park, parking, pickleball courts, skate park, connectors, ambulance bay, etc.; delivery of the new trailer will occur in October, and the City’s Emergency Operations Center is available as an intermediate office facility, if there is need to relocate the maintenance crew sooner; Council directed Staff to keep the original “City of La Quinta” sign from the old trailer prior to disposal. MOTION – A motion was made and seconded by Councilmembers Radi/Sanchez to appropriate funds in the amount of $166,000 to lease a new public works trailer from Pacific Mobile, and purchase new office furniture; and authorize the City Manager to execute the lease as recommended. Motion passed unanimously. STUDY SESSION – None PUBLIC HEARINGS – After 5:00 p.m. 1. ADOPT RESOLUTION TO APPROVE AND ADOPT THE RELOCATION PLAN PREPARED FOR THE ACQUISITION OF PERMANENT ROADWAY AND PUBLIC UTILITY EASEMENT INTERESTS IN A PORTION OF CERTAIN REAL PROPERTY IDENTIFIED AS ASSESSOR PARCEL NO 600-030-010, 46400 DUNE PALMS ROAD, LOCATED IN LA QUINTA, RIVERSIDE COUNTY, CALIFORNIA, FOR THE DUNE PALMS ROAD BRIDGE PROJECT (PROJECT NO. 2011- 05/111205) [RESOLUTION NO. 2019-033] Management Analyst Mignogna presented the staff report, which is on file in the Clerk’s Office. Council discussed the Dune Palms Bridge project (Project) funds; relocation costs are incorporated into the right-of-way portion of the bridge Project; relocation alternatives are within City limits and noted in the relocation plan included as Exhibit A to the proposed resolution; MAYOR EVANS DECLARED THE PUBLIC HEARING OPEN AT 7:42 P.M. PUBLIC SPEAKER: None. 18 CITY COUNCIL MINUTES Page 13 of 14 AUGUST 6, 2019 MAYOR EVANS DECLARED THE PUBLIC HEARING CLOSED AT 7:42 P.M. MOTION – A motion was made and seconded by Councilmembers Peña/Fitzpatrick to adopt Resolution No. 2019-033 to approve and adopt the relocation plan prepared for the acquisition of permanent roadway and public utility easement interests in a portion of certain real property identified as Assessor Parcel No. 600-030-010, 46400 Dune Palms Road, space 31 mobile home coach, located in La Quinta, Riverside County, California, in accordance with the California Relocation Assistance Law and the California Relocation and Real Property Acquisition Guidelines as recommended: A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF LA QUINTA, CALIFORNIA, APPROVING AND ADOPTING THE RELOCATION PLAN PREPARED FOR THE ACQUISITION OF PERMANENT ROADWAY AND PUBLIC UTILITY EASEMENT INTERESTS IN A PORTION OF CERTAIN REAL PROPERTY IDENTIFIED AS ASSESSOR PARCEL NO 600-030-010, 46400 DUNE PALMS ROAD, SPACE 31 MOBILE HOME COACH, LOCATED IN LA QUINTA, RIVERSIDE COUNTY, CALIFORNIA, FOR THE DUNE PALMS ROAD BRIDGE PROJECT Motion passed unanimously. DEPARTMENTAL REPORTS All reports are on file in the City Clerk’s Office. City Attorney Ihrke said he received a letter dated July 15, 2019 from legal counsel representing a coalition of counties and cities challenging California Bureau of Cannabis Control Regulation 5416(d), which allows delivery of commercial cannabis statewide, even in communities that have regulated or banned commercial cannabis. Council reached a consensus and directed the Cannabis Ad-hoc Committee to review the correspondence and report back to Council. Council discussed the increase in number of Short-Term Vacation Rental Code Compliance cases from 2017/18 to 2018/19. Council directed Staff to generate a “heat-map” identifying the locations generating the open cases. Council discussed the number of larceny incidents in La Quinta based on the Quarterly Police Report, and how La Quinta compares with other cities. Mayor Evans commended Staff on the low turnover employee rate of 6.9%. MAYOR’S AND COUNCIL MEMBERS’ ITEMS Council commended the Police Cadet Academy. 19 CITY COUNCIL MINUTES Page 14 of 14 AUGUST 6, 2019 Council participated in the 7th Annual Nine Cities Blood Challenge Blood Drive held for La Quinta on August 22, 2019, at the Wellness Center. REPORTS AND INFORMATIONAL ITEMS La Quinta’s representative for 2019, Councilmember Peña reported on his participation in the following organization’s meeting:  CVAG VALLEY-WIDE HOMELESSNESS COMMITTEE La Quinta’s representative for 2019, Councilmember Radi reported on his participation in the following organizations’ meetings:  CALIFORNIA JOINT POWERS INSURANCE AUTHORITY  SUNLINE TRANSIT AGENCY La Quinta’s representative for 2019, Councilmember Sanchez reported on his participation in the following organization’s meeting:  COACHELLA VALLEY ECONOMIC PARTNERSHIP MAYOR EVANS NOTED THE REGULAR COUNCIL MEETINGS OF AUGUST 20 AND SEPTEMBER 3 HAVE BEEN CANCELLED, AND THE NEXT REGULAR COUNCIL MEETING WILL BE HELD ON SEPTEMBER 17, 2019 ADJOURNMENT There being no further business, a motion was made and seconded by Councilmembers Peña/Radi to adjourn at 7:55 p.m. Motion passed unanimously. Respectfully submitted, MONIKA RADEVA, City Clerk City of La Quinta, California 20 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: AUTHORIZE OVERNIGHT TRAVEL FOR THE FINANCE DIRECTOR AND TWO FINANCE DEPARTMENT EMPLOYEES TO ATTEND THE CALIFORNIA SOCIETY OF MUNICIPAL FINANCE OFFICERS ANNUAL CONFERENCE IN ANAHEIM, CALIFORNIA, JANUARY 28-31, 2020 RECOMMENDATION Authorize overnight travel for the Finance Director and two Finance Department employees to attend the California Society of Municipal Finance Officers annual conference in Anaheim, California, January 28-31, 2020. EXECUTIVE SUMMARY •California Society of Municipal Finance Officers (CSMFO) conference focuses on key issues facing cities, counties and special districts in the State of California. •Finance staff will gain knowledge in key areas such as financial fraud prevention and detection, business automation, Governmental Accounting Standard Board reporting requirements, and the opportunity to network. •The City will also apply for a first -time attendee full registration scholarship, which will be awarded in November 2019. FISCAL IMPACT Estimated expenses are $2,700, which includes travel, lodging, and meals for up to three overnight attendees. Funds are budgeted in Finance - Travel and Training (101-1006-60320). BACKGROUND/ANALYSIS CSMFO is a statewide organization serving all California municipal finance professionals. The organization promotes financial management through innovation, continuing education, and the professional development of members with a focus on key issues facing cities, counties, and special CONSENT CALENDAR ITEM NO. 2 21 districts. Karla Romero, Finance Director is the CSMFO Chapter Chair for the Coachella Valley. This conference will further assist in allowing the Finance staff to gain a wider range of finance knowledge in a concentrated amo unt of time. Conference workshops will offer both technical training and the ability to network with other professionals performing similar duties. This training will also address new auditing and financial reporting requirements, internal controls, and best practices for financial processes. To broaden the knowledge and experience of the Finance Department, additional employees may join the conference as one-day attendees. The daily registration and parking cost are approximately $200 per attendee and are also budgeted in travel and training. ALTERNATIVES Council may elect not to authorize this request. Prepared by: Karla Romero, Finance Director Approved by: Jon McMillen, City Manager 22 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: AUTHORIZE OVERNIGHT TRAVEL FOR ACCOUNT TECHNICIAN TO ATTEND THE CALIFORNIA ASSOCIATION OF PUBLIC PROCUREMENT OFFICIALS ANNUAL CONFERENCE IN SAN DIEGO, CALIFORNIA, FEBRUARY 17 - 21, 2020 RECOMMENDATION Authorize overnight travel for Account Technician to attend the California Association of Public Procurement Officials annual conference in San Diego, California, February 17-21, 2020. EXECUTIVE SUMMARY •The Account Technician seeks additional knowledge in procurement methods, requirements, procedures, policies, and best practices. •The Account Technician administers the City’s purchasing process; reviewing requisitions and contracts, approving purchase orders, and coordination with City Clerk and Risk Management. •California Association of Public Procurement Officials (CAPPO) annual conference will focus on new guidelines and principles for procurement. FISCAL IMPACT Estimated expenses are $2,000, which includes travel, lodging, and meals. Funds are budgeted in Finance - Travel and Training (101-1006-60320). BACKGROUND/ANALYSIS CAPPO is a nonprofit organization that is dedicated to maintaining the highest standards of professional behavior and ethical conduct in public procurement. The annual conference will host class sessions on contract administration, changes in public procurement, leadership and team building. This conference gives procurement professionals a look into future purchasing trends as well as networking opportunities with others in the same industry. CONSENT CALENDAR ITEM NO. 3 23 ALTERNATIVES Council may elect not to authorize this request. Prepared by: Derrick Armendariz, Account Technician Approved by: Rosemary Hallick, Financial Services Analyst 24 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: AUTHORIZE OVERNIGHT TRAVEL FOR THE COMMUNITY RESOURCES DIRECTOR TO ATTEND THE CALIFORNIA PUBLIC EMPLOYERS LABOR RELATIONS ASSOCIATION TRAINING CONFERENCE IN MONTEREY, CALIFORNIA, NOVEMBER 19-22, 2019 RECOMMENDATION Authorize overnight travel for the Community Resources Director to attend California Employers Labor Relations Association Training Conference in Monterey, California, November 19-22, 2019. EXECUTIVE SUMMARY •California Public Employers Labor Relations Association (CALPELRA) provides comprehensive, quality training in labor relations and personnel management. •The training will provide hands-on workshops and discussion forums devoted to personnel management topics. FISCAL IMPACT Estimated expenses will be $2,750, which includes registration, travel, lodging, parking, and meals. Funds are budgeted in the 2019/20 Human Resources’ travel and training budget (101-1004-60320). BACKGROUND/ANALYSIS The conference is designed for public sector employers and provides essential information for the Human Resources Division to strengthen workforce engagement. Workshop topics include performance management, negotiations, hiring processes, effective documentation, classification and compensation studies, leaves of absence, workers compensation, health and wellness, and CalPERS pensions and regulations. ALTERNATIVES Council may elect not to authorize this request. Prepared by: Carla Triplett, Human Resources Analyst Approved by: Chris Escobedo, Community Resources Director CONSENT CALENDAR ITEM NO. 4 25 26 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: AUTHORIZE OVERNIGHT TRAVEL FOR FACILITIES MAINTENANCE WORKER I TO ATTEND THE INTERNATIONAL MUNICIPAL SIGNAL ASSOCIATION COURSE IN ONTARIO, CA, NOVEMBER 4–7, 2019 RECOMMENDATION Authorize overnight travel for the Facilities Maintenance Worker I to attend the International Municipal Signal Association course in Ontario, CA, November 4-7, 2019. EXECUTIVE SUMMARY •The International Municipal Signal Association (IMSA) course includes classes for Work Zone Temporary Traffic Control and Traffic Signal Technician I. •The Facilities Maintenance Worker I (Maintenance Worker), is participating in the City’s mentorship program in the Traffic Division. FISCAL IMPACT Estimated cost is $1,500, which includes registration, course materials, travel, lodging, parking and meals for four days. Funds are available in the 2019/20 Streets Travel and Training budget (101-7003-60320). BACKGROUND/ANALYSIS IMSA Work Zone safety teaches the procedures to enhance the safety for motorists and workers in the work areas. The Traffic Signal Technician I course provides instruction on the principals of operation and primary electrical details of cabinet wiring, components, equipment, methods, and materials of signal system construction. Through participation in the City’s mentorship program, the Maintenance Worker has acquired knowledge and experience to perform preventative maintenance with minimal supervision and seeks to expand his knowledge of traffic signal control cabinet equipment. This overnight travel would allow the Maintenance Worker to network with other traffic technicians and allow for course study time. CONSENT CALENDAR ITEM NO. 5 27 ALTERNATIVES Council could elect not to authorize this travel request, however, there are no local training opportunities. Prepared by: Dianne Hansen, Interim Management Analyst Approved by: Gil Villalpando, Assistant to City Manager 28 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: EXCUSE ABSENCES FOR PLANNING COMMISSIONERS McCUNE AND PROCTOR FROM THE SEPTEMBER 24, 2019 MEETING, AND PLANNING COMMISSIONER CALDWELL FROM THE OCTOBER 8, 2019 MEETING RECOMMENDATION Excuse absences for Planning Commissioners McCune and Proctor from the September 24, 2019 meeting and Planning Commissioner Caldwell from the October 8, 2019 meeting. EXECUTIVE SUMMARY Commissioners McCune and Proctor requested to be excused from the September 24, 2019 Planning Commission meeting as each will be out of the area during that time. Both Commissioners have no excused or unexcused absences in 2019/20. Commissioner Caldwell requested to be excused from the October 8, 2019 Planning Commission meeting as she will be out of the area at that time. Commissioner Caldwell has no excused or unexcused absences in 2019/20. FISCAL IMPACT No meeting attendance compensation is paid to absent members. BACKGROUND/ANALYSIS The Municipal Code states: “If any member of a board, commission or committee absents him/herself from two consecutive regular meetings or absents him/herself from a total of three regular meetings within any fiscal year, his/her office shall become vacant and shall be filled as any other vacancy. A board, commission or committee member may request advance permission from the city council to be absent at one or more regular meetings due to extenuating circumstances, and/or may request the city council to excuse an absence after-the-fact where such extenuating circumstances prevented the member from seeking advance permission to be absent. If such permission or excuse is granted by the city council, the absence shall not be counted toward the above-stated limitations on absences.” ALTERNATIVES Council may deny this request, which would result in the absence being counted toward each Commissioner’s limitation on absences. Prepared by: Tania Flores, Management Assistant Approved by: Monika Radeva, City Clerk CONSENT CALENDAR ITEM NO. 6 29 30 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: ADOPT A RESOLUTION TO AUTHORIZE THE ADOPTION OF CALTRANS’ LOCAL ASSISTANCE PROCEDURES MANUAL CHAPTER 10 RECOMMENDATION Adopt a resolution authorizing the adoption of Caltrans’ Local Assistance Procedures Manual Chapter 10. EXECUTIVE SUMMARY The City of La Quinta’s Design and Development Department is responsible for the execution of State and Federal funded projects. The State of California Department of Transportation (Caltrans) has developed the Local Assistance Procedures Manual (LAPM), Chapter 10 to ensure compliance with applicable Federal and State laws and regulations. LAPM Chapter 10, Consultant Selection, describes the consultant selection and procurement process local agencies must follow to maintain eligibility for federal and state reimbursement. The City is required to adopt the LAPM Chapter 10 or develop its own policies and procedures approved by Caltrans. FISCAL IMPACT – None. BACKGROUND The City has capital improvement projects funded by various state or federal monies. Caltrans has developed the LAPM Chapter 10 to ensure compliance with applicable Federal and State laws and regulations. Although the City has procurement policies and procedures that may meet the State requirements, there are some deviations from the Caltrans required LAPM Chapter 10, such as the Caltrans Acceptance of the Indirect Cost Rate. Rather than request that Caltrans review and approve the City's process and make adjustments that would impact the City’s other procurement processes, staff believes it would be more effective to adopt the Caltrans policies and procedures for State or Federally funded projects administered by Caltrans. CONSENT CALENDAR ITEM NO. 7 31 ALTERNATIVES Council may direct staff to develop the City’s own policies and procedures for Caltrans approval. Prepared by: Julie Mignogna, Management Analyst Approved by: Bryan McKinney, City Engineer 32 RESOLUTION NO. 2019 - A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF LA QUINTA, CALIFORNIA, AUTHORIZING ADOPTION OF CALTRANS’ LOCAL ASSISTANCE PROCEDURES MANUAL CHAPTER 10 WHEREAS, the City of La Quinta City Council through the Design and Development Department is responsible for the execution of State and Federal funded project(s); and WHEREAS, the provision of 23 CFR 172.5(b), subrecipients shall develop and sustain organizational capacity and provide the resources necessary for procurement, management, and administration of engineering and design related consultant services, reimbursed in whole or in part with Federal-Aid Highway Program funding as specified in 23 U.S.C. 106(g)(4)(A); and WHEREAS, 23 CFR 172.5(b)(1) requires subrecipients to adopt written policies and procedures prescribed by the awarding State Transportation Agency for the procurement, management, and administration of engineering and design related consultant services in accordance with applicable Federal and State laws and regulations; and WHEREAS, the State of California Department of Transportation (Caltrans) has developed the Local Assistance Procedures Manual (LAPM), Chapter 10, Consultant Selection which sets forth policies and procedures for procurement and management of contracts for engineering and design related consultant service contracts on federal and state funded transportation projects to ensure compliance with applicable Federal and State laws and regulations; and WHEREAS, LAPM Chapter 10, Consultant Selection, describes the consultant selection and procurement process local agencies must follow to maintain eligibility for federal and state reimbursement. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of La Quinta, California, adopts Caltrans LAPM Ch.10, Consultant Selection, attached hereto as “Exhibit A” and incorporated by this reference, and any updates thereto, in the procurement of A&E services for state and federal funded projects. 33 Resolution No. 2019- Adoption of Caltrans LAPM Chapter 10 Adopted: September 17, 2019 Page 2 of 2 PASSED, APPROVED and ADOPTED at a regular meeting of the La Quinta City Council held on this 17th day of September 2019, by the following vote: AYES: NOES: ABSENT: ABSTAIN: _______________________ LINDA EVANS, Mayor City of La Quinta, California ATTEST: __________________________ MONIKA RADEVA, City Clerk City of La Quinta, California (CITY SEAL) APPROVED AS TO FORM: ___________________________ WILLIAM H. IHRKE, City Attorney City of La Quinta, California 34 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ Chapter 10 &RQVXOWDQW6HOHFWLRQ CContents ^ĞĐƚŝŽŶϭϬ͘ϭ͗&Z>>z&hEΘKEdZd^͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ǀŝ ϭϬ͘ϭ͘ϭ'ĞŶĞƌĂů͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭ /ŶƚƌŽĚƵĐƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭ ĞĨŝŶŝƚŝŽŶŽĨĂŶƌĐŚŝƚĞĐƚƵƌĂůĂŶĚŶŐŝŶĞĞƌŝŶŐŽŶƐƵůƚĂŶƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭ ƌĐŚŝƚĞĐƚƵƌĂůĂŶĚŶŐŝŶĞĞƌŝŶŐŽŶƐƵůƚĂŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭ EŽŶͲΘŽŶƐƵůƚĂŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯ ^ĞůĞĐƚŝŶŐƚŚĞWƌŽũĞĐƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯ ^ƵďĐŽŶƚƌĂĐƚĞĚ^ĞƌǀŝĐĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯ KƌŐĂŶŝnjĂƚŝŽŶĂůĂŶĚŽŶƐƵůƚĂŶƚŽŶĨůŝĐƚƐŽĨ/ŶƚĞƌĞƐƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯ &ĞĚĞƌĂůZĞŐƵůĂƚŝŽŶ'ŽǀĞƌŶŝŶŐŽŶĨůŝĐƚŽĨ/ŶƚĞƌĞƐƚ;Ϯϯ&ZϭϳϮ͘ϳ;ďͿ;ϰͿͿZĞƋƵŝƌĞƐƚŚĂƚ͗͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯ ŽŶƐƵůƚĂŶƚƐWĞƌĨŽƌŵŝŶŐtŽƌŬŽŶDƵůƚŝƉůĞWŚĂƐĞƐŽĨ&ĞĚĞƌĂůͲĂŝĚWƌŽũĞĐƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯ ϭϬ͘ϭ͘Ϯ /ĚĞŶƚŝĨLJŝŶŐΘĞĨŝŶŝŶŐĂEĞĞĚĨŽƌŽŶƐƵůƚĂŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰ ƉƉŽŝŶƚŝŶŐƚŚĞŽŶƚƌĂĐƚĚŵŝŶŝƐƚƌĂƚŽƌ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱ ^ĞŐŵĞŶƚŝŶŐŽŶƐƵůƚĂŶƚtŽƌŬ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲ &ŝŐƵƌĞϭϬͲϮ͗^ĞŐŵĞŶƚŝŶŐŽŶƐƵůƚĂŶƚtŽƌŬ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳ ^ƉĞĐŝĨLJWƌŽĚƵĐƚƐƚŽďĞĞůŝǀĞƌĞĚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳ ^ĐŽƉĞŽĨŽŶƐƵůƚĂŶƚtŽƌŬ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳ EŽŶͲŝƐĐƌŝŵŝŶĂƚŝŽŶůĂƵƐĞ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳ ŝƐĂĚǀĂŶƚĂŐĞĚƵƐŝŶĞƐƐŶƚĞƌƉƌŝƐĞ;ͿWĂƌƚŝĐŝƉĂƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳ ĞƚĞƌŵŝŶĞdLJƉĞŽĨŽŶƚƌĂĐƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϵ ĞƚĞƌŵŝŶŝŶŐƚŚĞWƌŽũĞĐƚ^ĐŚĞĚƵůĞ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϬ ĞƚĞƌŵŝŶĞDĞƚŚŽĚŽĨWĂLJŵĞŶƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϭ ĐƚƵĂůŽƐƚͲWůƵƐͲ&ŝdžĞĚ&ĞĞ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϭ ŽƐƚWĞƌhŶŝƚŽĨtŽƌŬ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϭ ^ƉĞĐŝĨŝĞĚZĂƚĞƐŽĨŽŵƉĞŶƐĂƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϮ >ƵŵƉ^ƵŵŽƌ&ŝƌŵ&ŝdžĞĚWƌŝĐĞ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϮ ϭϬ͘ϭ͘ϯ ΘŽŶƐƵůƚĂŶƚƵĚŝƚĂŶĚZĞǀŝĞǁWƌŽĐĞƐƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϮ ƉƉůŝĐĂďůĞ^ƚĂŶĚĂƌĚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϯ ƵĚŝƚ'ƵŝĚĂŶĐĞǀĂŝůĂďůĞ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϯ ůůŽǁĂďůĞŽƐƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϰ ƉƉƌŽǀĂůŽƌĐĐĞƉƚĂŶĐĞŽĨ/ŶĚŝƌĞĐƚŽƐƚZĂƚĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϱ ŽŐŶŝnjĂŶƚ>ĞƚƚĞƌƐŽĨƉƉƌŽǀĂů͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϱ WĂŐĞŝ ŽĨŝdž :ĂŶƵĂƌLJϮϬϭϵ Council Resolution No. 2019-xxx EXHIBIT A 35 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ ĂůƚƌĂŶƐĐĐĞƉƚĂŶĐĞŽĨ/ŶĚŝƌĞĐƚŽƐƚZĂƚĞ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϱ &ŝŶĂŶĐŝĂůZĞǀŝĞǁWĞƌĨŽƌŵĞĚWƌŝŽƌƚŽŽŶƚƌĂĐƚdžĞĐƵƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϲ >ŽĐĂůŐĞŶĐŝĞƐ͛ZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϳ ŽŶƐƵůƚĂŶƚƐ͛ZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ;ŽƚŚƉƌŝŵĞĐŽŶƐƵůƚĂŶƚƐĂŶĚƐƵďĐŽŶƐƵůƚĂŶƚƐͿ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϴ /ŶĚĞƉĞŶĚĞŶƚKĨĨŝĐĞŽĨƵĚŝƚƐĂŶĚ/ŶǀĞƐƚŝŐĂƚŝŽŶƐ͛ZĞƐƉŽŶƐŝďŝůŝƚŝĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϵ ƵĚŝƚƐĂŶĚZĞǀŝĞǁƐƚŽďĞWĞƌĨŽƌŵĞĚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϵ /ŶĚŝƌĞĐƚŽƐƚZĂƚĞƵĚŝƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϵ WtŽƌŬƉĂƉĞƌZĞǀŝĞǁƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϵ ŽŶƚƌĂĐƚƵĚŝƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϮϬ /ŶĐƵƌƌĞĚŽƐƚƵĚŝƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϮϬ ƵĚŝƚ&ŝŶĚŝŶŐƐĂŶĚZĞǀŝĞǁĞĨŝĐŝĞŶĐŝĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϮϬ ϭϬ͘ϭ͘ϰ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶDĞƚŚŽĚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϮϮ KŶĞͲ^ƚĞƉZ&W͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϯ KŶĞͲ^ƚĞƉZ&Y͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϯ dǁŽͲ^ƚĞƉ;Z&Y&ŽůůŽǁĞĚďLJZ&WͿ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϯ ϭϬ͘ϭ͘ϱ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶhƐŝŶŐƚŚĞKŶĞͲ^ƚĞƉZ&WDĞƚŚŽĚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϲ ƉƉŽŝŶƚŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶŽŵŵŝƚƚĞĞ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϲ ĞǀĞůŽƉdĞĐŚŶŝĐĂůƌŝƚĞƌŝĂĨŽƌǀĂůƵĂƚŝŽŶŽĨWƌŽƉŽƐĂůƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϲ ĞǀĞůŽƉ^ĐŚĞĚƵůĞĨŽƌŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϳ WƌĞƉĂƌĞZ&W͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϳ &ŝŶĂŶĐŝĂůDĂŶĂŐĞŵĞŶƚĂŶĚĐĐŽƵŶƚŝŶŐ^LJƐƚĞŵZĞƋƵŝƌĞŵĞŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϴ ĚǀĞƌƚŝƐĞĨŽƌŽŶƐƵůƚĂŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϴ /ƐƐƵĞͬWƵďůŝƐŚZ&W͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϵ ŽŶĚƵĐƚWƌŽƉŽƐĞƌ͛ƐŽŶĨĞƌĞŶĐĞŽƌŶƐǁĞƌtƌŝƚƚĞŶYƵĞƐƚŝŽŶƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϵ ZĞĐĞŝǀĞĂŶĚǀĂůƵĂƚĞdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘Ϯϵ ĞǀĞůŽƉ&ŝŶĂůZĂŶŬŝŶŐĂŶĚEŽƚŝĨLJŽŶƐƵůƚĂŶƚƐŽĨZĞƐƵůƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϬ EĞŐŽƚŝĂƚĞŽŶƚƌĂĐƚǁŝƚŚdŽƉͲZĂŶŬĞĚŽŶƐƵůƚĂŶƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϬ ϭϬ͘ϭ͘ϲŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶhƐŝŶŐƚŚĞKŶĞͲ^ƚĞƉZ&YDĞƚŚŽĚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϭ ƉƉŽŝŶƚŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶŽŵŵŝƚƚĞĞ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϮ ĞǀĞůŽƉdĞĐŚŶŝĐĂůƌŝƚĞƌŝĂĨŽƌǀĂůƵĂƚŝŽŶŽĨYƵĂůŝĨŝĐĂƚŝŽŶƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϮ ĞǀĞůŽƉ^ĐŚĞĚƵůĞĨŽƌŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϮ WƌĞƉĂƌĞZ&Y͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϮ &ŝŶĂŶĐŝĂůDĂŶĂŐĞŵĞŶƚĂŶĚĐĐŽƵŶƚŝŶŐ^LJƐƚĞŵZĞƋƵŝƌĞŵĞŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϯ ĚǀĞƌƚŝƐĞĨŽƌŽŶƐƵůƚĂŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϰ /ƐƐƵĞͬWƵďůŝƐŚZ&Y͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϰ ZĞĐĞŝǀĞͬǀĂůƵĂƚĞ^ƚĂƚĞŵĞŶƚƐŽĨYƵĂůŝĨŝĐĂƚŝŽŶƐĂŶĚĞǀĞůŽƉ^ŚŽƌƚůŝƐƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϰ WĂŐĞŝŝŽĨŝdž :ĂŶƵĂƌLJϮϬϭϵ 36 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ EŽƚŝĨLJŽŶƐƵůƚĂŶƚƐŽĨ^ŚŽƌƚůŝƐƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϱ /ŶƚĞƌǀŝĞǁdŽƉͲZĂŶŬĞĚŽŶƐƵůƚĂŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϱ ĞǀĞůŽƉ&ŝŶĂůZĂŶŬŝŶŐĂŶĚEŽƚŝĨLJŽŶƐƵůƚĂŶƚƐŽĨZĞƐƵůƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϲ ŽŶĚƵĐƚ^ĐŽƉŝŶŐDĞĞƚŝŶŐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϲ ZĞƋƵĞƐƚŽƐƚWƌŽƉŽƐĂů͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϲ EĞŐŽƚŝĂƚĞŽŶƚƌĂĐƚǁŝƚŚdŽƉͲZĂŶŬĞĚŽŶƐƵůƚĂŶƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϲ ϭϬ͘ϭ͘ϳŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶhƐŝŶŐƚŚĞdǁŽͲ^ƚĞƉZ&YͬZ&WDĞƚŚŽĚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϴ ŽŵďŝŶĞĚZ&YĂŶĚZ&W͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϴ ĂƚĞŐŽƌŝnjĞǁŽƌŬ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯϵ ƐƚĂďůŝƐŚDŝŶŝŵƵŵYƵĂůŝĨŝĐĂƚŝŽŶƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϬ /ƐƐƵĞZ&Y͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϬ ^ĞƚͲhƉǀĂůƵĂƚŝŽŶWƌŽĐĞƐƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϭ ǀĂůƵĂƚĞYƵĂůŝĨŝĐĂƚŝŽŶƐĂŶĚĚĚ&ŝƌŵƚŽ>ŝƐƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϮ DĂŝŶƚĂŝŶ>ŝƐƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϮ /ƐƐƵĞZ&WƚŽWƌĞͲYƵĂůŝĨŝĞĚŽŶƐƵůƚĂŶƚƐŽŶ>ŝƐƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϮ ŽŶĚƵĐƚWƌŽƉŽƐĞƌ͛ƐŽŶĨĞƌĞŶĐĞŽƌŶƐǁĞƌtƌŝƚƚĞŶYƵĞƐƚŝŽŶƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϯ ZĞĐĞŝǀĞĂŶĚǀĂůƵĂƚĞdĞĐŚŶŝĐĂůWƌŽƉŽƐĂůƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϯ ĞǀĞůŽƉ&ŝŶĂůZĂŶŬŝŶŐĂŶĚEŽƚŝĨLJŽŶƐƵůƚĂŶƚƐŽĨZĞƐƵůƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϯ ZĞƋƵĞƐƚŽƐƚWƌŽƉŽƐĂůĂŶĚEĞŐŽƚŝĂƚĞŽŶƚƌĂĐƚǁŝƚŚdŽƉͲZĂŶŬĞĚŽŶƐƵůƚĂŶƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϰ ϭϬ͘ϭ͘ϴŽŵƉůĞƚŝŶŐƚŚĞWƌŽũĞĐƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϱ ĞǀĞůŽƉƚŚĞ&ŝŶĂůŽŶƚƌĂĐƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϱ ZĞǀŝĞǁĂŶĚƉƉƌŽǀĂůŽĨŽŶƚƌĂĐƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϱ džĞĐƵƚĞŽŶƚƌĂĐƚĂŶĚ/ƐƐƵĞEŽƚŝĐĞƚŽWƌŽĐĞĞĚƚŽŽŶƐƵůƚĂŶƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϲ ĚŵŝŶŝƐƚĞƌƚŚĞŽŶƚƌĂĐƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϳ ^ƵďƐƚŝƚƵƚŝŽŶŽĨŽŶƐƵůƚĂŶƚWĞƌƐŽŶŶĞůĂŶĚ^ƵďĐŽŶƐƵůƚĂŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϳ /ŶǀŽŝĐŝŶŐ;ŽƌWƌŽŐƌĞƐƐWĂLJŵĞŶƚƐͿ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϴ ŽŶƚƌĂĐƚŵĞŶĚŵĞŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϴ WĞƌĨŽƌŵĂŶĐĞǀĂůƵĂƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϵ WƌŽũĞĐƚZĞĐŽƌĚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰϵ ZĞƚĞŶƚŝŽŶůĂƵƐĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱϭ ZĞǀŝĞǁŽĨ>ŽĐĂůŐĞŶĐLJĐƚŝŽŶƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱϭ ϭϬ͘ϭ͘ϵ DŝƐĐĞůůĂŶĞŽƵƐŽŶƐŝĚĞƌĂƚŝŽŶƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱϭ ŐƌĞĞŵĞŶƚƐǁŝƚŚKƚŚĞƌ'ŽǀĞƌŶŵĞŶƚĂůŐĞŶĐŝĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱϭ ^ŵĂůůWƵƌĐŚĂƐĞŽŶƚƌĂĐƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱϭ EŽŶĐŽŵƉĞƚŝƚŝǀĞEĞŐŽƚŝĂƚĞĚŽŶƚƌĂĐƚƐ;^ŽůĞͲ^ŽƵƌĐĞͿ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱϮ WĞƌƐŽŶĂů^ĞƌǀŝĐĞƐŽŶƚƌĂĐƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱϮ WĂŐĞŝŝŝŽĨŝdž :ĂŶƵĂƌLJϮϬϭϵ 37 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ ZĞƚĂŝŶŝŶŐĂŽŶƐƵůƚĂŶƚĂƐĂŶŐĞŶĐLJŶŐŝŶĞĞƌŽƌŝŶDĂŶĂŐĞŵĞŶƚ^ƵƉƉŽƌƚZŽůĞ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱϯ ŽŶƐƚƌƵĐƚŝŽŶŶŐŝŶĞĞƌŝŶŐ^ĞƌǀŝĐĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱϲ ϭϬ͘ϭ͘ϭϬWƌŽŐƌĂŵDĂŶĂŐĞŵĞŶƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱϲ ϭϬ͘ϭ͘ϭϭ ZĞĨĞƌĞŶĐĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱϳ ϭϬ͘Ϯ͗^ddͲKE>z&hEΘKEdZd^͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱϵ ϭϬ͘Ϯ͘ϭ'ĞŶĞƌĂů͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϬ ϭϬ͘Ϯ͘ϮĞĨŝŶŝƚŝŽŶŽĨΘ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϬ ϭϬ͘Ϯ͘ϯ DŝŶŝŵƵŵƵĚŝƚZĞƋƵŝƌĞŵĞŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϭ $:ULWWHQ3URFHGXUHV͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϭ %&RQIOLFWRI,QWHUHVW͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϭ & 5HFRUGV ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϭ ')XOO 2SHQFRPSHWLWLRQ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϭ (6HOHFWLRQ%DVLV͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϮ )3XEOLFDWLRQ ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϮ *6ROLFLWDWLRQ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϮ +&RVW$QDO\VLV͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϮ ,1HJRWLDWLRQV͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϮ ϭϬ͘ϯ͗EKEͲΘKEdZd^͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϳ ĞƚĞƌŵŝŶŝŶŐEŽŶͲΘ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϳ džĂŵƉůĞŽĨĞƚĞƌŵŝŶŝŶŐEŽŶͲΘ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϳ /ŶƚĞůůŝŐĞŶƚdƌĂŶƐƉŽƌƚĂƚŝŽŶ^LJƐƚĞŵ;/d^ͿWƌŽũĞĐƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϴ EŽŶͲ/ŶĨƌĂƐƚƌƵĐƚƵƌĞWƌŽũĞĐƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϴ 'ŽǀĞƌŶŝŶŐZĞŐƵůĂƚŝŽŶƐĂŶĚŽĚĞƐĨŽƌŶŽŶͲΘ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϵ WƌŽĐƵƌĞŵĞŶƚŽĨEŽŶͲΘŽŶƐƵůƚĂŶƚŽŶƚƌĂĐƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϵ Z&WĂƐŝĐZĞƋƵŝƌĞŵĞŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲϵ ĚĚŝƚŝŽŶĂůZĞƋƵŝƌĞŵĞŶƚƐĂŶĚǀĂůƵĂƚŝŽŶƌŝƚĞƌŝĂ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳϬ ŽŶƐƵůƚĂŶƚ͛ƐWƌŽƉŽƐĂů͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳϬ ŽƐƚWƌŽƉŽƐĂůtŽƌŬƐŚĞĞƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳϭ ŽŶƐŝĚĞƌĂƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳϭ ĚŵŝŶŝƐƚƌĂƚŝǀĞZĞƋƵŝƌĞŵĞŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳϭ KƌĂůWƌĞƐĞŶƚĂƚŝŽŶƐKƉƚŝŽŶĂů͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳϮ ŽƐƚͲĨĨĞĐƚŝǀĞͬWƵďůŝĐ/ŶƚĞƌĞƐƚ&ŝŶĚŝŶŐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳϮ WƌŽƚĞƐƚͬƉƉĞĂůƐͬZĞŝŶƐƚĂƚĞŵĞŶƚWƌŽĐĞĚƵƌĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳϮ WĂŐĞŝǀŽĨŝdž :ĂŶƵĂƌLJϮϬϭϵ 38 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ džŚŝďŝƚƐ džŚŝďŝƚƐĂƉƉůŝĐĂďůĞƚŽƚŚŝƐĐŚĂƉƚĞƌĐĂŶďĞĨŽƵŶĚĂƚ͗ ŚƚƚƉƐ͗ͬͬĚŽƚ͘ĐĂ͘ŐŽǀͬƉƌŽŐƌĂŵƐͬůŽĐĂůͲĂƐƐŝƐƚĂŶĐĞͬĨŽƌŵƐͬůŽĐĂůͲĂƐƐŝƐƚĂŶĐĞͲƉƌŽĐĞĚƵƌĞƐͲŵĂŶƵĂůͲĨŽƌŵƐ Exhibit 10-A: A&E Consultant Financial Document Review Request Exhibit 10-B: Suggested Consultant Evaluation Sheet Exhibit 10-C: A&E Consultant Contract Reviewers Checklist Exhibit 10-G: Individual A&E Task Order DBE Utilization (needs linked) Exhibit 10-H: Sample Cost Proposal (Example#1 thru #4) Exhibit 10-I: Notice to Proposers DBE Information Exhibit 10-K: Consultant ŶŶƵĂůCertification of /ŶĚŝƌĞĐƚ Costs and Financial Management System Exhibit 10-01: Consultant Proposal DBE Commitment Exhibit 10-02: Consultant Contracts DBE Commitment Exhibit 10-Q: Disclosure of Lobbying Activities Exhibit 10-R: A&E Sample Contract Language Exhibit 10-S: Consultant Performance Evaluation Exhibit 10-T: Conflict of Interest & Confidentiality Statement Exhibit 10-U: Consultant in Management Support Role Conflict of interest and Confidentiality Statement WĂŐĞ ǀ ŽĨŝdž :ĂŶƵĂƌLJϮϬϭϵ 39 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 6(&7,21)('(5$//<)81'('$ (&2175$&76 Procurement Planning ϭ Ϯ ϯ >ŽĐĂůŐĞŶĐLJ>ŽĐĂůŐĞŶĐLJ >ŽĐĂůŐĞŶĐLJ Ύ^ĞůĞĐƚWƌŽũĞĐƚ Ύ^ĞƚWƌŽũĞĐƚKďũĞĐƚŝǀĞƐ ΎĞƚĞƌŵŝŶĞWƌŽũĞĐƚ^ĐŚĞĚƵůĞ ΎKďƚĂŝŶdůůŽĐĂƚŝŽŶͬ&ĞĚĞƌĂů ƵƚŚŽƌŝnjĂƚŝŽŶƚŽWƌŽĐĞĞĚƉƌŝŽƌƚŽ ďĞŐŝŶŶŝŶŐƌĞŝŵďƵƌƐĂďůĞǁŽƌŬ ΎLAPM Exhibit 10-U: Consultant in Management Support Role Conflict of Interest and Confidentiality Statement͕ŝĨĂƉƉůŝĐĂďůĞ͗ ƐƵďŵŝƚŽŶĨůŝĐƚŽĨ/ŶƚĞƌĞƐƚ ĂŶĚ^ĐŽƉĞŽĨtŽƌŬ;^KtͿ ƚŽ>Ͳ,YƉƌŝŽƌƚŽ ĐŽŶƚƌĂĐƚĂĚǀĞƌƚŝƐĞŵĞŶƚ͘ Ύ/ĚĞŶƚŝĨLJEĞĞĚĨŽƌŽŶƐƵůƚĂŶƚ ΎƉƉŽŝŶƚŽŶƚƌĂĐƚĚŵŝŶŝƐƚƌĂƚŽƌ Ύ^ĞŐŵĞŶƚWƌŽũĞĐƚtŽƌŬ ΎĞĨŝŶĞ^KtŽĨΘŽŶƐƵůƚĂŶƚ Ύ^ƉĞĐŝĨLJWƌŽĚƵĐƚƐƚŽďĞ ĚĞůŝǀĞƌĞĚ ΎƐƚŝŵĂƚĞŽƐƚŽĨŽŶƐƵůƚĂŶƚtŽƌŬ ΎĞƚĞƌŵŝŶĞdLJƉĞŽĨŽŶƚƌĂĐƚ ;WƌŽũĞĐƚ^ƉĞĐŝĨŝĐŽƌKŶͲĂůůͿ ΎĞƚĞƌŵŝŶĞDKW͗>ƵŵƉ ^Ƶŵ͖ĐƚƵĂůŽƐƚͲWůƵƐͲ &ŝdžĞĚͲ&ĞĞ͖ŽƐƚWĞƌhŶŝƚŽĨ tŽƌŬ͖Žƌ^ƉĞĐŝĨŝĐZĂƚĞŽĨ ŽŵƉĞŶƐĂƚŝŽŶ ΘсƌĐŚŝƚĞĐƚƵƌĂůĂŶĚŶŐŝŶĞĞƌŝŶŐ /K/сĂůƚƌĂŶƐ/ŶĚĞƉĞŶĚĞŶƚKĨĨŝĐĞŽĨƵĚŝƚƐĂŶĚ /ŶǀĞƐƚŝŐĂƚŝŽŶƐ dсĂůƚƌĂŶƐ сŝƐĂĚǀĂŶƚĂŐĞĚƵƐŝŶĞƐƐŶƚĞƌƉƌŝƐĞ >сŝǀŝƐŝŽŶŽĨ>ŽĐĂůƐƐŝƐƚĂŶĐĞ >сŝƐƚƌŝĐƚ>ŽĐĂůƐƐŝƐƚĂŶĐĞŶŐŝŶĞĞƌ >Ͳ,YсŝǀŝƐŝŽŶŽĨ>ŽĐĂůƐƐŝƐƚĂŶĐĞͲ,ĞĂĚƋƵĂƌƚĞƌƐ >W'с>ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽŐƌĂŵ'ƵŝĚĞůŝŶĞƐ >WDс>ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂů DKWсDĞƚŚŽĚŽĨWĂLJŵĞŶƚ Z&WсZĞƋƵĞƐƚĨŽƌWƌŽƉŽƐĂů Z&YсZĞƋƵĞƐƚĨŽƌYƵĂůŝĨŝĐĂƚŝŽŶƐ ^KYс^ƚĂƚĞŵĞŶƚŽĨYƵĂůŝĨŝĐĂƚŝŽŶƐ ^Ktс^ƚĂƚĞŵĞŶƚͬ^ĐŽƉĞŽĨtŽƌŬ &ŝŐƵƌĞϭϬͲϭ͗ ΘŽŶƚƌĂĐƚWƌŽĐƵƌĞŵĞŶƚWƌŽĐĞƐƐtŽƌŬĨůŽǁŝĂŐƌĂŵ WĂŐĞǀŝŽĨŝdž :ĂŶƵĂƌLJϮϬϭϵ 40 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ Solicitation Documents and Advertisement 4 5 6 >ŽĐĂůŐĞŶĐLJ>ŽĐĂůŐĞŶĐLJ>ŽĐĂůŐĞŶĐLJ ΎĞƚĞƌŵŝŶĞ^ŽůŝĐŝƚĂƚŝŽŶŽĐƵŵĞŶƚ͖ Z&WŽƌZ&Y ΎƉƉŽŝŶƚŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ ŽŵŵŝƚƚĞĞ ΎŽůůĞĐƚƐŝŐŶĞĚŽŶĨůŝĐƚŽĨ/ŶƚĞƌĞƐƚ ĨŽƌŵƐĂŶĚŽŶĨŝĚĞŶƚŝĂůŝƚLJ ^ƚĂƚĞŵĞŶƚƐ;see Exhibit 10-T: Conflict of Interest & Confidentiality StatementͿĨƌŽŵ ĂůůŵĞŵďĞƌƐŝŶǀŽůǀĞĚŝŶƉƌŽĐĞƐƐ ΎĞƚĞƌŵŝŶĞWƌŽĐƵƌĞŵĞŶƚ^ĐŚĞĚƵůĞ ΎĞǀĞůŽƉdĞĐŚŶŝĐĂůƌŝƚĞƌŝĂ ǁŝƚŚůĞǀĞůŽĨŝŵƉŽƌƚĂŶĐĞ ;ǁĞŝŐŚƚƐͿĨŽƌǀĂůƵĂƚŝŽŶŽĨ WƌŽƉŽƐĂůƐŽƌƚŚĞ^KY ΎWƌĞƉĂƌĞZ&WŽƌZ&YĚŽĐƵŵĞŶƚƐ Ύ/ŶĐůƵĚĞ^Kt͕ĞǀĂůƵĂƚŝŽŶ ƉƌŽĐĞƐƐͬĐƌŝƚĞƌŝĂ͕ŐŽĂůƐ͕DKW ĂŶĚĐŽƐƚƉƌŽƉŽƐĂůĨŽƌŵĂƚ;ƐĞĞ Exhibit 10-H: Sample Cost ProposalͿŵŝŶŝŵƵŵƌĞƋƵŝƌĞŵĞŶƚ ŽĨWƌŽƉŽƐĂůŽƌ^KY͕EŽƚŝĐĞƚŽ WƌŽƉŽƐĞƌƐ/ŶĨŽƌŵĂƚŝŽŶ;see Exhibit 10-I: Notice to Proposers DBE Information), ƐƵďŵŝƚƚĂů ĚĞĂĚůŝŶĞ ΎĚǀĞƌƚŝƐĞZ&WŽƌZ&YŽŶƉƵďůŝĐ ĨŽƌƵŵ;ŶĞǁƐƉĂƉĞƌ͕ƚĞĐŚŶŝĐĂů ƉƵďůŝĐĂƚŝŽŶƐ͕tĞď,ŽƐƚŝŶŐ^ŝƚĞ͕ ŽƚŚĞƌůŽĐĂůǁĞďƐŝƚĞƐͿ Ύ/ƐƐƵĞZ&WŽƌZ&Y;ĚŝƌĞĐƚŵĂŝůŝŶŐ͕ ǁĞďƉŽƐƚŝŶŐͿ ΎWƌĞƉĂƌĞƚŽƌĞƐƉŽŶĚƚŽZ&WͬZ&Y ƋƵĞƐƚŝŽŶƐ ΎŽŶĚƵĐƚWƌŽƉŽƐĞƌƐŽŶĨĞƌĞŶĐĞ͕ŝĨ ĂƉƉůŝĐĂďůĞ ΎZĞĐĞŝǀĞWƌŽƉŽƐĂůƐŽƌ^KYƐ ΘсƌĐŚŝƚĞĐƚƵƌĂůĂŶĚŶŐŝŶĞĞƌŝŶŐ /K/сĂůƚƌĂŶƐ/ŶĚĞƉĞŶĚĞŶƚKĨĨŝĐĞŽĨƵĚŝƚƐĂŶĚ /ŶǀĞƐƚŝŐĂƚŝŽŶƐ dсĂůƚƌĂŶƐ сŝƐĂĚǀĂŶƚĂŐĞĚƵƐŝŶĞƐƐŶƚĞƌƉƌŝƐĞ >сŝǀŝƐŝŽŶŽĨ>ŽĐĂůƐƐŝƐƚĂŶĐĞ >сŝƐƚƌŝĐƚ>ŽĐĂůƐƐŝƐƚĂŶĐĞŶŐŝŶĞĞƌ >Ͳ,YсŝǀŝƐŝŽŶŽĨ>ŽĐĂůƐƐŝƐƚĂŶĐĞͲ,ĞĂĚƋƵĂƌƚĞƌƐ >W'с>ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽŐƌĂŵ'ƵŝĚĞůŝŶĞƐ >WDс>ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂů DKWсDĞƚŚŽĚŽĨWĂLJŵĞŶƚ Z&WсZĞƋƵĞƐƚĨŽƌWƌŽƉŽƐĂů Z&YсZĞƋƵĞƐƚĨŽƌYƵĂůŝĨŝĐĂƚŝŽŶƐ ^KYс^ƚĂƚĞŵĞŶƚŽĨYƵĂůŝĨŝĐĂƚŝŽŶƐ ^Ktс^ƚĂƚĞŵĞŶƚͬ^ĐŽƉĞŽĨtŽƌŬ &ŝŐƵƌĞϭϬͲϭ͗ ΘŽŶƚƌĂĐƚWƌŽĐƵƌĞŵĞŶƚWƌŽĐĞƐƐtŽƌŬĨůŽǁŝĂŐƌĂŵͲ ĐŽŶƚŝŶƵĞĚ WĂŐĞǀŝŝŽĨŝdž :ĂŶƵĂƌLJϮϬϭϵ 41 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ ǀĂůƵĂƚŝŽŶĂŶĚ^ĞůĞĐƚŝŽŶŽĨŽŶƐƵůƚĂŶƚ ŽŶƚƌĂĐƚEĞŐŽƚŝĂƚŝŽŶ ϳ ϴ ϵ >ŽĐĂůŐĞŶĐLJ>ŽĐĂůŐĞŶĐLJ>ŽĐĂůŐĞŶĐLJ ΎŝƐƚƌŝďƵƚĞWƌŽƉŽƐĂůƐŽƌ^KYƐƚŽ ^ĞůĞĐƚŝŽŶŽŵŵŝƚƚĞĞŵĞŵďĞƌƐ ΎŶƐƵƌĞŽŵŵŝƚƚĞĞŵĞŵďĞƌƐƌĞĐĞŝǀĞ ƚŚĞĂƉƉƌŽƉƌŝĂƚĞƐĐŽƌĞƐŚĞĞƚƚŽƵƐĞ ;ƐĞĞExhibit 10-B: Suggested Consultant Evaluation SheetͿ ΎŽŶǀĞŶĞ^ĞůĞĐƚŝŽŶŽŵŵŝƚƚĞĞĂŶĚ ĞǀĂůƵĂƚĞƐƵďŵŝƚƚĂůƐ͖WĞƌĨŽƌŵ ƌĞĨĞƌĞŶĐĞĐŚĞĐŬƐ ΎĞǀĞůŽƉ&ŝŶĂůZĂŶŬŝŶŐŽƌ^ŚŽƌƚ>ŝƐƚ ΎEŽƚŝĨLJƉƌŽƉŽƐĞƌƐŽĨƌĂŶŬŝŶŐͬ^ŚŽƌƚ>ŝƐƚ ΎZĞƚĂŝŶĂůůŽƌŝŐŝŶĂůƐĐŽƌĞƐŚĞĞƚƐĂŶĚ ƐƵŵŵĂƌŝĞƐ Ύ^ĞŶĚŽƵƚZ&WƐƚŽ^ŚŽƌƚ>ŝƐƚ;ƚǁŽͲ ƐƚĞƉƉƌŽĐĞƐƐͿ ΎŽŶĚƵĐƚ/ŶƚĞƌǀŝĞǁŽĨ^ŚŽƌƚ>ŝƐƚ;ŝĨ ŶĞĞĚĞĚͿ ΎĞǀĞůŽƉ&ŝŶĂůZĂŶŬŝŶŐŽĨ ŽŶƐƵůƚĂŶƚƐ͕ĂŶĚŶŽƚŝĨLJĂůů ŝŶƚĞƌǀŝĞǁĞĞƐ ΎZĞƚĂŝŶĂůůŽƌŝŐŝŶĂůƐĐŽƌĞƐŚĞĞƚƐ ĂŶĚƐƵŵŵĂƌŝĞƐ ΎWƌŽǀŝĚĞĂĐŽƉLJŽĨ^ƚĂŶĚĂƌĚ ŽŶƚƌĂĐƚůĂŶŐƵĂŐĞƚŽƚŽƉ ƌĂŶŬĞĚĐŽŶƐƵůƚĂŶƚĂŶĚ ŝŶǀŝƚĞĨŽƌŶĞŐŽƚŝĂƚŝŽŶƐ ;ƐĞĞExhibit 10-R: A&E Sample Contract Language ĨŽƌƐƚĂŶĚĂƌĚ ĐŽŶƚƌĂĐƚůĂŶŐƵĂŐĞĂŶĚ ƉƌŽǀŝƐŝŽŶƐͿ ΎKƉĞŶĂŶĚĂŶĂůLJnjĞĐŽƐƚƉƌŽƉŽƐĂů ĨƌŽŵƚŚĞ,ŝŐŚĞƐƚZĂŶŬĞĚĨŝƌŵ ĂůƚƌĂŶƐ/K/ 5HYLHZDQGHYDOXDWe 10-A package ĂŶĚƐƵƉƉŽƌƚŝŶŐ ĚŽĐƵŵĞŶƚƐ͕ŝĨĂƉƉůŝĐĂďůĞ Ύ/ƐƐƵĞ&ŝŶĂŶĐŝĂůZĞǀŝĞǁ>ĞƚƚĞƌ͕ŝĨ ĂƉƉůŝĐĂďůĞ ΎWĞƌĨŽƌŵĐŽŶƚƌĂĐƚĂƵĚŝƚƐĂŶĚ ƌĞǀŝĞǁƐ͕ŝĨĂƉƉůŝĐĂďůĞ͕ŽƌƌĞǀŝĞǁ ŽĨWĂƵĚŝƚĞĚ/ZǁŽƌŬƉĂƉĞƌƐ ƚŽŝƐƐƵĞŽŐŶŝnjĂŶƚ>ĞƚƚĞƌŽĨ ƉƉƌŽǀĂů ΘсƌĐŚŝƚĞĐƚƵƌĂůĂŶĚŶŐŝŶĞĞƌŝŶŐ /K/сĂůƚƌĂŶƐ/ŶĚĞƉĞŶĚĞŶƚKĨĨŝĐĞŽĨƵĚŝƚƐĂŶĚ /ŶǀĞƐƚŝŐĂƚŝŽŶƐ dсĂůƚƌĂŶƐ сŝƐĂĚǀĂŶƚĂŐĞĚƵƐŝŶĞƐƐŶƚĞƌƉƌŝƐĞ >сŝǀŝƐŝŽŶŽĨ>ŽĐĂůƐƐŝƐƚĂŶĐĞ >сŝƐƚƌŝĐƚ>ŽĐĂůƐƐŝƐƚĂŶĐĞŶŐŝŶĞĞƌ >Ͳ,YсŝǀŝƐŝŽŶŽĨ>ŽĐĂůƐƐŝƐƚĂŶĐĞͲ,ĞĂĚƋƵĂƌƚĞƌƐ >W'с>ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽŐƌĂŵ'ƵŝĚĞůŝŶĞƐ >WDс>ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂů DKWсDĞƚŚŽĚŽĨWĂLJŵĞŶƚ Z&WсZĞƋƵĞƐƚĨŽƌWƌŽƉŽƐĂů Z&YсZĞƋƵĞƐƚĨŽƌYƵĂůŝĨŝĐĂƚŝŽŶƐ ^KYс^ƚĂƚĞŵĞŶƚŽĨYƵĂůŝĨŝĐĂƚŝŽŶƐ ^Ktс^ƚĂƚĞŵĞŶƚͬ^ĐŽƉĞŽĨtŽƌŬ &ŝŐƵƌĞϭϬͲϭ͗ ΘŽŶƚƌĂĐƚWƌŽĐƵƌĞŵĞŶƚWƌŽĐĞƐƐtŽƌŬĨůŽǁŝĂŐƌĂŵͲ ĐŽŶƚŝŶƵĞĚ WĂŐĞǀŝŝŝŽĨŝdž :ĂŶƵĂƌLJϮϬϭϵ 42 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ ŽŶƚƌĂĐƚEĞŐŽƚŝĂƚŝŽŶ ŽŶƚƌĂĐƚdžĞĐƵƚŝŽŶ ϭϬϭϭϭϮ >ŽĐĂůŐĞŶĐLJ>ŽĐĂůŐĞŶĐLJ>ŽĐĂůŐĞŶĐLJ ΎEĞŐŽƚŝĂƚĞĐŽŶƚƌĂĐƚĐŽƐƚƐǁŝƚŚƚŚĞ ŵŽƐƚƋƵĂůŝĨŝĞĚŽŶƐƵůƚĂŶƚ ΎWƌĞƉĂƌĞĂŶĚƌĞƚĂŝŶƌĞĐŽƌĚŽĨĐŽƐƚ ŶĞŐŽƚŝĂƚŝŽŶƐ Ύ/ŶŝƚŝĂƚĞd/K/&ŝŶĂŶĐŝĂůZĞǀŝĞǁ Section ;LAPM Section 10.1.3Ϳ ĂŶĚƐĞŶĚĚŽĐƵŵĞŶƚƐ;Exhibit 10-A: A&E Consultant Financial Document Review RequestͿ͕ŝĨ ĂƉƉůŝĐĂďůĞ͕ƚŽĂůƚƌĂŶƐ/K/ ΎZĞĐĞŝǀĞĂŶĚĂŶĂůLJnjĞĨŝŶĚŝŶŐƐŽĨƚŚĞ &ŝŶĂŶĐŝĂůZĞǀŝĞǁ>ĞƚƚĞƌĨƌŽŵd /K/͕ŝĨĂŶLJ ΎĚĚƌĞƐƐĂŶĚƌĞƐŽůǀĞĂůůĨŝŶĚŝŶŐƐďLJ /K/ĂŶĚŝŶĐŽƌƉŽƌĂƚĞŝŶƚŽĨŝŶĂů ĐŽŶƚƌĂĐƚĂŶĚĐŽƐƚƉƌŽƉŽƐĂů Ύ/ĨŶĞŐŽƚŝĂƚŝŽŶƐǁŝƚŚ&ŝƌƐƚƌĂŶŬĞĚ ĨŝƌŵŝƐƵŶƐƵĐĐĞƐƐĨƵů͕ĨŽƌŵĂůůLJ ƚĞƌŵŝŶĂƚĞĐŽƐƚŶĞŐŽƚŝĂƚŝŽŶƐǁŝƚŚ ŽŶƐƵůƚĂŶƚĂŶĚďĞŐŝŶ^ƚĞƉϵǁŝƚŚ ŶĞdžƚƌĂŶŬĞĚĐŽŶƐƵůƚĂŶƚ ^ĞŶĚdžŚŝďŝƚϭϬͲƚŽ>Ͳ,YĨŽƌ ĂĐĐĞƉƚĂŶĐĞƉƌŝŽƌƚŽĂǁĂƌĚ ΎZĞƚĂŝŶĂĐĐĞƉƚĂŶĐĞŽĨdžŚŝďŝƚϭϬͲ ĨƌŽŵ>Ͳ,Y Ύ&ŝŶĂůŝnjĞĐŽŶƚƌĂĐƚ͕ĐŽƐƚƉƌŽƉŽƐĂů ΎZĞƚĂŝŶĐŽƉLJŽĨĐŽŶƚƌĂĐƚ&ŝŶĂŶĐŝĂů ZĞǀŝĞǁ>ĞƚƚĞƌǁŝƚŚĂĐĐĞƉƚĂŶĐĞ͕ ĚĞŶŝĂů͕ŽƌĂĚũƵƐƚŵĞŶƚŽĨƚŚĞ/Z Ύ^ŝŐŶĂŶĚdžĞĐƵƚĞĐŽŶƚƌĂĐƚ ΎKĨĨĞƌĂŶĚĐŽŶĚƵĐƚĚĞďƌŝĞĨŝŶŐ ŵĞĞƚŝŶŐƐǁŝƚŚĐŽŶƐƵůƚĂŶƚǁŚŽ ĂƐŬĞĚĨŽƌŽŶĞ Ύ^ĞŶĚĐŽƉŝĞƐŽĨĞdžĞĐƵƚĞĚĐŽŶƚƌĂĐƚ ĂŶĚŽŵŵŝƚŵĞŶƚ;Exhibits 10-O1: Consultant Proposal DBE Commitment and Exhibit 10-O2: Consultant Contract DBE CommitmentͿƚŽ> ΎůŽƐĞŽƵƚĐŽŶƚƌĂĐƚƉƌŽĐƵƌĞŵĞŶƚ ƉƌŽĐĞƐƐ > ΎWƌŝŽƌƚŽĐŽŶĐƵƌƌŝŶŐǁŝƚŚŝŶǀŽŝĐĞ ƉĂLJŵĞŶƚƌĞůĂƚĞĚƚŽĐŽŶƐƵůƚĂŶƚ ƐĞƌǀŝĐĞƐ͕ĞŶƐƵƌĞƚŚĂƚĚŝƐƚƌŝĐƚ ĐŽŶĨŝƌŵƐĂĐĐĞƉƚĂŶĐĞŽĨdžŚŝďŝƚ ϭϬͲĂŶĚŚĂƐĂĐŽƉLJŽĨƚŚĞ ĞdžĞĐƵƚĞĚĐŽŶƐƵůƚĂŶƚĐŽŶƚƌĂĐƚŽŶ ĨŝůĞĂŶĚ10-O1 and 10-O2͘ůƐŽ͕ ĐŚĞĐŬ/K/ĚĂƚĂďĂƐĞƚŽĞŶƐƵƌĞ ƚŚĂƚLAPM Exhibit 10-K: Consultant ŶŶƵĂůCertifŝcation of /ŶĚŝƌĞĐƚCosts and Financŝal Management System͕ŝĨ ĂƉƉůŝĐĂďůĞ͕ŚĂƐďĞĞŶƌĞĐĞŝǀĞĚďLJ /K/ ĂůƚƌĂŶƐ/K/ ΎWĞƌĨŽƌŵ/ŶĐƵƌƌĞĚŽƐƚƵĚŝƚ͕ŝĨ ƐĞůĞĐƚĞĚ ΘсƌĐŚŝƚĞĐƚƵƌĂůĂŶĚŶŐŝŶĞĞƌŝŶŐ /K/сĂůƚƌĂŶƐ/ŶĚĞƉĞŶĚĞŶƚKĨĨŝĐĞŽĨƵĚŝƚƐĂŶĚ /ŶǀĞƐƚŝŐĂƚŝŽŶƐ dсĂůƚƌĂŶƐ сŝƐĂĚǀĂŶƚĂŐĞĚƵƐŝŶĞƐƐŶƚĞƌƉƌŝƐĞ >сŝǀŝƐŝŽŶŽĨ>ŽĐĂůƐƐŝƐƚĂŶĐĞ >сŝƐƚƌŝĐƚ>ŽĐĂůƐƐŝƐƚĂŶĐĞŶŐŝŶĞĞƌ >Ͳ,YсŝǀŝƐŝŽŶŽĨ>ŽĐĂůƐƐŝƐƚĂŶĐĞͲ,ĞĂĚƋƵĂƌƚĞƌƐ >W'с>ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽŐƌĂŵ'ƵŝĚĞůŝŶĞƐ >WDс>ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂů DKWсDĞƚŚŽĚŽĨWĂLJŵĞŶƚ Z&WсZĞƋƵĞƐƚĨŽƌWƌŽƉŽƐĂů Z&YсZĞƋƵĞƐƚĨŽƌYƵĂůŝĨŝĐĂƚŝŽŶƐ ^KYс^ƚĂƚĞŵĞŶƚŽĨYƵĂůŝĨŝĐĂƚŝŽŶƐ ^Ktс^ƚĂƚĞŵĞŶƚͬ^ĐŽƉĞŽĨtŽƌŬ &ŝŐƵƌĞϭϬͲϭ͗ ΘŽŶƚƌĂĐƚWƌŽĐƵƌĞŵĞŶƚWƌŽĐĞƐƐtŽƌŬĨůŽǁŝĂŐƌĂŵͲ ĐŽŶƚŝŶƵĞĚ WĂŐĞŝdžŽĨŝdž :ĂŶƵĂƌLJϮϬϭϵ 43 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ *(1(5$/ ,QWURGXFWLRQ $ORFDODJHQF\PD\HQJDJHFRQVXOWDQWVWRSHUIRUPDUFKLWHFWXUDOHQJLQHHULQJDQGUHODWHG VHUYLFHVWRGHYHORSDIHGHUDODLGIXQGHGSURMHFW/RFDODJHQFLHVUHTXHVWLQJIHGHUDOIXQGVWR UHLPEXUVH$ (&RQVXOWDQWVPXVWIROORZWKHVHOHFWLRQDQGFRQWUDFWLQJSURFHGXUHVGHWDLOHGLQ WKLVFKDSWHU 'HILQLWLRQRIDQ$UFKLWHFWXUDODQG(QJLQHHULQJ&RQVXOWDQW &RGHRI)HGHUDO5HJXODWLRQV†DQG&$6WDWH/DZIXUWKHUGHILQHV$ (VHUYLFHVDQG LQFOXGHVWKRVHSULYDWHFRQVXOWLQJILUPVSURYLGLQJDUFKLWHFWXUDOODQGVFDSHDUFKLWHFWXUDO HQJLQHHULQJHQYLURQPHQWDOODQGVXUYH\LQJFRQVWUXFWLRQHQJLQHHULQJRUSURJUDP PDQDJHPHQWDUHWHUPHG$UFKLWHFWXUDODQG(QJLQHHULQJ $ ( &RQVXOWDQWV $UFKLWHFWXUDODQG(QJLQHHULQJ&RQVXOWDQWV 7KH%URRNV$FW 86&6HFWLRQ UHTXLUHVORFDODJHQFLHVWRDZDUGIHGHUDOO\IXQGHG HQJLQHHULQJDQGGHVLJQUHODWHGFRQWUDFWVEDVHGRQIDLUDQGRSHQFRPSHWLWLYHQHJRWLDWLRQV GHPRQVWUDWHGFRPSHWHQFHDQGSURIHVVLRQDOTXDOLILFDWLRQV &RGHRI)HGHUDO5HJXODWLRQV &)5 3DUW DWDIDLUDQGUHDVRQDEOHSULFH &)5  &RVWSURSRVDOVVXEPLWWHGWRWKHORFDODJHQF\PXVWEHVHDOHGDQGVKDOOQRWEHLQFOXGHGDVD FULWHULRQIRUUDWLQJVXFKFRQVXOWDQWV$IWHUUDQNLQJFRVWQHJRWLDWLRQVPD\EHJLQZLWKWKHPRVW TXDOLILHGFRQVXOWDQWDQGRQO\WKHLUFRVWSURSRVDOZLOOEHRSHQHG6KRXOGQHJRWLDWLRQVIDLORU UHVXOWLQDSULFHWKDWWKHORFDODJHQF\GRHVQRWFRQVLGHUIDLUDQGUHDVRQDEOHQHJRWLDWLRQVPXVW EHIRUPDOO\WHUPLQDWHGDQGWKHORFDODJHQF\PXVWWKHQXQGHUWDNHQHJRWLDWLRQVZLWKWKHVHFRQG PRVWTXDOLILHGFRQVXOWDQW ,IWKHQHJRWLDWLRQVZLWKWKHVHFRQGPRVWTXDOLILHGILUPDUHQRWVXFFHVVIXOQHJRWLDWLRQVPXVWEH IRUPDOO\WHUPLQDWHGDQGWKHORFDODJHQF\PXVWWKHQXQGHUWDNHQHJRWLDWLRQVZLWKWKHWKLUGPRVW TXDOLILHGFRQVXOWDQWDQGVRRQXQWLOWKHSULFHLVGHWHUPLQHGWREHIDLUDQGUHDVRQDEOHE\WKH ORFDODJHQF\ ,QVHOHFWLQJDQ$ (FRQVXOWDQWDGHWDLOHGWHFKQLFDOSURSRVDORUTXDOLILFDWLRQVSURSRVDODQGD SURSRVHGFRQWUDFWZLOOEHUHTXLUHG 'HSHQGLQJXSRQWKHVFRSHRIZRUNWKHUHTXLUHGFRQWUDFWSURYLVLRQVPD\QHHGWRLQFOXGHWKH &DOLIRUQLD6WDWH3UHYDLOLQJ:DJHV )HGHUDO3D\PHQWRI3UHGHWHUPLQHG0LQLPXP:DJHDSSOLHV RQO\WRIHGHUDODLGFRQVWUXFWLRQFRQWUDFWV 3UHYDLOLQJZDJHVZLOODSSO\LIWKHVHUYLFHVWREH SHUIRUPHGZLOOLQYROYHODQGVXUYH\LQJ VXFKDVIODJSHUVRQVVXUYH\SDUW\FKLHIURGPDQRU FKDLQPDQ PDWHULDOVVDPSOLQJDQGWHVWLQJ VXFKDVGULOOLQJULJRSHUDWRUVSLOHGULYLQJFUDQH RSHUDWRUV LQVSHFWLRQZRUNVRLOVRUIRXQGDWLRQLQYHVWLJDWLRQVHQYLURQPHQWDOKD]DUGRXV PDWHULDOVDQGVRIRUWK&DOLIRUQLD6WDWH3UHYDLOLQJ:DJHLQIRUPDWLRQLVDYDLODEOHWKURXJKWKH &DOLIRUQLD'HSDUWPHQWRI,QGXVWULDO5HODWLRQVZHEVLWHVEHORZ &RQVXOWDQWVZLOOQHHGWRSURYLGHWKHLU3UHYDLOLQJ:DJH3ROLF\LIWKHLUSDUWLFLSDWLRQRQWKH SURMHFWLQFOXGHVSUHYDLOLQJZDJHZRUN7KHSROLF\ZLOOLQFOXGHLQIRUPDWLRQRQWKHDFFRXQWLQJ WĂŐĞϭŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 44 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ WUHDWPHQWRIGHOWDEDVHDQGGHOWDIULQJHDQGYHULI\WKHDFFRXQWLQJWUHDWPHQWLVFRQVLVWHQWHYHU\ \HDU x',5)$4ZHEVLWH KWWSZZZGLUFDJRY235/)$4B3UHYDLOLQJ:DJHKWPO x',5:DJH'HWHUPLQDWLRQZHEVLWH KWWSZZZGLUFDJRYRSUO'3UH:DJH'HWHUPLQDWLRQKWP x&DOWUDQV3UHYDLOLQJ:DJH,QWHUSUHWLYH*XLGDQFH KWWSZZZGRWFDJRYKTDXGLWVGRFXPHQWVSUHYDLOLQJZDJHLQWHUSUHWLYH JXLGDQFHSGI 1RQ$ (&RQVXOWDQWV &RQVXOWDQWVRWKHUWKDQ$ (FRQVXOWDQWVPD\EHVHOHFWHGXVLQJFRVWFRVWDQGTXDOLILFDWLRQV EHVWYDOXH RURWKHUFULWLFDOVHOHFWLRQFULWHULD7KHSURFHGXUHVRXWOLQHGLQWKLVFKDSWHUFDQEH PRGLILHGIRUVHOHFWLQJQRQ$ (FRQVXOWDQWVE\DGGLQJDFRVWLWHPWRWKHFRQWUDFWSURSRVDO )RUPRUHGHWDLOVRQQRQ$ (FRQVXOWDQWVVHH6HFWLRQNon-A&E Contracts RIWKLVFKDSWHU 6HOHFWLQJWKH3URMHFW 7KHORFDODJHQF\LVUHVSRQVLEOHIRUVHOHFWLQJDQGLQLWLDWLQJDIHGHUDODLGILQDQFHGWUDQVSRUWDWLRQ SURMHFW7KHGHFLVLRQWREHJLQSURMHFWGHYHORSPHQWLVLQIOXHQFHGE\WKHSURMHFWQHHGVLWV DFFHSWDELOLW\WKHWLPLQJRIVWXGLHVILQDQFLQJDQGFRQVWUXFWLRQ7KHORFDODJHQF\PXVWLGHQWLI\ WKHSURMHFW·VREMHFWLYHVLQFOXGLQJWKHJHQHUDOOHYHORILPSURYHPHQWRUVHUYLFHRSHUDWLQJ VWDQGDUGVPD[LPXPFRVWDQGWKHWDUJHWGDWHIRUSURMHFWFRPSOHWLRQEHIRUHFRPPHQFLQJDQ\ FRQVXOWDQWVHOHFWLRQSURFHVV 6XEFRQWUDFWHG6HUYLFHV 7KHFRQVXOWDQWLVUHVSRQVLEOHIRUSHUIRUPLQJWKHZRUNUHTXLUHGXQGHUWKHFRQWUDFWLQDPDQQHU DFFHSWDEOHWRWKHORFDODJHQF\7KHFRQVXOWDQW·VRUJDQL]DWLRQDQGDOODVVRFLDWHGFRQVXOWDQWVDQG VXEFRQVXOWDQWVPXVWEHLGHQWLILHGLQWKHSURSRVDO,IWKHFRQVXOWDQWZLVKHVWRXVHD VXEFRQVXOWDQWQRWVSHFLILHGLQWKHSURSRVDOSULRUZULWWHQDSSURYDOPXVWEHREWDLQHGIURPWKH ORFDODJHQF\7KHVXEFRQWUDFWPXVWFRQWDLQDOOUHTXLUHGSURYLVLRQVRIWKHSULPHFRQWUDFW$OO VXEDZDUGVPXVWLQFOXGHDGHTXDWHRYHUVLJKWPDQDJHPHQWDQGDGPLQLVWUDWLRQRIHQJLQHHULQJ DQGGHVLJQUHODWHGFRQVXOWDQWVHUYLFHVDQGEHDGPLQLVWHUHGLQDFFRUGDQFHZLWK6WDWHODZVDQG SURFHGXUHVVSHFLILHGLQ86& J  &)5 2UJDQL]DWLRQDODQG&RQVXOWDQW&RQIOLFWVRI,QWHUHVW ,QWKHSURFXUHPHQWRIFRQWUDFWVIRUHQJLQHHULQJVHUYLFHVE\SULYDWHFRQVXOWLQJILUPVXVLQJ IHGHUDODLGKLJKZD\IXQGVORFDODJHQFLHVPXVWWDNHDOOWKHVWHSVQHFHVVDU\WRSUHYHQWIUDXG ZDVWHDQGDEXVH7KHORFDODJHQF\PXVWGHYHORSDQGPDLQWDLQDZULWWHQFRGHRIFRQGXFW JRYHUQLQJWKHSHUIRUPDQFHRILWVHPSOR\HHV LQFOXGLQJWKHFRQWUDFWDGPLQLVWUDWRU HQJDJHGLQ WKHDZDUGDQGDGPLQLVWUDWLRQRIIHGHUDODLGKLJKZD\IXQGHGFRQWUDFWVLQFOXGLQJWKH SUHYHQWLRQRIFRQIOLFWVRILQWHUHVWLQDFFRUGDQFHZLWK&)5 E   WĂŐĞϮŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 45 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ $FRQIOLFWRILQWHUHVWRFFXUVZKHQDSXEOLFRIILFLDO·VSULYDWHLQWHUHVWVDQGKLVRUKHUSXEOLFGXWLHV DQGUHVSRQVLELOLWLHVGLYHUJHRUDUHQRWFRQVLVWHQW&RQIOLFWVRILQWHUHVWPD\EHGLUHFWRULQGLUHFW HJDVUHVXOWRIDSHUVRQDORUEXVLQHVVUHODWLRQVKLS 7KHDSSHDUDQFHRIDFRQIOLFWRILQWHUHVW VKRXOGEHDYRLGHGDVDQDSSDUHQWFRQIOLFWPD\XQGHUPLQHSXEOLFWUXVWLIQRWVXIILFLHQWO\ PLWLJDWHG )HGHUDO5HJXODWLRQ*RYHUQLQJ&RQIOLFWRI,QWHUHVW &)5 E  5HTXLUHV WKDW x/RFDODJHQF\VKDOOPDLQWDLQDZULWWHQFRGHRIVWDQGDUGVRIFRQGXFWIRU HPSOR\HHVHQJDJHGLQWKHDZDUGDQGDGPLQLVWUDWLRQRIHQJLQHHULQJDQGGHVLJQ VHUYLFHFRQWUDFWV x1RFRQWUDFWLQJDJHQF\HPSOR\HHZKRSDUWLFLSDWHVLQWKHSURFXUHPHQW PDQDJHPHQWRUDGPLQLVWUDWLRQRIIHGHUDOIXQGHGFRQWUDFWVRUVXEFRQWUDFWV VKDOOKDYHGLUHFWO\RULQGLUHFWO\DQ\ILQDQFLDORURWKHUSHUVRQDOLQWHUHVWLQ FRQQHFWLRQZLWKVXFKFRQWUDFWRUVXEFRQWUDFW x1RSHUVRQRUHQWLW\SHUIRUPLQJVHUYLFHVIRUDFRQWUDFWLQJDJHQF\LQFRQQHFWLRQ ZLWKDIHGHUDOIXQGHGSURMHFWVKDOOKDYHGLUHFWO\RULQGLUHFWO\DQ\ILQDQFLDORU RWKHUSHUVRQDOLQWHUHVWRWKHUWKDQHPSOR\PHQWRUUHWHQWLRQE\WKHFRQWUDFWLQJ DJHQF\LQDQ\FRQWUDFWRUVXEFRQWUDFWLQFRQQHFWLRQZLWKVXFKSURMHFW x1RSHUVRQRUHQWLW\SHUIRUPLQJVHUYLFHVIRUDFRQWUDFWLQJDJHQF\LQFRQQHFWLRQ ZLWKDIHGHUDODLGKLJKZD\IXQGHGSURMHFWVKDOOKDYHGLUHFWO\RULQGLUHFWO\DQ\ ILQDQFLDORURWKHUSHUVRQDOLQWHUHVWLQDQ\UHDOSURSHUW\DFTXLUHGIRUWKHSURMHFW x1RFRQWUDFWLQJDJHQF\HPSOR\HHVRUDJHQWVVKDOOQHLWKHUVROLFLWQRUDFFHSW JUDWXLWLHVIDYRUVRUDQ\WKLQJRIPRQHWDU\YDOXHIURPFRQVXOWDQWVSRWHQWLDO FRQVXOWDQWVRUSDUWLHVWRVXEDJUHHPHQWV x/RFDODJHQF\VKDOOGLVFORVHLQZULWLQJDQ\SRWHQWLDOFRQIOLFWRILQWHUHVWWR)+:$ &RQVXOWDQWV3HUIRUPLQJ:RUNRQ0XOWLSOH3KDVHVRI)HGHUDODLG3URMHFWV /RFDODJHQFLHVVRPHWLPHVZLVKWRKLUHWKHVDPHFRQVXOWDQWILUPWRSHUIRUPFRQVWUXFWLRQ HQJLQHHULQJDQGRULQVSHFWLRQVHUYLFHVRQWKHVDPHSURMHFWRQZKLFKWKHILUPDOVRSHUIRUPHG GHVLJQVHUYLFHV7KLVFDQFDXVHSURMHFWGHOLYHU\HIILFLHQFLHVDVWKHGHVLJQILUPLVZHOOVXLWHGWR YHULI\WKDWWKHSURMHFWLVEHLQJFRQVWUXFWHGLQDFFRUGDQFHZLWKWKHGHVLJQDQGFDQUHVROYHLVVXHV UHODWHGWRWKHGHVLJQRQEHKDOIRIWKHFRQWUDFWLQJDJHQF\+RZHYHUWKLVPD\DOVRSRVHD SRWHQWLDOFRQIOLFWRILQWHUHVWLIWKHILUPKDVDYHVWHGILQDQFLDOLQWHUHVWLQIDLOLQJWRGLVFORVH GHILFLHQFLHVLQLWVGHVLJQZRUNSURGXFWDQGVHHNVWRLQVXODWHLWVHOIIURPSHFXQLDU\OLDELOLW\LQ VXEVHTXHQWSKDVHVRIWKHSURMHFWVXFKDVPLQLPL]LQJRULJQRULQJGHVLJQHUURUVDQGRPLVVLRQV UDWKHUWKDQVHUYLQJWKHEHVWLQWHUHVWVRIWKHFRQWUDFWLQJDJHQF\DQGWKHSXEOLF3URFXULQJD GLIIHUHQWILUPIURPWKHGHVLJQILUPWRSURYLGHWKHFRQVWUXFWLRQHQJLQHHULQJDQGRULQVSHFWLRQ VHUYLFHVSURYLGHVDQRWKHUOHYHORIUHYLHZDQGUHGXFHVWKHULVNRIRUSRWHQWLDOIRUDFRQIOLFWRI LQWHUHVW WĂŐĞϯŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 46 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ $OWKRXJKIHGHUDOUHJXODWLRQVGRQRWH[SUHVVO\SURKLELWWKHVDPHILUPIURPSURYLGLQJVHUYLFHV RQVXEVHTXHQWSKDVHVWKHORFDODJHQFLHVDUHUHVSRQVLEOHIRUHQVXULQJWKHSXEOLFLQWHUHVWLV PDLQWDLQHGWKURXJKRXWWKHOLIHRIDSURMHFWDQGWKDWDFRQIOLFWRILQWHUHVWUHDORUDSSDUHQWGRHV QRWRFFXURULVVXIILFLHQWO\PLWLJDWHGE\DSSURSULDWHSXEOLFDJHQF\FRQWUROV3ULRUWRDOORZLQJD FRQVXOWLQJILUPWRSURYLGHVHUYLFHVRQVXEVHTXHQWSKDVHVRIWKHVDPHSURMHFWWKHFRQWUDFWLQJ DJHQF\PXVWHVWDEOLVKDSSURSULDWHFRPSHQVDWLQJFRQWUROVLQSROLFLHVSURFHGXUHVSUDFWLFHVDQG RWKHUVDIHJXDUGVWRHQVXUHDFRQIOLFWRILQWHUHVWGRHVQRWRFFXULQWKHSURFXUHPHQW PDQDJHPHQWDQGDGPLQLVWUDWLRQRIFRQVXOWDQWVHUYLFHV :KHQGHVLJQDQGFRQVWUXFWLRQSKDVHVHUYLFHVDUHSURFXUHGXQGHUDVLQJOHVROLFLWDWLRQWKH VHOHFWLRQRIWKHFRQVXOWLQJILUPPXVWEHEDVHGRQWKHRYHUDOOTXDOLILFDWLRQVWRSURYLGHERWK GHVLJQDQGFRQVWUXFWLRQSKDVHVHUYLFHVZKLFKUHTXLUHGLIIHUHQWVNLOOVHWVH[SHULHQFHDQG UHVRXUFHV3URFXULQJWKHVHVHUYLFHVXQGHUGLIIHUHQWVROLFLWDWLRQVPD\UHVXOWLQVHOHFWLRQRID PRUHTXDOLILHGILUPWRSHUIRUPVHUYLFHVLQHDFKSKDVHDVWKHPRVWTXDOLILHGILUPWRSHUIRUP GHVLJQSKDVHVHUYLFHVPD\QRWEHWKHPRVWTXDOLILHGILUPWRSURYLGHFRQVWUXFWLRQSKDVH VHUYLFHV6LPLODUO\WKHTXDOLILFDWLRQVDQGFDSDFLW\RIDILUPPD\FKDQJHRYHUWLPH$VVXFKLW PD\QRWEHDSSURSULDWHWRFRQWUDFWZLWKDFRQVXOWLQJILUPWRSURYLGHFRQVWUXFWLRQSKDVH VHUYLFHVDWWKHRXWVHWRIDGHVLJQSKDVHNQRZLQJWKDWWKHVHVHUYLFHVPD\QRWEHQHHGHGIRUDQ H[WHQGHGSHULRGXQWLOWKHSUHFRQVWUXFWLRQSKDVHRIWKHSURMHFWLVFRPSOHWHDQGFRQVWUXFWLRQ IXQGLQJDXWKRUL]HG7KHFRQWUDFWZLWKDFRQVXOWLQJILUPSURYLGLQJGHVLJQSKDVHVHUYLFHVRQD SURMHFWPD\QRWEHDPHQGHGWRLQFOXGHFRQVWUXFWLRQSKDVHVHUYLFHVXQOHVVWKHGHVLUHG FRQVWUXFWLRQSKDVHVHUYLFHVZHUHLQFOXGHGZLWKLQWKHRULJLQDODGYHUWLVHGVFRSHRIVHUYLFHVDQG HYDOXDWLRQFULWHULDRIWKHVROLFLWDWLRQIURPZKLFKDTXDOLILFDWLRQVEDVHGVHOHFWLRQZDVFRQGXFWHG $OOFRQVXOWDQWVDFWLQJLQDPDQDJHPHQWVXSSRUWUROHPXVWFRPSOHWHExhibit 10-U: Consultant in Management Support Role Conflict of Interest and Confidentiality Statement VHHSection 10.1.9: Miscellaneous Considerations LQWKLVFKDSWHU DQGUHWDLQLWLQWKHORFDODJHQF\ILOHV 0LVFHOODQHRXV&RQVLGHUDWLRQV$XWKRUL]DWLRQWR3URFHHG 7KH)HGHUDO+LJKZD\$GPLQLVWUDWLRQ )+:$ PXVWJLYHWKHORFDODJHQF\DQ$XWKRUL]DWLRQWR 3URFHHG ( ZLWKWKHZRUNSULRUWRSHUIRUPLQJRIDQ\ZRUNIRUZKLFKIHGHUDOUHLPEXUVHPHQW LVWREHUHTXHVWHG VHHWKHLAPM Chapter 3: Project Authorization )RUVWDWHIXQGHGSURMHFWVVHH 6HFWLRQState-Only Funded A&E Contracts DQGWKH/RFDO$VVLVWDQFH3URJUDP*XLGHOLQHV (LAPG), Chapter 23: Local Agency State Transportation Improvement Program ProjectsIRUJXLGDQFH RQZKHQZRUNPD\SURFHHG &RSLHVRIWKH$XWKRUL]DWLRQWR3URFHHGDQGWKHFRQVXOWDQWFRQWUDFWPXVWEHUHWDLQHGLQWKHORFDO DJHQF\SURMHFWILOHVIRUIXWXUHDXGLW ,'(17,)<,1* '(),1,1*$1((')25&2168/7$176 7KHQHHGIRUDFRQVXOWDQWLVLGHQWLILHGE\FRPSDULQJWKHSURMHFW·VVFKHGXOHDQGREMHFWLYHVZLWK WKHORFDODJHQF\·VFDSDELOLWLHVLWVVWDIIDYDLODELOLW\RIWKHUHTXLUHGH[SHUWLVHDQGLWVIXQGLQJ UHVRXUFHV,IWKHORFDODJHQF\GRHVQRWKDYHVXIILFLHQWVWDIIFDSDELOLWLHVLWPD\VROLFLWDVVLVWDQFH IURPDQRWKHUDJHQF\RUXVHDTXDOLILHGSULYDWHFRQVXOWDQWWRSHUIRUPWKHUHTXLUHGZRUN WĂŐĞϰŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 47 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ ,IWKHORFDODJHQF\GHWHUPLQHVWKDWWKHUHLVDQHHGWRVROLFLWDVVLVWDQFHIURPDQRWKHUORFDODJHQF\ RUWRXVHDFRQVXOWDQWWKH'LVWULFW/RFDO$VVLVWDQFH(QJLQHHU '/$( VKRXOGEHQRWLILHGLI IHGHUDODLGIXQGVDUHWREHUHTXHVWHGIRUWKHSURMHFWVHJPHQWWREHFRQWUDFWHGRXW $SSRLQWLQJWKH&RQWUDFW$GPLQLVWUDWRU 7KH&RQWUDFW$GPLQLVWUDWRULVUHVSRQVLEOHIRUHQVXULQJWKHTXDOLW\RIFRQVXOWDQWFRQWUDFW SURGXFWVRUVHUYLFHV7KH&RQWUDFW$GPLQLVWUDWRULVDSSRLQWHGDVVRRQDVWKHQHHGIRU FRQVXOWDQWVHUYLFHVLVLGHQWLILHG7KH&RQWUDFW$GPLQLVWUDWRULVLQYROYHGWKURXJKRXWWKH GHYHORSPHQWRIWKHVHOHFWLRQSURFHVVDQGWKHFRQWUDFWSURYLVLRQVDQGLQWKHDGPLQLVWUDWLRQRI WKHFRQVXOWDQW·VZRUN7KH&RQWUDFW$GPLQLVWUDWRUPXVWEHDTXDOLILHGORFDODJHQF\HPSOR\HH RUKDYHVWDIIWKDWLVTXDOLILHGWRHQVXUHWKHFRQVXOWDQW·VZRUNLVFRPSOHWHDFFXUDWHDQG FRQVLVWHQWZLWKWKHWHUPVDQGFRQGLWLRQVRIWKHFRQVXOWDQWFRQWUDFW2QIHGHUDODLGFRQWUDFWVWKH &RQWUDFW$GPLQLVWUDWRURUVWDIIPHPEHUVPXVWEHDIXOOWLPHHPSOR\HHDQGIDPLOLDUZLWKWKH ZRUNWREHFRQWUDFWHGRXWDQGWKHVWDQGDUGVWREHXVHG7KH&RQWUDFW$GPLQLVWUDWRUPXVWDOVR DELGHE\WKHODZVUHJXODWLRQVDQGSROLFLHVUHTXLUHGDVSDUWRIDFFHSWLQJIHGHUDORUVWDWHIXQGLQJ IRUWKHLUSURMHFW1RQFRPSOLDQFHZLWKWKHODZVUHJXODWLRQVDQGSROLFLHVPD\UHVXOWLQORVVRI SURMHFWIXQGLQJ 7KH&RQWUDFW$GPLQLVWUDWRU·VGXWLHVDUHOLVWHGLQ&)5 G  DQGLQFOXGH x&RQWUDFWQHJRWLDWLRQFRQWUDFWSD\PHQWDQGHYDOXDWLRQRIFRPSOLDQFH SHUIRUPDQFHDQGTXDOLW\RIVHUYLFHVSURYLGHGE\WKHFRQVXOWDQW x%HLQJIDPLOLDUZLWKWKHFRQWUDFWUHTXLUHPHQWVVFRSHRIVHUYLFHVWREH SHUIRUPHGDQGSURGXFWVWREHSURGXFHGE\WKHFRQVXOWDQW x%HLQJIDPLOLDUZLWKWKHTXDOLILFDWLRQVDQGUHVSRQVLELOLWLHVRIWKHFRQVXOWDQW·V VWDIIDQGHYDOXDWLQJDQ\UHTXHVWHGFKDQJHVLQNH\SHUVRQQHO x6FKHGXOLQJDQGDWWHQGLQJSURJUHVVDQGSURMHFWUHYLHZPHHWLQJVFRPPHQVXUDWH ZLWKWKHPDJQLWXGHFRPSOH[LW\DQGW\SHRIZRUNWRHQVXUHWKHZRUNLV SURJUHVVLQJLQDFFRUGDQFHZLWKHVWDEOLVKHGVFRSHRIZRUNDQGVFKHGXOH PLOHVWRQHV x'RFXPHQWLQJFRQWUDFWPRQLWRULQJDFWLYLWLHVDQGPDLQWDLQLQJVXSSRUWLQJ FRQWUDFWUHFRUGVDVVSHFLILHGLQ&)5 x3URYLGHVGLUHFWLRQWRHQVXUHWKHSURSRVHGZRUNLVDGYHUWLVHGSURSHUO\ x3UHSDUHVDQGGLVWULEXWHVWKH5HTXHVWIRU4XDOLILFDWLRQV 5)4 GHVFULSWLRQRI ZRUNDQG5HTXHVWIRU3URSRVDOV 5)3 LIXVHG x3UHSDUHVWKHGUDIWFRQWUDFW x$UUDQJHVIRUSUHSDUDWLRQEHIRUHDQLQGHSHQGHQWHVWLPDWHRIWKHYDOXHRIWKH ZRUNWREHFRQWUDFWHGRXW x(QVXUHVWKDWWKHVHOHFWLRQSURFHGXUHVDUHIROORZHG x$QDO\]HVWKHVHOHFWHGEHVWTXDOLILHGFRQVXOWDQW·VFRVWSURSRVDO x(QVXUHVFRQWUDFWDXGLWDQGUHYLHZSURFHGXUHLVIROORZHG WĂŐĞϱŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 48 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ x(QVXUHVWKDWIHHSURILWQHJRWLDWLRQLVFRQGXFWHGDQGNHHSVUHFRUGV x6HUYHVDVWKHORFDODJHQF\·VSULPDU\FRQWDFWSHUVRQIRUWKHVXFFHVVIXO FRQVXOWDQW x0RQLWRUVWKHFRQVXOWDQW·VSURJUHVVDQGSURYLGHVGLUHFWLRQ x(QVXULQJFRQVXOWDQWFRVWVELOOHGDUHDOORZDEOHLQDFFRUGDQFHZLWKWKH)HGHUDO FRVWSULQFLSOHVDQGFRQVLVWHQWZLWKWKHFRQWUDFWWHUPVDVZHOODVWKH DFFHSWDELOLW\DQGSURJUHVVRIWKHFRQVXOWDQW·VZRUN x,GHQWLILHVRWKHUORFDODJHQF\VWDIIIRUWKHFRQVXOWDQWWRFRQWDFWLIQHHGHG x&ORVHVRXWWKHFRQWUDFWDWFRPSOHWLRQE\SURFHVVLQJWKHILQDOLQYRLFH FRPSOHWLQJDPDQGDWRU\FRQVXOWDQWHYDOXDWLRQDQGILQDO'%(XWLOL]DWLRQ UHSRUWV Exhibit 17-F: Final Report Utilization of Disadvantaged Business Enterprises (DBE) and First-Tier Subcontractors  6HJPHQWLQJ&RQVXOWDQW:RUN &RQVXOWDQWVHUYLFHVDUHPRVWHIIHFWLYHZKHQFRQVXOWDQWZRUNLVVHJPHQWHGDSSURSULDWHO\7KH H[WHQWRIVHJPHQWLQJGHSHQGVXSRQWKHW\SHDQGFRPSOH[LW\RIWKHZRUN&RPELQLQJ SUHOLPLQDU\HQJLQHHULQJWDVNVZLWKWKHSUHSDUDWLRQRIWKHUHTXLUHGHQYLURQPHQWDODQDO\VLVLV QRUPDOO\GHVLUDEOH3UHSDULQJDQ(QYLURQPHQWDO$VVHVVPHQW ($ RU(QYLURQPHQWDO,PSDFW 6WDWHPHQW (,6 LVPRUHWKDQVLPSO\ZULWLQJDUHSRUW$VVHVVPHQWDQGLPSDFWUHSRUWVLQFOXGH SUHOLPLQDU\HQJLQHHULQJQHHGHGWRDQDO\]HSURMHFWDOWHUQDWLYHVDQGSURGXFHDQHQJLQHHULQJDQG SODQQLQJDVVHVVPHQW,QLWLDOSURMHFWVWXGLHVLQFOXGHRQO\DVPXFKWUDIILFDQGHQJLQHHULQJ DQDO\VLVRIDOWHUQDWLYHVDVLVQHHGHGWRSURGXFHDVRXQG($RU(,6 VHHLAPM Chapter 6 Environmental Procedures DQG6WDQGDUG(QYLURQPHQWDO5HIHUHQFH 6(5 &KDSWHUV (QYLURQPHQWDO$VVHVVPHQW ($ DQG)LQGLQJRI1R6LJQLILFDQW,PSDFW )216, DQG&KDSWHU (QYLURQPHQWDO,PSDFW6WDWHPHQW (,6 )LQDOGHVLJQVKDOOQRWEHJLQXQWLO1(3$HQYLURQPHQWDO DSSURYDOKDVEHHQUHFHLYHGLIIHGHUDOUHLPEXUVHPHQWLVGHVLUHG 5HIHUWR)LJXUH6HJPHQWLQJ&RQVXOWDQW:RUNEHORZZKLFKLOOXVWUDWHVVHYHUDOVDWLVIDFWRU\ ZD\VWRVHJPHQWFRQVXOWDQWDFWLYLWLHV WĂŐĞϲŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 49 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ &ŝŐƵƌĞϭϬͲϮ͗^ĞŐŵĞŶƚŝŶŐŽŶƐƵůƚĂŶƚtŽƌŬ 6SHFLI\3URGXFWVWREH'HOLYHUHG 7KH&RQWUDFW$GPLQLVWUDWRULGHQWLILHVWKHSURGXFWVDQGVHUYLFHVWREHGHOLYHUHGDVDUHVXOWRI FRQVXOWDQWFRQWUDFWZRUNDQGPLQLPXPTXDOLILFDWLRQRIFRQVXOWDQWSURIHVVLRQDOVDQGVWDII 7KHVHYDU\GHSHQGLQJXSRQWKHW\SHRISURMHFWVDQGWKHSKDVHRISURMHFWGHYHORSPHQWEHLQJ DGGUHVVHG 6FRSHRI&RQVXOWDQW:RUN 7KHVFRSHRIZRUNZKLFKWKHFRQWUDFWPXVWLQFOXGHLVDGHWDLOHGGHVFULSWLRQRIWKHSURGXFWVRU VHUYLFHVWKHFRQVXOWDQWLVWRSURYLGH)URPDGHWDLOHGVFRSHRIZRUNFRQVXOWDQWVUHVSRQGWRD SURMHFWDGYHUWLVHPHQWGHWHUPLQHSHUVRQQHODQGWLPHUHTXLUHPHQWVDQGGHYHORSDWHFKQLFDO SURSRVDO7KHUHIRUHWKHVFRSHRIZRUNPXVWEHFOHDUFRQFLVHFRPSOHWHDQGGHVFULEHWKH GHOLYHUDEOHVVWDQGDUGVIRUGHVLJQDQGRWKHUZRUNTXDOLW\FRQWUROPHDVXUHVDFFHSWDQFHFULWHULD DQGGHDGOLQHV 1RQ'LVFULPLQDWLRQ&ODXVH 7KH1RQ'LVFULPLQDWLRQ&ODXVH Exhibit 10-R: A&E Boilerplate Agreement LanguagH$UWLFOH;9, 6WDWHPHQWRI&RPSOLDQFH PXVWEHLQFOXGHGLQHDFKFRQVXOWDQWFRQWUDFW7KHFRQVXOWDQWPXVW LQFOXGHWKHQRQGLVFULPLQDWLRQDQGFRPSOLDQFHSURYLVLRQVRIWKH1RQ'LVFULPLQDWLRQ&ODXVHLQ DOOVXEFRQWUDFWVWRSHUIRUPZRUNXQGHUWKHFRQWUDFW 'LVDGYDQWDJHG%XVLQHVV(QWHUSULVH '%( 3DUWLFLSDWLRQ :KHQDGPLQLVWHULQJIHGHUDODLGSURMHFWVIHGHUDOUHJXODWLRQV &)53DUW UHTXLUHDORFDO DJHQF\WRFRPSO\ZLWKWKH'%(SURJUDPDQGWDNHQHFHVVDU\VWHSVWRHQVXUHWKDW'%(ILUPV KDYHWKHRSSRUWXQLW\WRSDUWLFLSDWHLQWKHSURMHFWV5HIHUWRChapter 9: Civil Rights and Disadvantaged Business Enterprises IRU'%(UHTXLUHPHQWVIRU$ (&RQVXOWDQW&RQWUDFWV WĂŐĞϳŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 50 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ (VWLPDWHG&RVWRI&RQVXOWDQW:RUN $QLQGHSHQGHQWHVWLPDWHIRUFRVWRUSULFHDQDO\VLVLVQHHGHGIRUDOOFRQVXOWDQWFRQWUDFWV &)5  D  Y % WRHQVXUHWKDWFRQVXOWDQWVHUYLFHVDUHREWDLQHGDWDIDLUDQGUHDVRQDEOHSULFH 7KHHVWLPDWHLVSUHSDUHGLQDGYDQFHRIUHTXHVWLQJDFRVWSURSRVDOIURPWKHWRSUDQNHG FRQVXOWDQWVRWKHORFDODJHQF\·VQHJRWLDWLQJWHDPKDVDFRVWFRPSDULVRQRIWKHSURMHFWWR HYDOXDWHWKHUHDVRQDEOHQHVVRIWKHFRQVXOWDQW·VFRVWSURSRVDO7KHHVWLPDWHZKLFKLVVSHFLILFDOO\ IRUWKHXVHRIWKHORFDODJHQF\·VQHJRWLDWLQJWHDPLVWREHNHSWFRQILGHQWLDODQGPDLQWDLQHGIRU UHFRUGV $JRRGFRVWHVWLPDWHFDQEHSUHSDUHGRQO\LIWKHVFRSHRIZRUNLVGHILQHGFOHDUO\7KHVFRSHRI ZRUNPXVWLQFOXGHDOLVWRIWKHSURGXFWVRUVHUYLFHVZKLFKWKHFRQVXOWDQWLVUHTXLUHGWRGHOLYHU DQGDWLPHVFKHGXOHRIZKHQWKH\PXVWEHGHOLYHUHG ,WVKRXOGEHVWUHVVHGWKDWDOOZRUNWREHGHULYHGIURPWKHFRQVXOWDQWVHUYLFHVVXFKDV SUHOLPLQDU\GHVLJQHQYLURQPHQWDORUILQDOGHVLJQPXVWEHFOHDUO\LGHQWLILHGLQWKHVROLFLWDWLRQ RIFRQVXOWDQWVHUYLFHV 5)4RU5)3 DQGLQFOXGHGLQWKHFRVWHVWLPDWH7KHDGGLWLRQRIZRUNWR WKHRULJLQDOVFRSHE\DPHQGPHQWVKRXOGEHDYRLGHGZKHQHYHUSRVVLEOH&RQWUDFWPRGLILFDWLRQV DUHUHTXLUHGIRUDQ\DPHQGPHQWVWRWKHWHUPVRIWKHH[LVWLQJFRQWUDFWWKDWFKDQJHWKHFRVWRIWKH FRQWUDFWVLJQLILFDQWO\FKDQJHWKHFKDUDFWHUVFRSHFRPSOH[LW\RUGXUDWLRQRIWKHZRUNRU VLJQLILFDQWO\FKDQJHWKHFRQGLWLRQVXQGHUZKLFKWKHZRUNLVUHTXLUHGWREHSHUIRUPHG 6RPHRIWKHFRVWVHVWLPDWLQJWHFKQLTXHVDUH Analogous Estimating: $QDORJRXVFRVWHVWLPDWLQJLVXVLQJWKHDFWXDOFRVWRIDSUHYLRXVVLPLODUFRQWUDFWDVWKHEDVLVIRU HVWLPDWLQJWKHFRVWRIWKHFXUUHQWFRQWUDFW$QDORJRXVFRVWHVWLPDWLQJLVIUHTXHQWO\XVHGWR HVWLPDWHFRVWVZKHQWKHUHLVDOLPLWHGDPRXQWRIGHWDLOHGLQIRUPDWLRQDERXWWKHSURMHFW $QDORJRXVFRVWHVWLPDWLQJLVJHQHUDOO\OHVVDFFXUDWHDQGLWLVPRVWUHOLDEOHZKHQSUHYLRXV SURMHFWVDUHVLPLODULQIDFWDQGQRWMXVWLQDSSHDUDQFHDQGLWXVHVH[SHUWMXGJPHQW Parametric Estimating: 3DUDPHWULFHVWLPDWLQJLVDWHFKQLTXHWKDWXVHVVWDWLVWLFDOUHODWLRQVKLSEHWZHHQKLVWRULFDOGDWD DQGRWKHUYDULDEOHVWRFDOFXODWHDFRVWHVWLPDWHIRUDQDFWLYLW\UHVRXUFH7KLVWHFKQLTXHFDQ SURGXFHDKLJKHUOHYHORIDFFXUDF\GHSHQGLQJXSRQWKHVRSKLVWLFDWLRQDVZHOODVXQGHUO\LQJ UHVRXUFHTXDQWLW\DQGWKHFRVWGDWD$FRVWH[DPSOHZRXOGLQYROYHPXOWLSO\LQJWKHSODQQHG TXDQWLW\RIZRUNE\WKHKLVWRULFDOFRVWSHUXQLWWRREWDLQWKHHVWLPDWHGFRVWRIWKHFRQWUDFW Bottom-up Estimating: 7KLVWHFKQLTXHLQYROYHVHVWLPDWLQJWKHFRVWIRULQGLYLGXDOZRUNLQWKHFRQWUDFWZLWKWKHORZHVW OHYHORIGHWDLO7KLVGHWDLOHGFRVWLVWKHQVXPPDUL]HGRUUROOHGXSWRGHWHUPLQHDWRWDOFRVWRI FRQWUDFW&RVWGHWDLOVKRXOGLQFOXGHHVWLPDWHGKRXUVSHUWDVNODERUKRXUO\FRVWIRUSURIHVVLRQDO DQGQRQSURIHVVLRQDOFODVVLILFDWLRQVVXEFRQVXOWDQWFRVWVRWKHUSURMHFWGLUHFWFRVWVDQGSURILW /DERUFRVWVVKRXOGEHEURNHQGRZQWRGLUHFWODERUDQGLQGLUHFWFRVWUDWHVLISRVVLEOH ,IPRUHWKDQRQHSURMHFWRUSKDVHRIZRUNLVWREHGHYHORSHGZLWKLQWKHFRQVXOWDQWFRQWUDFW VHSDUDWHFRVWHVWLPDWHVDUHUHTXLUHGIRUHDFKSURMHFWRUSKDVHRIZRUN6HSDUDWHFRVWHVWLPDWHV DUHUHTXLUHGIRUHDFKPLOHVWRQHDQGSRUWLRQRIWKHZRUNH[SHFWHGWREHVXEFRQWUDFWHG WĂŐĞϴŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 51 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ )RURQFDOO DVQHHGHG FRQWUDFWVWKHFRVWHVWLPDWHDQDO\VLVVKRXOGLQFOXGHDWPLQLPXPD KLVWRULFDODQDO\VLVRIDQQXDOQHHGVIRUFRQVXOWDQWZRUNSURIHVVLRQDOODERUFRVWDQGPDUNHW DQDO\VLVDQGUHDVRQDEOHSURILWDQDO\VLV 'HWHUPLQH7\SHRI&RQWUDFW 7\SHVRIFRQWUDFWVWREHXVHGDUHGHVFULEHGDVIROORZV x3URMHFWVSHFLILFFRQWUDFWLVEHWZHHQWKHORFDODJHQF\DQGFRQVXOWDQWIRUWKHSHUIRUPDQFH RIVHUYLFHVDQGDGHILQHGVFRSHRIZRUNUHODWHGWRDVSHFLILFSURMHFWRUSURMHFWV x0XOWLSKDVHFRQWUDFWLVDSURMHFWVSHFLILFFRQWUDFWZKHUHWKHGHILQHGVFRSHRIZRUNLV GLYLGHGLQWRSKDVHVZKLFKPD\EHQHJRWLDWHGDQGH[HFXWHGLQGLYLGXDOO\DVWKHSURMHFW SURJUHVVHV x2QFDOOFRQWUDFWLVDFRQWUDFWWKDWPD\EHXWLOL]HGIRUDQXPEHURISURMHFWVXQGHUZKLFK WDVNRUZRUNRUGHUVDUHLVVXHGRQDQDVQHHGHGEDVLVIRUDQHVWDEOLVKHGFRQWUDFWSHULRG 2QFDOOFRQWUDFWVDUHW\SLFDOO\XVHGZKHQDVSHFLDOL]HGVHUYLFHRILQGHILQLWHGHOLYHU\RU LQGHILQLWHTXDQWLW\LVQHHGHGIRUDQXPEHURIGLIIHUHQWSURMHFWVVXFKDVFRQVWUXFWLRQ HQJLQHHULQJGHVLJQHQYLURQPHQWDODQDO\VLVWUDIILFVWXGLHVJHRWHFKQLFDOVWXGLHVDQG ILHOGVXUYH\LQJHWF0DQ\DJHQFLHVXVHWKHVHFRQWUDFWVWRDGGUHVVSHDNVLQZRUNORDGRI LQ KRXVHHQJLQHHULQJVWDIIDQGRUWRSHUIRUPDVSHFLDOL]HGVHUYLFHZKLFKWKHDJHQF\ GRHVQRWKDYH2QFDOOFRQWUDFWVVKDOOVSHFLI\DUHDVRQDEOHPD[LPXPOHQJWKRIFRQWUDFW QRWWRH[FHHG\HDUVDQGDPD[LPXPWRWDOFRQWUDFWGROODUDPRXQW &)5 7KH PD[LPXPGROODUDPRXQWIRUDOOFRQWUDFWVDZDUGHGXQGHUWKHVROLFLWDWLRQLVVWDWHGLQWKH VROLFLWDWLRQ7KHPD[LPXPGROODUDPRXQWLVWKHDJJUHJDWHRIWKHRQFDOOFRQWUDFWV DQWLFLSDWHGWREHDZDUGHG,IWKHVROLFLWDWLRQOLVWVWKDWXSWRFRQWUDFWVPD\EHDZDUGHG WKHDJJUHJDWHDPRXQWRIWKHVHFRQWUDFWVLVWKHPD[LPXPFRQWUDFWGROODUDPRXQW+RZ PDQ\FRQWUDFWVDUHDQWLFLSDWHGWREHDZDUGHGPXVWEHVWDWHGLQWKHVROLFLWDWLRQ+RZ WDVNRUGHUVZLOOEHLVVXHGPXVWEHVWDWHGLQWKHVROLFLWDWLRQ WZRRSWLRQVH[LVW JHRJUDSKLFDOO\GHVLJQDWHGDUHDVRUDGGLWLRQDOFRPSHWLWLYHVROLFLWDWLRQWRDOOFRQVXOWDQWV ZKRSURYLGHWKHVDPHW\SHRIVHUYLFHDQGDZDUGHGDFRQWUDFWXQGHUWKHVDPH VROLFLWDWLRQ  o7RPDLQWDLQWKHLQWHQWRIWKH%URRNV$FW 86& LQSURPRWLQJRSHQ FRPSHWLWLRQDQGVHOHFWLRQEDVHGRQGHPRQVWUDWHGFRPSHWHQFHDQGTXDOLILFDWLRQVRQ FDOOFRQVXOWDQWFRQWUDFWVHVWDEOLVKHGWKURXJKWKH5)4SURFHVVPXVWPHHWWKH IROORZLQJUHTXLUHPHQWV ƒ0XVWGHILQHDJHQHUDOVFRSHRIZRUNFRPSOH[LW\DQGSURIHVVLRQDOQDWXUHRI VHUYLFHV ƒ6SHFLI\DWDVNRUGHUSURFHGXUHWKHORFDODJHQF\XVHVWRSURFXUHSURMHFW VSHFLILFZRUNXQGHUWKHFRQWUDFW ƒ1RWDVNRUGHULVYDOLGXQOHVVWKHRQFDOOFRQWUDFWLVVWLOOHQIRUFHG)RU H[DPSOHLIWKHRQFDOOFRQWUDFWLVH[SLUHGDOOWDVNRUGHUVLVVXHGDIWHUWKH FRQWUDFWH[SLUDWLRQGDWHZLOOEHFRPHLQYDOLG WĂŐĞϵŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 52 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ ƒ,IPXOWLSOHFRQVXOWDQWVDUHWREHVHOHFWHGDQGPXOWLSOHRQFDOOFRQWUDFWV DZDUGHGWKURXJKDVLQJOHVROLFLWDWLRQIRUVSHFLILFVHUYLFHVWKHQXPEHURI FRQVXOWDQWVWKDWPD\EHVHOHFWHGRUFRQWUDFWVWKDWPD\EHDZDUGHGPXVWEH LGHQWLILHG o6SHFLI\SURFXUHPHQWSURFHGXUHVLQWKHFRQWUDFWVWKHORFDODJHQF\ZLOOXVHWR DZDUGH[HFXWHWDVNRUGHUVDPRQJWKHFRQVXOWDQWV ƒ(LWKHUWKURXJKDQDGGLWLRQDOTXDOLILFDWLRQEDVHGVHOHFWLRQSURFHVV VHHWKH 7ZR6WHS5)45)4SURFHVVODWHULQWKLVFKDSWHU 25 ƒ2QUHJLRQDOEDVLVZKHUHE\WKHUHJLRQLVGLYLGHGLQWRDUHDVLGHQWLILHGLQWKH VROLFLWDWLRQDQGFRQVXOWDQWVDUHVHOHFWHGWRSURYLGHRQFDOOVHUYLFHVIRU DVVLJQHGDUHDVRQO\7KH5)3PD\OLVWPXOWLSOHUHJLRQVWKDWDOORZFRQVXOWDQWV WRFURVVRYHURUEHD´EDFNXSµWRRWKHUFRQVXOWDQWVWKDWIRUVSHFLILFDOO\ GRFXPHQWHGUHDVRQVDUHQRWDEOHWRSHUIRUPWKHZRUNLQWKHLUDVVLJQHG UHJLRQ3HU&)5 D  %  7KH´EDFNXSµRSWLRQQHHGVWREHOLVWHG LQWKHUHVSHFWLYHFRQWUDFWV xAn example of acceptable contract wording in multiple on-call contracts for the same type of service: ƒ“Agency has or will enter into three (3) task order contracts for performance of the Scope of Services identified in Exhibit “A”, including this Agreement (“CM Services Task Order Contracts”). The other CM Services Task Order Contracts are [identify other two contracts by agreement numbers and consultant firms]. The total amount payable by Agency for the CM Services Task Order Contracts shall not exceed a cumulative maximum total value of Seven Million, Five Hundred Thousand Dollars ($7,500,000) (“NTE Sum”). It is understood and agreed that there is no guarantee, either expressed or implied that this dollar amount will be authorized under the CM Services Task Order Contracts through Task Orders. Each time a Task Order is awarded under any of the CM Services Task Order Contracts, the Agency shall send written notification to Consultant and each of the other consultants entering into the CM Services Task Order Contracts. The notice shall identify the total funds allocated under issued Task Orders, and the remaining unencumbered amount of the NTE Sum. Consultant acknowledges and agrees that Agency shall not pay any amount under this Agreement that would exceed the NTE Sum, and Consultant shall not enter into a Task Order that exceeds the NTE Sum.” 'HWHUPLQLQJWKH3URMHFW6FKHGXOH 7KHORFDODJHQF\GHYHORSVDVFKHGXOHIRUSHUIRUPDQFHRIZRUNDQGFRPSOHWLRQRIWKHSURMHFW 7KHVFKHGXOHPXVWLQFOXGHVXIILFLHQWWLPHWRDOORZIRU x6HOHFWLQJWKHFRQVXOWDQW x'HYHORSLQJWKHFRQVXOWDQWFRQWUDFW x&RPSOHWLQJWKH$ (FRQVXOWDQWFRQWUDFWDXGLWSURFHVV x&RQGXFWLQJPHHWLQJVDQGSURMHFWUHYLHZV WĂŐĞϭϬŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 53 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 'HWHUPLQH0HWKRGRI3D\PHQW 7KHPHWKRGRISD\PHQWRIFRQWUDFWPXVWEHVSHFLILHG)RXUPHWKRGVDUHSHUPLWWHGGHSHQGLQJ RQWKHVFRSHRIVHUYLFHVWREHSHUIRUPHGUHIHUHQFH&)5 E  x$FWXDO&RVW3OXV)L[HG)HH VHHExhibit 10-H: Sample Cost Proposal, ([DPSOH  x&RVW3HU8QLWRI:RUN VHHExhibit 10-H, ([DPSOH  x6SHFLILF5DWHVRI&RPSHQVDWLRQ VHHExhibit 10-H, ([DPSOH  x/XPS6XP VHHExhibit 10-H, ([DPSOH  7KHPHWKRGRISD\PHQWWRWKHFRQVXOWDQWVKDOOEHVHWIRUWKLQWKHRULJLQDOVROLFLWDWLRQFRQWUDFW DQGLQDQ\FRQWUDFWPRGLILFDWLRQWKHUHWR$VLQJOHFRQWUDFWPD\FRQWDLQGLIIHUHQWSD\PHQW PHWKRGVDVDSSURSULDWHIRUFRPSHQVDWLRQRIGLIIHUHQWHOHPHQWVRIZRUN 7KHFRVWSOXVDSHUFHQWDJHRIFRVWDQGSHUFHQWDJHRIFRQVWUXFWLRQFRVWPHWKRGVRISD\PHQWVKDOO QRWEHXVHG%RWKRIWKHVHPHWKRGVDUHH[SOLFLWO\SURKLELWHGE\)HGHUDO5HJXODWLRQV $FWXDO&RVW3OXV)L[HG)HH 7KHFRQVXOWDQWLVUHLPEXUVHGIRUDFWXDOFRVWVLQFXUUHGDQGUHFHLYHVDQDGGLWLRQDOSUHGHWHUPLQHG DPRXQWDVDIL[HGIHH SURILW )HGHUDOUHJXODWLRQVUHTXLUHWKDWSURILWEHVHSDUDWHO\QHJRWLDWHG IURPFRQWUDFWFRVWV7KHGHWHUPLQDWLRQRIWKHDPRXQWRIWKHIL[HGIHHVKDOOWDNHLQWRDFFRXQWWKH VL]HFRPSOH[LW\GXUDWLRQDQGGHJUHHRIULVNLQYROYHGLQWKHZRUN7KHIL[HGIHHLVQRW DGMXVWDEOHGXULQJWKHOLIHRIWKHFRQWUDFW7KHIL[HGIHHGROODUDPRXQWPXVWEHFOHDUO\VWDWHGLQ WKHFRQWUDFW 7KLVPHWKRGRISD\PHQWLVDSSURSULDWHZKHQWKHH[WHQWVFRSHFRPSOH[LW\FKDUDFWHURU GXUDWLRQRIZRUNFDQQRWEHSUHFLVHO\SUHGLFWHG7KHIL[HGIHHOLPLWDSSOLHVWRWKHWRWDOGLUHFWDQG LQGLUHFWFRVWV)L[HGIHHVLQH[FHVVRISHUFHQWRIWKHWRWDOGLUHFWODERUDQGLQGLUHFWFRVWVRIWKH FRQWUDFWPD\EHMXVWLILHGRQO\ZKHQH[FHSWLRQDOFLUFXPVWDQFHVH[LVW7KHFRQWUDFWVKDOOVSHFLI\D UHDVRQDEOHPD[LPXPOHQJWKRIFRQWUDFWSHULRGDQGDPD[LPXPWRWDOFRQWUDFWGROODUDPRXQW VHHExhibit 10-H: Sample Cost Proposal Example #1 DQGExhibit 10-R: A&E Sample Contract Language$UWLFOH9Option 1 LQWKLVFKDSWHU 7KHFRQWUDFWFRVWSURSRVDOPXVWLGHQWLI\DOONH\ HPSOR\HHVDQGRUFODVVLILFDWLRQVWREHELOOHG1HZNH\HPSOR\HHVDQGRUFODVVLILFDWLRQVPXVW EHDSSURYHGEHIRUHWKH\LQFXUZRUNRQWKHFRQWUDFWRUWKHFRVWVFDQEHTXHVWLRQHGRU GLVDOORZHG &RVW3HU8QLWRI:RUN 7KHFRQVXOWDQWLVSDLGEDVHGRQVSHFLILFLWHPRIZRUNSHUIRUPHG7KHLWHPRIZRUNPXVWEH VLPLODUUHSHWLWLRXVDQGPHDVXUDEOHVXFKDVJHRWHFKQLFDOLQYHVWLJDWLRQDQGPDWHULDOWHVWLQJ 7KLVPHWKRGRISD\PHQWLVDSSURSULDWHZKHQWKHFRVWSHUXQLWRIZRUNFDQEHGHWHUPLQHGZLWK UHDVRQDEOHDFFXUDF\LQDGYDQFHEXWWKHH[WHQWRUTXDQWLW\RIWKHZRUNLVLQGHILQLWH&RQWUDFW SD\PHQWSURYLVLRQVPXVWVSHFLI\ZKDWLVLQFOXGHGLQWKHSULFHWREHSDLGIRUHDFKLWHP$Q\ LWHPRIZRUNQRWLGHQWLILHGLQWKHFRQWUDFWFRVWSURSRVDOLVQRWHOLJLEOHIRUUHLPEXUVHPHQW1HZ LWHPVRIZRUN WKRVHZLWKLQWKHRULJLQDOVFRSHRIZRUNRQO\ PXVWEHDPHQGHGLQWRWKHFRQWUDFW EHIRUHZRUNLVSHUIRUPHG7KHFRQWUDFWVKDOODOVRVSHFLI\DUHDVRQDEOHPD[LPXPOHQJWKRI WĂŐĞϭϭŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 54 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ FRQWUDFWSHULRGDQGDPD[LPXPWRWDOFRQWUDFWGROODUDPRXQW VHHExhibit 10-H, ([DPSOHDQG Exhibit 10-R, $UWLFOH9Option 2  6SHFLILHG5DWHVRI&RPSHQVDWLRQ 7KHFRQVXOWDQWLVSDLGDWDQDJUHHGDQGVXSSRUWHGVSHFLILFIL[HGKRXUO\GDLO\ZHHNO\RU PRQWKO\UDWHIRUHDFKFODVVRIHPSOR\HHHQJDJHGGLUHFWO\LQWKHZRUN6XFKUDWHVRISD\LQFOXGH WKHFRQVXOWDQW·VHVWLPDWHGFRVWVDQGQHWIHH SURILW )HGHUDOUHJXODWLRQVUHTXLUHWKDWSURILWEH VHSDUDWHO\QHJRWLDWHGIURPFRQWUDFWFRVWV7KHVSHFLILFUDWHVRIFRPSHQVDWLRQH[FHSWIRUDQ LQGLYLGXDODFWLQJDVDVROHSURSULHWRUDUHWRLQFOXGHDQKRXUO\EUHDNGRZQGLUHFWVDODU\FRVWV IULQJHEHQHILWVLQGLUHFWFRVWVDQGQHWIHH2WKHUGLUHFWFRVWVPD\EHLQFOXGHGVXFKDVWUDYHODQG HTXLSPHQWUHQWDOVLIQRWDOUHDG\FDSWXUHGLQWKHLQGLUHFWFRVWUDWH 7KLVPHWKRGRISD\PHQWVKRXOGRQO\EHXVHGZKHQLWLVQRWSRVVLEOHDWWKHWLPHRISURFXUHPHQW WRHVWLPDWHWKHH[WHQWRUWKHGXUDWLRQRIWKHZRUNRUWRHVWLPDWHFRVWVZLWKDQ\UHDVRQDEOH GHJUHHRIDFFXUDF\7KLVPHWKRGVKRXOGQRWEHXVHGIRUSURMHFWVSHFLILFFRQWUDFWVDQGLV UHFRPPHQGHGIRURQFDOOFRQWUDFWVIRUVSHFLDOL]HGRUVXSSRUWW\SHVHUYLFHVVXFKDVFRQVWUXFWLRQ HQJLQHHULQJDQGLQVSHFWLRQZKHUHWKHFRQVXOWDQWLVQRWLQGLUHFWFRQWURORIWKHQXPEHURIKRXUV ZRUNHGDQGLWDOVRUHTXLUHVPDQDJHPHQWDQGPRQLWRULQJRIWKHFRQVXOWDQW·VOHYHORIHIIRUWDQG WKHFODVVLILFDWLRQRIHPSOR\HHVXVHGWRSHUIRUPWKHFRQWUDFWHGZRUN7KHFRQWUDFWVKDOODOVR VSHFLI\DUHDVRQDEOHPD[LPXPOHQJWKRIFRQWUDFWSHULRGDQGDPD[LPXPWRWDOFRQWUDFWGROODU DPRXQW VHHExhibit 10-H , ([DPSOHDQGExhibit 10-R, $UWLFOH9Option 3  /XPS6XPRU)LUP)L[HG3ULFH 7KHFRQVXOWDQWSHUIRUPVWKHVHUYLFHVVWDWHGLQWKHFRQWUDFWIRUDQDJUHHGDPRXQWDV FRPSHQVDWLRQLQFOXGLQJDQHWIHHRUSURILW7KLVPHWKRGRISD\PHQWLVDSSURSULDWHRQO\LIWKH H[WHQWVFRSHFRPSOH[LW\FKDUDFWHUGXUDWLRQDQGULVNRIWKHZRUNKDYHEHHQVXIILFLHQWO\ GHILQHGWRSHUPLWIDLUFRPSHQVDWLRQWREHGHWHUPLQHGDQGHYDOXDWHGE\DOOSDUWLHVGXULQJ QHJRWLDWLRQV VHHExhibit 10-H: Sample Cost Proposal, Example #1 DQGExhibit 10-R: A&E Sample Contract Language, $UWLFOH9Option 4 1RUPDOO\DOXPSVXPFRQWUDFWZLOOEHSDLGLQIXOODWHQG RIWKHFRQWUDFWZKHQFRPSOHWHG+RZHYHUDOXPSVXPFRQWUDFWFDQEHQHJRWLDWHGZLWK SURJUHVVSD\PHQWLIIHDVLEOH7KHSURJUHVVSD\PHQWVKDOOEHEDVHGRQSHUFHQWRIZRUNFRPSOHWH RUFRPSOHWLRQRIFOHDUO\GHILQHGPLOHVWRQHV7KHFRQWUDFWFRVWSURSRVDOVKDOOGRFXPHQWWKH DJUHHGXSRQSURJUHVVSD\PHQWDQGLQFOXGHWKHQHFHVVDU\PLOHVWRQHVFRVWVRUWKHSHUFHQWZRUN FRPSOHWHVFKHGXOH &KDQJHVWR([KLELW+UHTXLULQJUHVXEPLWWDOWR,QGHSHQGHQW2IILFHRI$XGLWVDQG ,QYHVWLJDWLRQVIRUUHYLHZ x&RQVXOWDQWQDPHFKDQJH x1HZSDUWLFLSDWLQJVXEFRQVXOWDQW x&KDQJHLQ,&5UDWH $ (&2168/7$17$8',7$1'5(9,(:352&(66 7KLVVHFWLRQRXWOLQHVWKHDXGLWDQGUHYLHZSURFHVVIRU$ (FRQWUDFWVWKDWDWDQ\WLPH XVHVWDWHRUIHGHUDOIXQGV$OOSURSRVHG$ (FRQWUDFWVDQGVXSSRUWLQJGRFXPHQWVDUH WĂŐĞϭϮŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 55 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ VXEMHFWWRDXGLWRUUHYLHZE\&DOWUDQV·,QGHSHQGHQW2IILFHRI,QGHSHQGHQW2IILFHRI $XGLWVDQG,QYHVWLJDWLRQV ,2$, RWKHUVWDWHDXGLWRUJDQL]DWLRQVRUWKHIHGHUDO JRYHUQPHQW1RWDOOSURSRVHGFRQWUDFWVZLOOEHDXGLWHGRUUHYLHZHGUDWKHUWKH\ZLOO EHVHOHFWHGRQDULVNEDVHG DSSURDFK $SSOLFDEOH6WDQGDUGV 6WDWHDQGIHGHUDOUHTXLUHPHQWVOLVWHGEHORZDQGVSHFLILFFRQWUDFWUHTXLUHPHQWVVHUYH DVWKH VWDQGDUGVIRUDXGLWVDQGUHYLHZVSHUIRUPHG /RFDODJHQFLHVFRQVXOWDQWV DQGVXEFRQVXOWDQWVDUHUHVSRQVLEOHIRUFRPSO\LQJZLWKVWDWH IHGHUDODQGVSHFLILFFRQWUDFWUHTXLUHPHQWV/RFDODJHQFLHVDUHUHVSRQVLEOHIRUGHWHUPLQLQJ WKHHOLJLELOLW\ RIFRVWVWREHUHLPEXUVHGWRFRQVXOWDQWV $SSOLFDEOHVWDQGDUGVLQFOXGHEXWDUHQRW OLPLWHGWR x&DOWUDQV/RFDO$VVLVWDQFH3URFHGXUHV0DQXDO /$30  x6WDWHDQG)HGHUDODJUHHPHQWVEHWZHHQORFDODJHQFLHVDQG&DOWUDQV LH 0DVWHU $JUHHPHQWV  x3URMHFW3URJUDP6XSSOHPHQWDO$JUHHPHQWV x8QLWHG6WDWHV&RGH 86& 6HFWLRQ²/HWWLQJRI&RQWUDFWV x86&&KDSWHUWKH%URRNV$FW x&)5&KDSWHU3DUW3URFXUHPHQW0DQDJHPHQWDQG$GPLQLVWUDWLRQRI (QJLQHHULQJDQG'HVLJQ5HODWHG6HUYLFHV x&)5&KDSWHU )HGHUDO+LJKZD\$GPLQLVWUDWLRQ'HSDUWPHQWRI 7UDQVSRUWDWLRQ x&)5)HGHUDO$FTXLVLWLRQ5HJXODWLRQ )$5 &KDSWHU3DUW &RQWUDFW &RVW3ULQFLSOHVDQG3URFHGXUHV x&)5&KDSWHU²&RVW$FFRXQWLQJ6WDQGDUGV &$6 6XESDUW x&)53DUW²8QLIRUP$GPLQLVWUDWLYH5HTXLUHPHQWV&RVW3ULQFLSOHVDQG $XGLW5HTXLUHPHQWVIRU)HGHUDO$ZDUGV x8QLWHG6WDWHV*RYHUQPHQW$FFRXQWDELOLW\2IILFH*RYHUQPHQW$XGLWLQJ 6WDQGDUGV  *HQHUDOO\$FFHSWHG*RYHUQPHQW$XGLWLQJ6WDQGDUGV *$*$6  x&DOLIRUQLD*RYHUQPHQW&RGHVHFWLRQVDQG x3URSRVHGFRQWUDFWWHUPVDQGFRQGLWLRQV 6HHVHFWLRQ´ReferencesµRIWKLV&KDSWHUIRUOLQNVWRDERYHUHIHUHQFHGVWDQGDUGV $XGLW*XLGDQFH$YDLODEOH 7KH$PHULFDQ$VVRFLDWLRQRI6WDWH+LJKZD\DQG7UDQVSRUWDWLRQ2IILFLDOV8QLIRUP$XGLW  $FFRXQWLQJ *XLGH $$6+72$XGLW*XLGH ZKLFKLVUHIHUUHGWRIUHTXHQWO\LQWKLVVHFWLRQLV DYDOXDEOHWRROWRJXLGHORFDODJHQFLHVFRQVXOWDQWVDQG&HUWLILHG3XEOLF$FFRXQWDQWV &3$  WKURXJKWKHUHTXLUHPHQWVIRUHVWDEOLVKLQJDQGDXGLWVRI)$5FRPSOLDQW ,QGLUHFW&RVW5DWHV WĂŐĞϭϯŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 56 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ ,&5 7KH$$6+72$XGLW*XLGHLVXVHGH[WHQVLYHO\DVDQLQGXVWU\ JXLGHLQWKHDXGLWDQG UHYLHZSURFHVV /RFDODJHQFLHVPD\VHHNDFFRXQWLQJDVVLVWDQFHIURPLQWHUQDODXGLWVWDIIDQGDQLQGHSHQGHQW &3$IRUFRPSOLDQFH7KHFRQVXOWDQWPD\VHHNSURIHVVLRQDOJXLGDQFHLQVHOHFWLQJLWV LQGHSHQGHQW&3$6HHDOVRWKH$$6+72$XGLW*XLGH&K&Selection of CPA Firm as Overhead Auditor IRUJXLGDQFHLQWKHVHOHFWLRQSURFHVV7UDLQLQJLVDOVRRIIHUHGE\)+:$·V 1DWLRQDO+LJKZD\,QVWLWXWH VHHKWWSZZZQKLIKZDGRWJRYGHIDXOWDVS[ &RXUVHV RIIHUHG LQFOXGH x8VLQJWKH$$6+72$XGLW*XLGHIRUWKH3URFXUHPHQWDQG$GPLQLVWUDWLRQRI$ ( &RQWUDFWV )+:$1+,  x8VLQJWKH$$6+72$XGLW*XLGHIRUWKH'HYHORSPHQWRI$ (&RQVXOWDQW,QGLUHFW &RVW5DWHV )+:$ 1+,  x8VLQJWKH$$6+72$XGLW*XLGHIRUWKH$XGLWLQJDQG2YHUVLJKWRI$ (&RQVXOWDQW ,QGLUHFW&RVW5DWHV )+:$1+,  ,IFRQVXOWDQWVGHVLUHWUDLQLQJRQKRZWREXLOGDQ,&5DQGEDVLFWLPHNHHSLQJWKHUHDUH ,QGLUHFW&RVW5DWHDQG7LPHNHHSLQJZHELQDUVFUHDWHGE\WKH:DVKLQJWRQ6WDWH'HSDUWPHQW RI7UDQVSRUWDWLRQ7KHOLQNWRWKHZHELQDUVLVDYDLODEOHDWKWWSZZZGRWFDJRYDXGLWV FOLFNRQ$UFKLWHFWXUDO (QJLQHHULQJ&RQWUDFWV*HQHUDO$ (&RQWUDFW5HVRXUFHV2WKHU 6WDWH'277UDLQLQJ0RGXOH )RUWUDLQLQJDQGDGGLWLRQDOLQIRUPDWLRQSURYLGHGE\&DOWUDQV /RFDO$VVLVWDQFHYLVLW&DOWUDQV/RFDO$VVLVWDQFH%ORJDW KWWSZZZORFDODVVLVWDQFHEORJFRP)RU)+:$·V4 $IRU,&5VDQGDXGLWVDQG$ ( UHODWHGVHUYLFHVYLVLW)+:$DWKWWSZZZIKZDGRWJRYSURJUDPDGPLQTDFIP $OORZDEOH&RVWV 86& E  % VWDWHVWKDWDQ\$ (FRQWUDFWRUVXEFRQWUDFWDZDUGHGZKHWKHU IXQGHG LQZKROHRULQSDUWZLWK)HGHUDODLGKLJKZD\IXQGVLQIXUWKHUDQFHRIKLJKZD\FRQVWUXFWLRQ SURMHFWVVKDOOEHSHUIRUPHGDQGDXGLWHGLQFRPSOLDQFHZLWKWKH)HGHUDOFRVWSULQFLSOHV /RFDODJHQFLHVDUHUHTXLUHGWRSHUIRUPDFRVWDQDO\VLVWRHQVXUHDOOFRVWVDUHDOORZDEOHDQG LQFRPSOLDQFHZLWKIHGHUDODQGVWDWHUHTXLUHPHQWVDQGUHWDLQGRFXPHQWDWLRQRIQHJRWLDWLRQ DFWLYLWLHVDQGUHVRXUFHV+RXUO\UDWH V IRUHDFKNH\SHUVRQQHODQGRUFODVVLILFDWLRQRI HPSOR\HH V SURSRVHGLQFRVWSURSRVDOVPXVWEHUHDVRQDEOHIRUWKHZRUNSHUIRUPHGDQG DFWXDODOORZDEOHDQGDOORFDEOHLQDFFRUGDQFHZLWKWKH)HGHUDOFRVWSULQFLSOHV&RVWVVKDOOEH DOORZDEOHRQO\LIWKHFRVWLVLQFXUUHGDQGFRVWHVWLPDWHVLQFOXGHGLQQHJRWLDWHGSULFHVDUH DOORZDEOHLQDFFRUGDQFHZLWKWKHIHGHUDODQGVWDWHUHJXODWLRQVDQGSURFHGXUHVDQGFRQWUDFW SURYLVLRQV([DPSOHVRI&RVW$QDO\VLV:RUNVKHHWVDUHSURYLGHGDW([KLELW+WKURXJK /RFDODJHQFLHVDUHUHTXLUHGWRDSSO\&DOWUDQVDFFHSWHGFRQVXOWDQWRUVXEFRQVXOWDQW·V,&5VWR FRQWUDFWV$Q,&5LVYDOLGIRUWKHRQH\HDUDSSOLFDEOHDFFRXQWLQJSHULRGDFFHSWHGRUDXGLWHG E\&DOWUDQV &RQVXOWDQWVVKDOOXSGDWHRQDQDQQXDOEDVLV,&5VLQDFFRUGDQFHZLWKWKH FRQVXOWDQW·VDQQXDODFFRXQWLQJSHULRGDQGLQFRPSOLDQFHZLWKWKH)HGHUDOFRVWSULQFLSOHV )RUIXUWKHUJXLGDQFHUHIHUWR&)53DUW E  ,IWKHFRQVXOWDQWLVVXEMHFWWR&RVW $FFRXQWLQJ6WDQGDUGV &$6 WKHFRQVXOWDQWPXVWXVHWKHDSSOLFDEOH ,&5IRUWKHFRQWUDFW WĂŐĞϭϰŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 57 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ $FRQVXOWDQW·VDFFHSWHG,&5IRULWVRQH\HDUDSSOLFDEOHDFFRXQWLQJSHULRGVKDOOEHDSSOLHGWR FRQWUDFWVKRZHYHURQFHDQ,&5LVHVWDEOLVKHGIRUDFRQWUDFWLWPD\EHH[WHQGHGEH\RQGWKH RQH\HDUDSSOLFDEOHSHULRGWKURXJKWKHGXUDWLRQRIWKHVSHFLILF FRQWUDFWSURYLGHGDOO FRQFHUQHGSDUWLHVDJUHH$JUHHPHQWWRWKHH[WHQVLRQRIWKHRQH\HDUDSSOLFDEOHSHULRGVKDOO QRWEHDFRQGLWLRQRUTXDOLILFDWLRQWREHFRQVLGHUHGIRUWKHZRUNRUFRQWUDFWDZDUG7KH FRQWUDFWPXVWFOHDUO\VSHFLI\WKH,&5SHULRGLILWLVEH\RQGWKHRQH\HDUDSSOLFDEOHSHULRG &RQVXOWDQWVVKDOODFFRXQWIRUFRVWVDSSURSULDWHO\DQGPDLQWDLQUHFRUGVLQFOXGLQJVXSSRUWLQJ GRFXPHQWDWLRQDGHTXDWHWRGHPRQVWUDWHWKDWFRVWVFODLPHGKDYHEHHQ LQFXUUHGDQGDUH DOORZDEOHUHDVRQDEOHDQGDOORFDEOHWRWKHFRQWUDFWDQGFRPSO\ZLWK)HGHUDOFRVWSULQFLSOHV ,2$,DQGUHSUHVHQWDWLYHVRIWKH)HGHUDO*RYHUQPHQWKDYHWKHULJKWWRFRQGXFWDQDXGLWRIDOO FRQWUDFWFRVWV,IWKHFRVWVDUHVXEVHTXHQWO\GHWHUPLQHGWREHXQDOORZDEOHWKHVHFRVWVDUH VXEMHFWWRUHSD\PHQW)RUIXUWKHUJXLGDQFHUHIHUWR&)53DUWDQG&)53DUW *HQHUDOO\ZKHQHYHUORFDODJHQFLHVFRQVXOWDQWVDQGRUFRQWUDFWRUVDUHXQDEOHWRSURYLGH UHTXHVWHGGRFXPHQWDWLRQLWVKDOOEHYLHZHGWKDWWKHVHUYLFHVZHUHHLWKHUQRWSHUIRUPHGRU WKHFRVWVQRWSURSHUO\UHFRUGHG5HWHQWLRQRIDOOGRFXPHQWVLVUHTXLUHGDVLWUHGXFHVWKH SRVVLELOLW\RIDXGLWILQGLQJVDQGdisallowed costs)RUPRUHUHIHUHQFHVUHIHUWR$SSOLFDEOH 6WDQGDUGVLQWKLVFKDSWHU $SSURYDORU$FFHSWDQFHRI,QGLUHFW&RVW5DWHV &RJQL]DQW/HWWHUVRI$SSURYDO $FRJQL]DQWDSSURYHG,&5KDVEHHQDXGLWHGE\D&RJQL]DQWDJHQF\ D6WDWHWUDQVSRUWDWLRQ DJHQF\RIWKH6WDWHZKHUHWKHFRQVXOWDQW VDFFRXQWLQJDQGILQDQFLDOUHFRUGVDUHORFDWHGRUD6WDWH WUDQVSRUWDWLRQDJHQF\WRZKLFKFRJQL]DQFHIRUWKHSDUWLFXODULQGLUHFWFRVWUDWH V RIDFRQVXOWLQJ ILUPKDVEHHQGHOHJDWHGRUWUDQVIHUUHGWRLQZULWLQJE\WKH6WDWHWUDQVSRUWDWLRQDJHQF\ZKHUH WKHFRQVXOWDQW·VDFFRXQWLQJDQGILQDQFLDOUHFRUGVDUHORFDWHG LQDFFRUGDQFHZLWKJHQHUDOO\ DFFHSWHGJRYHUQPHQWDXGLWLQJVWDQGDUGVWRWHVWFRPSOLDQFHZLWKWKHUHTXLUHPHQWVRIWKH )HGHUDOFRVWSULQFLSOHV SHU&)5SDUW DQGWKHFRJQL]DQWDJHQF\KDVHLWKHU LVVXHGDQ DXGLWUHSRUWRIWKHFRQVXOWDQW VLQGLUHFWFRVWUDWHRU FRQGXFWHGDUHYLHZRIDQDXGLWUHSRUWDQG UHODWHGZRUNSDSHUVSUHSDUHGE\DFHUWLILHGSXEOLFDFFRXQWDQWDQGLVVXHGDOHWWHURIFRQFXUUHQFH ZLWKWKHDXGLWHGLQGLUHFWFRVWUDWH V 7KHFRJQL]DQWDJHQF\DSSURYHVWKH,&5DQGDFRJQL]DQW DSSURYDOOHWWHULVLVVXHG &DOWUDQV$FFHSWDQFHRI,QGLUHFW&RVW5DWH :KHQWKH,&5VKDYHQRWEHHQHVWDEOLVKHGE\DFRJQL]DQWDJHQF\&DOWUDQVVKDOOSHUIRUPDQDXGLW RUUHYLHZRIDFRQVXOWDQW·VDQGVXEFRQVXOWDQW·V,&5 V WRSURYLGHUHDVRQDEOHDVVXUDQFHRI FRPSOLDQFHZLWK)HGHUDOFRVWSULQFLSOHV $QDXGLWRUUHYLHZRIWKH,&5PD\FRQVLVWRIRQHRUPRUHRIWKHIROORZLQJ x3HUIRUPDUHYLHZWRGHWHUPLQHLIWKH,&5ZDVSUHSDUHGLQDFFRUGDQFHZLWK&)5 DQG&)5&KDSWHU3DUW x3HUIRUPDQDXGLWWRGHWHUPLQHLIWKH,&5ZDVSUHSDUHGLQDFFRUGDQFHZLWK&)5 DQG&)5&KDSWHU3DUWDQGLVVXHDQDXGLWUHSRUW x5HYLHZDQGDFFHSWDQ,&5DXGLWUHSRUWDQGUHODWHGZRUNSDSHUVSUHSDUHGE\D&3$RU DQRWKHU6WDWH7UDQVSRUWDWLRQ$JHQF\ WĂŐĞϭϱŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 58 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 7KHRXWFRPHRIDQDXGLWRUUHYLHZLVIRU&DOWUDQVWRDSSURYHRUDFFHSWWKH,&5VRWKDWLWFDQEH UHOLHGXSRQIRUIXWXUHFRQWUDFWVZLWKWKHFRQVXOWDQWIRUDJLYHQRQH\HDUDFFRXQWLQJSHULRGDQG IRUUHOLDQFHE\RWKHUFRQWUDFWLQJDJHQFLHVXVLQJWKHVDPHFRQVXOWDQW/RFDODJHQFLHVVKDOOHQVXUH WKDWRQO\DSSURYHGRUDFFHSWHG,&5VRIFRQVXOWDQWVIRUWKHDSSOLFDEOHRQH\HDUDFFRXQWLQJ SHULRGEHDSSOLHGWRFRQWUDFWVLIUDWHVDUHQRWXQGHUGLVSXWH/RFDODJHQFLHVPD\FKHFN,2$,·V ZHEVLWHIRUFRQVXOWDQW·VDSSURYHGRUDFFHSWHG,&5V$OODSSURYHGRUDFFHSWHG,&5VDUHLVVXHGDQ $FFHSWDQFH,GHQWLILFDWLRQ ,' QXPEHUE\,2$,WKDWLVSRVWHGWR,2$,·VZHEVLWHDW KWWSZZZGRWFDJRYKTDXGLWV7KLV,'QXPEHUVKRXOGEHUHIHUHQFHGRQDOOIXWXUH FRQWUDFWVWKDWXVHWKHVDPHILVFDO\HDU,&5,&5FDQEHIL[HGIRUWKHOLIHRIWKHFRQWUDFWLQSULRU ZULWWHQGRFXPHQWRUDQQXDOO\XSGDWHG2QFHLWKDVEHHQXSGDWHGLWPXVWEHDQQXDOO\XSGDWHG DQGWKHPRVWFXUUHQWILVFDO\HDURI,&5PXVWEHXVHG ,&5VWKDWKDYHQRWEHHQDFFHSWHGE\&DOWUDQVZLOOQRWEHHOLJLEOHIRULQGLUHFWFRVWSD\PHQW$Q ,&5DSSURYHGE\DFRJQL]DQWDJHQF\PD\EHXVHGDFURVVVWDWHVIRUWKHRQH\HDUDSSOLFDEOH DFFRXQWLQJSHULRGEXWDQ,&5DFFHSWHGE\&DOWUDQVPD\only EHDSSOLHGWR$ (FRQWUDFWVZLWK &DOWUDQVRUORFDODJHQF\FRQWUDFWVXVLQJSDVVWKURXJK&DOWUDQVIXQGLQJ/RFDODJHQFLHVLQFOXGH &LWLHV&RXQWLHV0HWURSROLWDQ3ODQQLQJ2UJDQL]DWLRQ6SHFLDO'LVWULFWVDQG5HJLRQDO 7UDQVSRUWDWLRQ3ODQQLQJ$JHQFLHV )LQDQFLDO5HYLHZ3HUIRUPHG3ULRUWR&RQWUDFW([HFXWLRQ $OOFRQVXOWDQWVLQFOXGLQJSULPHDQGVXEFRQVXOWDQWVRQDSURSRVHGFRQWUDFWZLWKDGROODU YDOXHJUHDWHUWKDQ.DUHVXEMHFWWRDQ,&5ILQDQFLDOUHYLHZE\,2$,7KHILQDQFLDO GRFXPHQWVUHTXLUHGDUHGHWDLOHGLQ([KLELW$A&E Consultant Financial Document Review Request Letter and Exhibit 10-A Checklist. ,2$,ZLOOUHYLHZWKH,&5ILQDQFLDOGRFXPHQWVWR HLWKHUDFFHSWRUDGMXVWWKHLQGLUHFWFRVWUDWHprior to contract execution XVLQJDULVNEDVHG DSSURDFKDVGLFWDWHGE\IDFWRUVWKDWLQFOXGHEXWDUHQRWOLPLWHGWR x+LVWRU\RIVDWLVIDFWRU\SHUIRUPDQFHDQGSURIHVVLRQDOUHSXWDWLRQRIFRQVXOWDQW x3ULRU)$5FRPSOLDQWKLVWRU\DQGDXGLWIUHTXHQF\ x([SHULHQFHRIFRQVXOWDQWZLWK)$+3FRQWUDFWV x*HQHUDOUHVSRQVLYHQHVVDQGUHVSRQVLELOLW\ x7KHDSSUR[LPDWHFRQWUDFWYROXPHDQGGROODUDPRXQWRIDOO$ (FRQWUDFWVDZDUGHGWR WKHFRQVXOWDQWE\&DOWUDQVRUDORFDODJHQF\LQ&DOLIRUQLDZLWKLQWKHODVWWKUHH FDOHQGDU\HDUV x7KHQXPEHURIVWDWHVLQZKLFKWKHFRQVXOWDQWGRHVEXVLQHVV x7KHW\SHDQGFRPSOH[LW\RIWKHFRQVXOWDQW·VDFFRXQWLQJV\VWHP x7KHUHOHYDQWSURIHVVLRQDOH[SHULHQFHRIDQ\&3$SHUIRUPLQJDXGLWVRIWKH FRQVXOWDQWVLQGLUHFWFRVWUDWH x$VVHVVPHQWRIFRQVXOWDQW·VLQWHUQDOFRQWURO5HVSRQVHVWRLQWHUQDOFRQWURO TXHVWLRQQDLUHVHH$$6+72$XGLW*XLGH$SSHQGL[% x)RU,&5VWKDWKDYHEHHQDGMXVWHGE\,2$,WKHFRQVXOWDQWPXVWSURYLGHDUHYLVHGFRVW SURSRVDOWKDWUHIOHFWVWKHDGMXVWHG,&5 WĂŐĞϭϲŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 59 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ /RFDO$JHQFLHV·5HVSRQVLELOLWLHV /RFDO$JHQFLHVDUHUHVSRQVLEOHIRUREWDLQLQJDOOUHTXLUHG,&5VXSSRUWLQJGRFXPHQWDWLRQIURP $ (SULPHFRQVXOWDQWVDQGVXEFRQVXOWDQWVDVRXWOLQHGLQ([KLELW$ A&E Consultant Financial Document Review Request) DQGWKH([KLELW$&KHFNOLVW /RFDO$JHQFLHVDUH UHVSRQVLEOHIRUIRUZDUGLQJWKHVHGRFXPHQWVWR,2$,IRUUHYLHZ /RFDODJHQFLHVDUHDOVR UHTXLUHGWRHQVXUHWKDW,2$,KDVFRSLHVRIWKH([KLELW. ´Consultant Certification of Contract Costs and Financial Management SystemµDQG([KLELW+“Cost Proposal” IRUDOOFRQVXOWDQWV ERWKSULPHDQGVXEFRQVXOWDQWV7KH,&5LQFOXGHGLQ([KLELW+PXVWPDWFKWKH,&5LQFOXGHG LQWKH([KLELW.DQGWKHFRQVXOWDQW·V,&5VFKHGXOH 7KHSURSRVHG,&5KRZHYHUFDQEH ORZHUWKDQ,&5LQ([KLELW.DQGWKHFRQVXOWDQW·V,&5VFKHGXOHLIWKHFRQVXOWDQWHOHFWVWR SURSRVHDORZHU,&5 )RUFRQWUDFWVVSDQQLQJPRUHWKDQRQH\HDUORFDODJHQFLHVDUHUHVSRQVLEOH IRUHQVXULQJWKH([KLELW.DQGFRVWSURSRVDOVDUHXSGDWHGDQQXDOO\XQOHVVDOOFRQFHUQHG SDUWLHVDJUHHWRIL[WKH,&5IRUWKHWHUPRIFRQWUDFW, DQGWKLVLVFOHDUO\VSHFLILHGLQWKHFRQWUDFW ,&5XSGDWHVDUHQRWUHTXLUHWR,2$,LIWKH,&5LVIL[HGIRUWKHOLIHRIWKHFRQWUDFW,&5·VDUHRQO\ UHYLHZHGIRUFRQVXOWDQWVWKDWDUHEHLQJDZDUGHGDFRQWUDFWQRWFRQVXOWDQWVRQDEHQFKRU VKRUWOLVW 7KH([KLELW+“Cost Proposal” LQFOXGHVFRQWUDFWFRVWVGLUHFWVDODU\RUZDJHUDWHV IL[HGIHHV RWKHUGLUHFWFRVWVLQGLUHFWFRVWVWRWDOFRVWVDQGFHUWLILFDWLRQIRUWKHFRVWV/RFDODJHQFLHVPXVW SHUIRUPDQGUHWDLQGRFXPHQWDWLRQRIDFWLYLWLHVDQGUHVRXUFHVXVHGWRVXSSRUWWKDWDFRVW DQDO\VLVKDVEHHQSHUIRUPHGWRHVWDEOLVKWKDWFRVWVDQGHOHPHQWVZHUHGHWHUPLQHGWREHIDLUDQG UHDVRQDEOHLQDFFRUGDQFHZLWK)HGHUDOFRVWSULQFLSOHV $OOFRQWUDFWVXSSRUWLQJGRFXPHQWDWLRQPXVWEHUHWDLQHGE\WKHORFDODJHQF\LQSURMHFWILOHVIRU WKHUHTXLUHGUHWHQWLRQSHULRG8QVXSSRUWHGFRVWVPD\EHGLVDOORZHGDQGUHTXLUHGWREH UHWXUQHGWR&DOWUDQV+DYLQJSURSHUGRFXPHQWDWLRQSROLF\DQGSURFHGXUHVWUDLQHGVWDIIDQG RUJDQL]HGSURMHFWILOHVDUHHVVHQWLDOIRUGHPRQVWUDWLQJWKDWFRVWVFODLPHGDQGUHLPEXUVHGKDYH EHHQLQFXUUHGDUHHOLJLEOHUHDVRQDEOHDOORZDEOHDQGDOORFDEOHWRWKHFRQWUDFWDQGFRPSO\ZLWK )HGHUDOFRVWSULQFLSOHV &RQWUDFWVEHORZDUHQRWVXEMHFWWRWKH&DOWUDQV)LQDQFLDO'RFXPHQW5HYLHZEXWORFDO DJHQFLHVDUHUHTXLUHGWRHVWDEOLVKWKDWDOOFRVWVDUHLQFRPSOLDQFHZLWKWKH)HGHUDOFRVW SULQFLSOHV&)5&KDSWHU3DUWDQGRWKHUDSSOLFDEOHUHTXLUHPHQWVDUHPHW$OO GRFXPHQWVOLVWHGDERYHDQGFRVWDQDO\VLVGRFXPHQWVDUHUHTXLUHGWREHUHWDLQHGLQWKHSURMHFW ILOHVWRGHPRQVWUDWHFRPSOLDQFH ,QVWUXFWLRQVDUHSURYLGHGLQWKH([KLELW$RQWKHUHTXLUHPHQWVIRUVXEPLWWLQJDFRPSOHWH )LQDQFLDO5HYLHZSDFNHW)LQDQFLDOSDFNHWVFDQEHHPDLOHGWR FRQIRUPDQFHUHYLHZ#GRWFDJRY $OWHUQDWLYHO\LI\RXGRQRWKDYH,QWHUQHWDFFHVV\RXFDQPDLO)LQDQFLDO5HYLHZSDFNHWV WR 'HSDUWPHQWRI7UDQVSRUWDWLRQ ,QGHSHQGHQW2IILFHRI ,QGHSHQGHQW2IILFHRI$XGLWVDQG ,QYHVWLJDWLRQV06$WWHQWLRQ ([WHUQDO$XGLW0DQDJHU WĂŐĞϭϳŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 60 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 32%R[6DFUDPHQWR&$ &RQVXOWDQWV·5HVSRQVLELOLWLHV %RWKSULPHFRQVXOWDQWVDQGVXEFRQVXOWDQWV  $ (SULPHFRQVXOWDQWVDQGVXEFRQVXOWDQWVLQFRQWUDFWZLWKORFDODJHQFLHVXVLQJVWDWHRU IHGHUDODLGKLJKZD\IXQGVVKRXOGUHIHUWR([KLELW$DQGWKH$&KHFNOLVWIRUWKH,&5 ILQDQFLDOGRFXPHQWVUHTXLUHGWREHVXEPLWWHGWRWKHLUORFDODJHQF\&RQVXOWDQWVPXVWFRPSOHWH WKH´$QQXDO&HUWLILFDWLRQRI,QGLUHFW&RVWVDQG)LQDQFLDO0DQDJHPHQW6\VWHPµ ([KLELW.  WKDWDWWHVWVWKDWWKH,&5UDWHSURSRVHGLVLQFRPSOLDQFHZLWK)$5 &)5&KDSWHU3DUW  DQGWKDWWKHFRQVXOWDQW·VILQDQFLDOPDQDJHPHQWV\VWHPLVDGHTXDWHWRDFFXPXODWHDQG VHJUHJDWHUHDVRQDEOHDOORZDEOHDQGDOORFDEOHGLUHFWDQGLQGLUHFWSURMHFWFRVWV)RUDOOIXWXUH FRQWUDFWVZLWKLQDVDPHILVFDO\HDUWKHFRQVXOWDQWQHHGVWRRQO\SURYLGHDFRS\RIWKH([KLELW .WRWKH/RFDO$JHQF\7KH([KLELW$DQG.VKRXOGEHVXEPLWWHGWRWKHORFDODJHQF\ ZKRZLOOIRUZDUGDFRS\WR,2$,DORQJZLWKDOORWKHUUHODWHGDQGUHTXLUHGILQDQFLDO GRFXPHQWV)RUJXLGDQFHVHH7UDLQLQJ0RGXOHIRU)LQDQFLDO'RFXPHQW5HTXLUHPHQWVIRU $ (&RQWUDFWVZLWK/RFDO$JHQFLHVRQ,2$,·VZHEVLWHKWWSGRWFDJRYDXGLWV FOLFNRQ $UFKLWHFWXUDO (QJLQHHULQJ&RQWUDFWV$ (&RQWUDFWVZLWK/RFDO$JHQFLHV7UDLQLQJ 0RGXOHV  &RQVXOWDQWVPXVWIROORZDOOWKHIHGHUDOVWDWHDQGFRQWUDFWUHTXLUHPHQWVRXWOLQHGDERYHLQWKH 6HFWLRQDERYH´Applicable Standards”(DFKFRQWUDFWLQJFRQVXOWDQWPXVWHQVXUHLWV,&5LVQRW FRPELQHGZLWKDQ\SDUHQWFRPSDQ\·VRUVXEVLGLDU\·V,&5 ,&5 VFKHGXOHVIRUERWKSULPHFRQVXOWDQWVDQGVXEFRQVXOWDQWVVKRXOGEHSUHSDUHGXVLQJWKH DFFUXDOEDVLVRIDFFRXQWLQJDQGEHSUHVHQWHGLQFRPSOLDQFHZLWKWKH)HGHUDOFRVWSULQFLSOHV )LJXUHDWWKHHQGRIWKLVFKDSWHUSURYLGHVDQH[DPSOHRID6WDQGDUG,QGLUHFW&RVW5DWH 6FKHGXOHWKDWFRQVXOWDQWVFDQXVHZKHQSUHSDULQJWKHLURZQ )RUSXEOLFZRUNV3UHYDLOLQJ:DJHFRQWUDFWVDOOZRUNHUVPXVWEHSDLGWKHSUHYDLOLQJZDJH UDWHGHWHUPLQHGE\WKH'LUHFWRURIWKH'HSDUWPHQWRI,QGXVWULDO5HODWLRQVDFFRUGLQJWRWKH W\SHRIZRUNDQGORFDWLRQRIWKHSURMHFWKWWSZZZGLUFDJRY3XEOLF :RUNV3UHYDLOLQJ:DJHKWPO3ULPHDQGVXEFRQVXOWDQWVPXVWLQFOXGH SUHYDLOLQJZDJH UDWHLQIRUPDWLRQLQWKHFRVWSURSRVDO(see Exhibit 10-H4 for example) DQGSURYLGHD3UHYDLOLQJ :DJH5DWH3ROLF\RQFRPSDQ\OHWWHUKHDGVLJQHGDQGGDWHG7KHSROLF\PXVWGRFXPHQWWKH DFFRXQWLQJWUHDWPHQWIRUSUHYDLOLQJZDJHGHOWDVDQGLQFOXGLQJWKHIROORZLQJLQIRUPDWLRQ x'HVFULSWLRQRIW\SHVRIZRUNWKDWUHTXLUHSD\PHQWRISUHYDLOLQJZDJHUDWHV x([SODQDWLRQRIKRZWKHILUPSD\VSUHYDLOLQJZDJHGHOWDV HJSD\GLUHFWO\WR HPSOR\HHDVVLQJOHDPRXQWWRFRYHUGHOWDEDVHDQGGHOWDIULQJHSD\GHOWDEDVHWR HPSOR\HHDQGSD\GHOWDIULQJHDPRXQWWRDWKLUGSDUW\SODQHWF  x$FFRXQWLQJPHWKRGXVHGIRUSUHYDLOLQJZDJHGHOWDEDVHFRVWV x$FFRXQWLQJPHWKRGXVHGIRUSUHYDLOLQJZDJHGHOWDIULQJHFRVWV )RUJXLGDQFHVHH&DOWUDQV·3UHYDLOLQJ:DJH,QWHUSUHWLYH*XLGDQFHDQGZHELQDURQ,2$,·V ZHEVLWHZZZGRWFDJRYDXGLWV :KHQGHWHUPLQHGQHFHVVDU\,2$,PD\UHTXHVWDGGLWLRQDOLQIRUPDWLRQVXFKDVDODERU GLVWULEXWLRQVXPPDU\DQG([HFXWLYH&RPSHQVDWLRQ$QDO\VLV (&$ $FRQVXOWDQW·VODERU GLVWULEXWLRQVXPPDU\UHSRUWLVDODERUH[SHQVHUHSRUWWKDWGHWDLODOO KRXUVZRUNHG SDLGDQG XQSDLG IRUDILVFDO\HDUZDJHVHDUQHGDQGEHQHILWVDFFUXHGE\DOOWKHFRQVXOWDQW·VHPSOR\HHV WĂŐĞϭϴŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 61 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 7KHODERUVXPPDU\UHSRUWVKRXOGLQFOXGHHPSOR\HHQDPHVVDODULHVKRXUO\UDWHVWRWDOKRXUV ZRUNHGVHJUHJDWHGE\GLUHFWKRXUVLQGLUHFWKRXUVSDLGWLPHRIIKRXUVDQGXQFRPSHQVDWHG KRXUVDQGDPRXQWV $Q(&$LVDQHYDOXDWLRQE\WKHFRQVXOWDQWWRGHWHUPLQHWKHDOORZDELOLW\DQGUHDVRQDEOHQHVV RIH[HFXWLYHFRPSHQVDWLRQLQFRPSOLDQFHZLWK)HGHUDOFRVWSULQFLSOHVDQGWKH$$6+72$XGLW *XLGHWKDWFDQEHEDVHGRQHLWKHUWKH1DWLRQDO&RPSHQVDWLRQ0DWUL[RULQGHSHQGHQW FRPSHQVDWLRQVXUYH\V ,QGHSHQGHQW2IILFHRI$XGLWVDQG,QYHVWLJDWLRQV·5HVSRQVLELOLWLHV $IWHU,2$,UHFHLYHVDFRQVXOWDQW·VFRPSOHWHILQDQFLDOGRFXPHQWSDFNHW SHU([KLELW$DQG ([KLELW$&KHFNOLVW IURPWKHORFDODJHQF\,2$,ZLOOUHYLHZWKHSURSRVHG,&5DQG VXSSRUWLQJGRFXPHQWVDQGQRWLI\ORFDODJHQFLHVLQZULWLQJZKHWKHUWKHSURSRVHG,&5VDUH DFFHSWHGRUDGMXVWHG &RQWUDFWVZLOOEHH[HFXWHGDIWHU,2$,HLWKHUDFFHSWVRUDGMXVWVWKH,&5DQGDUHYLVHGILQDOFRVW SURSRVDO LIDSSOLFDEOH LVUHFHLYHG &RUUHFWLRQRIWKHILQDOFRVW SURSRVDOKRZHYHUGRHV127 QHHGWREHFOHDUHGWKURXJK&DOWUDQV,2$,EHIRUH H[HFXWLQJWKHFRQWUDFW$QHPDLOQRWLILFDWLRQ IURP,2$,VHUYHVDVGRFXPHQWDWLRQWRVXSSRUWDQDFFHSWHG,&5 $XGLWVDQG5HYLHZVWREH3HUIRUPHG $IWHUFRQWUDFWH[HFXWLRQDFRQVXOWDQW·V,&5PD\EHVXEMHFWWRIXUWKHUGHWDLOHGUHYLHZRUDXGLW E\,2$,EDVHGRQFHUWDLQULVNIDFWRUV&RVWVWKDWDUHGHWHUPLQHGWREHXQDOORZDEOHDVDUHVXOWRI WKHUHYLHZRUDXGLWZLOOEHVXEMHFWWRUHSD\PHQW ,QGLUHFW&RVW5DWH$XGLWV 'XULQJDQ,&5DXGLW,2$,RUDQLQGHSHQGHQW&3$ZLOOH[DPLQHWKH FRQVXOWDQW·VSURSRVHG,&5 IRUDRQH\HDUDFFRXQWLQJSHULRGWRHQVXUHWKDWXQDOORZDEOHFRVWVKDYHEHHQUHPRYHGIURPWKH LQGLUHFW FRVWVWKDWDOORZDEOHFRVWVKDYHEHHQFRUUHFWO\PHDVXUHGDQGSURSHUO\FKDUJHGDQG DOORFDWHGDQGWKDWWKH,&5KDVEHHQGHYHORSHGLQDFFRUGDQFHZLWKWKH)HGHUDOFRVWSULQFLSOHV DVVSHFLILHGLQ86&6HFWLRQ E  % &)53DUW&)53DUW DQGRWKHU )$5DQG6WDWHUHTXLUHPHQWV $VDUHVXOWRIWKHDXGLWWKHORFDODJHQF\ZLOO ZRUNZLWKWKH FRQVXOWDQWWRDGMXVWWKH,&5EDVHGRQDXGLWUHFRPPHQGDWLRQV )RUJXLGDQFHUHJDUGLQJWKHH[LVWLQJSROLFLHVDQGSURFHGXUHVVHWIRUWKLQWKHIHGHUDOUHJXODWLRQV DQGDFFHSWDEOH,&5VFKHGXOHVUHIHUWRWKH$$6+72$XGLW*XLGH&KDSWHUDQG)LJXUH 6WDQGDUG,QGLUHFW&RVW5DWH6FKHGXOHLQWKLV&KDSWHU7KHUHLVDOVRDUHYLHZSURJUDPDW $SSHQGL[$ZKLFKVHUYHVDVDJXLGHIRU&3$VDQG,2$,ZKHQSHUIRUPLQJ,&5DXGLWVDQGFDQ DOVREHXVHGDVDUHVRXUFHIRUFRQVXOWDQWVZKHQSUHSDULQJIRUDQ,&5DXGLW &3$:RUNSDSHU5HYLHZV 'XULQJDZRUNSDSHUUHYLHZRID&3$DXGLWRIDQ,&5,2$,ZLOOUHYLHZWKH&3$·VDXGLW ZRUNSDSHUVWRGHWHUPLQHZKHWKHUWRLVVXHD&RJQL]DQW/HWWHURI$SSURYDOIRUWKH,&57KH &3$:RUNSDSHU5HYLHZGHWHUPLQHVZKHWKHU D WKH&3$·VDXGLWRIWKH,&5ZDVFRQGXFWHGLQ DFFRUGDQFHZLWK*HQHUDOO\$FFHSWHG*RYHUQPHQW$XGLWLQJ6WDQGDUGV *$*$6  E WKH&3$ WĂŐĞϭϵŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 62 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ DGHTXDWHO\FRQVLGHUHGWKHDXGLWHH·VFRPSOLDQFHZLWKWKH)HGHUDOFRVWSULQFLSOHVDQGUHODWHG IHGHUDODQGVWDWHODZVDQGUHJXODWLRQV &KDSWHURIWKH$$6+72$XGLW*XLGHSURYLGHVLQIRUPDWLRQWRWKH&3$RQWKHUHTXLUHG DXGLWGLVFORVXUHV ,03257$17127()25&3$V&RQWUDFWVUHFHLYLQJVWDWHRUIHGHUDOIXQGVDUHKLJKO\ VFUXWLQL]HG0DWHULDOLW\OHYHOVWHQGWREHORZHUDQGPRUHWHVWLQJLVUHTXLUHG*$*$6SURYLGHV WKDWDXGLWRUVPD\ILQGLWDSSURSULDWHWRXVHORZHUPDWHULDOLW\OHYHOVDVFRPSDUHGZLWKWKH PDWHULDOLW\OHYHOVXVHGLQQRQ*$*$6DXGLWVEHFDXVHRIWKHSXEOLFDFFRXQWDELOLW\RI JRYHUQPHQWHQWLWLHVDQGHQWLWLHVUHFHLYLQJJRYHUQPHQWIXQGLQJYDULRXVOHJDODQGUHJXODWRU\ UHTXLUHPHQWVDQGWKHYLVLELOLW\DQGVHQVLWLYLW\RIJRYHUQPHQWSURJUDPV7KH$$6+72$XGLW *XLGHVKRXOGEHXVHGDVDWRROIRUSHUIRUPLQJDXGLWVDQGDWWHVWDWLRQVRI$ (ILUPV &RQWUDFW$XGLWV 'XULQJD&RQWUDFW$XGLWDXGLWRUVZLOOUHYLHZDFRQVXOWDQW·V ILQDQFLDOPDQDJHPHQWV\VWHPDQG FRQWUDFWFRVWSURSRVDOWRGHWHUPLQHLI x7KHFRQVXOWDQWV·DFFRXQWLQJV\VWHPLVDGHTXDWHWRDFFXPXODWHDQGVHJUHJDWHFRVWV x&RVWVDUHUHDVRQDEOHDOORZDEOHDOORFDEOHDQGVXSSRUWHGDGHTXDWHO\ x7KHFRQWUDFWFRQWDLQVDOOUHTXLUHGILVFDOSURYLVLRQV x3URSHUVWDWHDQGIHGHUDOSURFXUHPHQWUHTXLUHPHQWVZHUHIROORZHG ,QFXUUHG&RVW$XGLWV 'XULQJDQ,QFXUUHG&RVW$XGLWDXGLWRUVZLOOUHYLHZLQFXUUHGFRQWUDFWFRVWVWRGHWHUPLQHLI x&RVWGDWDDUHPDLQWDLQHGLQDQDFFRXQWLQJV\VWHPWKDWDGHTXDWHO\JDWKHUVUHFRUGV FODVVLILHVVXPPDUL]HVDQGUHSRUWVDFFXUDWHDQGWLPHO\ILQDQFLDOGDWDIRUGLUHFWDQG LQGLUHFWSURMHFWFRVWVE\DFFRXQW x&RVWVDUHDGHTXDWHO\VXSSRUWHGUHDVRQDEOHDOORZDEOHDQGDOORFDEOH x&RVWVLQFXUUHGDUHLQFRPSOLDQFHZLWKVWDWHDQGIHGHUDOODZVDQGUHJXODWLRQV x&RVWVLQFXUUHGDUHLQFRPSOLDQFHZLWKWKH0DVWHU$JUHHPHQWDQG6XSSOHPHQWDO $JUHHPHQW x&RVWVLQFXUUHGDUHLQFRPSOLDQFHZLWKWKHILVFDOSURYLVLRQVVWLSXODWHGLQWKH FRQWUDFWDQG x7KHWHUPVUHTXLUHGE\WKH0DVWHU$JUHHPHQWDQGIHGHUDOODZVDQGUHJXODWLRQVDUH LQWKHFRQWUDFW $XGLW)LQGLQJVDQG5HYLHZ'HILFLHQFLHV ,IDFRQVXOWDQW·V,&5LVDXGLWHGRUUHYLHZHGORFDODJHQFLHVDUHUHVSRQVLEOHIRUHQVXULQJDOO H[HFXWHGDQGIXWXUHFRQWUDFWVUHIOHFWWKHDXGLWHGDQGDGMXVWHGILVFDO\HDU,&5 V /RFDODJHQFLHV VKRXOGUHTXHVWUHLPEXUVHPHQWIURPWKHFRQVXOWDQWIRURYHUSD\PHQWRQUDWHVWKDWZHUH DGMXVWHGGRZQ 7KHORFDODJHQFLHVPD\EHVXEMHFWWRVDQFWLRQVRXWOLQHGLQ/$30&KDSWHUDeficiencies and Sanctions LIWKHVWDWHRUIHGHUDOJRYHUQPHQWGHWHUPLQHVWKDWDQ\UHLPEXUVHPHQWV WRWKH WĂŐĞϮϬŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 63 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ FRQVXOWDQWDUHWKHUHVXOWRIODFNRISURSHUFRQWUDFWSURYLVLRQVXQDOORZDEOH FKDUJHV XQVXSSRUWHGDFWLYLWLHVRUDQLQDGHTXDWHILQDQFLDOPDQDJHPHQWV\VWHP ([DPSOHRID)$5&RPSOLDQW,QGLUHFW&RVW5DWH6FKHGXOHSample Consulting Company Statement of Direct Labor, Fringe Benefits, and General Overhead for the Year Ended December 31, 20xx Description General Ledger Balance Unallowable FAR Reference Total Proposed Home Office Field Office 'LUHFW/DERU         Fringe Benefits 9DFDWLRQ3DLG/HDYHV    3D\UROO7D[HV        0HGLFDO,QVXUDQFH    .0DWFK    ,QFHQWLYHVDQG%RQXV        2WKHU(PSOR\HH %HQHILWV         Total Fringe Benefits      General & Administrative Overhead ,QGLUHFW2YHUKHDG /DERU            3XUFKDVHG /DERU6XEFRQVXOWDQWV        Office Rent         6XSSOLHV 8WLOLWLHV     3RVWDJHDQG 6KLSSLQJ       (TXLSPHQWDQG 0DLQWHQDQFH   'HSUHFLDWLRQ ([SHQVH        ,QWHUHVW     'XHVDQG 6XEVFULSWLRQ        $GYHUWLVLQJ  0DUNHWLQJ        9HKLFOHV          %DGGHEWV     Legal and Accounting Services         )LQHVDQG3HQDOWLHV      7RWDO*HQHUDO  $GPLQ2YHUKHDG     WĂŐĞϮϭŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 64 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 7RWDO,QGLUHFW&RVWVΨϭϯϬ͕Ϭϭϭ͕ϴϳϬ ,QGLUHFW&RVW5DWHV   &ŝŐƵƌĞϭϬ͘ϯ͗^ƚĂŶĚĂƌĚ/ŶĚŝƌĞĐƚŽƐƚZĂƚĞ^ĐŚĞĚƵůĞ FAR References:  )$58QFRPSHQVDWHGRYHUWLPH  )$53URILWGLVWULEXWLRQDQGH[FHVVRIWKHUHDVRQDEOHFRPSHQVDWLRQ  )$5 0HDOVQRWIRUYDOLGEXVLQHVVSXUSRVHVDQGDVVRFLDWHGZLWK OREE\LQJDQGODFNLQJ DGHTXDWHVXSSRUW  )$5$GPLQLVWUDWLYHVWDIIFRVWVELOOHGWRSURMHFWVFOLHQWV  )$56XEFRQVXOWDQWODERUDQGRWKHUGLUHFWFRVWVELOOHGWRDQGSDLGE\FRQWUDFWVFOLHQWV  )$5DQG&DSLWDOOHDVHFRVWVUHQWSDLGLQH[FHVVRIUHDVRQDEOHFRVWVDQGLGOH IDFLOLWLHVDQGFDSDFLW\FRVWV  )$5 &RVWVUHODWHVWRSHUVRQDOXVHE\HPSOR\HHVDQGOX[XU\YHKLFOHV  )$5,QWHUHVWDQGRWKHUILQDQFLDOFRVWVQRWDOORZDEOH  )$51RQEXVLQHVVUHODWHGGXHVDQGVXEVFULSWLRQV  )$5&RVWVIRUDGYHUWLVHPHQWDQGSXEOLFUHODWLRQVFRVWVDQGWUDGHVKRZH[SHQVHLQFOXGLQJ ODERU  )$5 G DQG P  3HUVRQDOXVHRIYHKLFOHDQGODFNRIPLOHDJHORJVDQGEXVLQHVV SXUSRVH  )$5 %DGGHEWVDQGFROOHFWLRQFRVWV  )$5DQG5HRUJDQL]DWLRQDQGFDSLWDOUDLVLQJUHODWHGFRVWVDQGFRVWVLQFXUUHGLQ FRQQHFWLRQZLWK YLRODWLRQRI DODZRUUHJXODWLRQE\WKHFRQVXOWDQW  )$58QUHDVRQDEOHFRVWVDQGFRVWVQRWVXSSRUWHGE\GRFXPHQWVDQGODFNRIEXVLQHVV SXUSRVH  )$5 D  &$6/DERUFRVWVDVVRFLDWHGZLWKXQDOORZDEOHFRVWV  )$5)LQHVDQGSHQDOWLHVUHVXOWLQJIURPYLRODWLRQVRIODZVDQGUHJXODWLRQV 7KLVVHFWLRQRXWOLQHVWKHDXGLWDQGUHYLHZSURFHVVIRU$ (FRQWUDFWVWKDWDWDQ\WLPHXVHIHGHUDO DQGRUVWDWHIXQGV$OOSURSRVHG$ (FRQWUDFWVDQGVXSSRUWLQJGRFXPHQWVDUHVXEMHFWWRDXGLWRU UHYLHZE\&DOWUDQV·,QGHSHQGHQW2IILFHRI,QGHSHQGHQW2IILFHRI$XGLWVDQG,QYHVWLJDWLRQV ,2$,  RWKHUVWDWHDXGLWRUJDQL]DWLRQVRUWKHIHGHUDOJRYHUQPHQW1RWDOOSURSRVHGFRQWUDFWVZLOOEHDXGLWHG RUUHYLHZHGUDWKHUWKH\ZLOOEHVHOHFWHGRQDULVNEDVHGDSSURDFK &2168/7$176(/(&7,210(7+2'6 )LJXUH&RQVXOWDQW6HOHFWLRQ)ORZFKDUWVKRZVWKHWKUHHPHWKRGVQRUPDOO\XVHGLQVHOHFWLQJD FRQVXOWDQW7KH\DUH x2QH6WHS5)3 x2QH6WHS5)4 x7ZR6WHS5)45)3 WĂŐĞϮϮŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 65 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 7KHPHWKRGXVHGGHSHQGVXSRQWKHVFRSHRIZRUNWKHVHUYLFHVUHTXLUHGWKHSURMHFW·VFRPSOH[LW\DQG WKHWLPHDYDLODEOHIRUVHOHFWLRQRIWKHFRQVXOWDQW %HJLQQLQJZLWKSection 10.1.5: Consultant Selection Using the One–Step RFP Method, HDFKRIWKHVHOHFWLRQ PHWKRGVLVH[SODLQHGLQGHWDLO5HJDUGOHVVRIWKHPHWKRGXVHGWKHORFDODJHQF\VKDOOUHWDLQDOO FRQVXOWDQWVHOHFWLRQGRFXPHQWDWLRQLQWKHLUSURMHFWILOHVDVUHTXLUHGE\&)53DUW 2QH6WHS5)3 7KH2QH6WHS5)3PHWKRGPD\EHXVHGIRU3URMHFW²VSHFLILFFRQWUDFWVZKHQWKHVFRSHRIZRUNLVZHOO GHILQHGRUIRU0XOWLSKDVHGFRQWUDFWVZKHUHWKHGHILQHGVFRSHRIZRUNLVGLYLGHGLQWRSKDVHV2WKHU FRQVLGHUDWLRQVLQFOXGHZKHQWKHFRQVXOWDQW·VVHUYLFHVDUHKLJKO\VSHFLDOL]HGDQGWKHUHDUHIHZTXDOLILHG FRQVXOWDQWV 2QH6WHS5)4 7KH2QH6WHS5)4PHWKRGLVXVHGZKHQWKHUHTXHVWHGVHUYLFHVDUHVSHFLDOL]HGRUWKHVFRSHRIZRUNLV GHILQHGEURDGO\DQGPD\LQFOXGHPXOWLSOHSURMHFWV7\SLFDOVHUYLFHVDUHSUHOLPLQDU\HQJLQHHULQJ VXUYH\LQJHQYLURQPHQWDOVWXGLHVSUHSDUDWLRQRI3ODQV6SHFLILFDWLRQVDQG(VWLPDWH 36 ( DQG HQYLURQPHQWDOGRFXPHQWVRUFRQVWUXFWLRQPDQDJHPHQW7KLVPHWKRGRUWKHWZRVWHSVHOHFWLRQSURFHVV LVXVHGIRUSURFXUHPHQWRIRQFDOOFRQWUDFW V 1RWHWKDWVSHFLILFDWLRQVDQGUHTXLUHPHQWVLQWKH5)4 PXVWFRYHUDOODVSHFWVRIWKHILQDOQHHG$5)3VSHFLILFWRWKHSURMHFWWDVNRUVHUYLFHPXVWEHLQFOXGHG LQWKHVROLFLWDWLRQIRUHYDOXDWLRQRIDFRQVXOWDQW VVSHFLILFWHFKQLFDODSSURDFKDQGTXDOLILFDWLRQV 7ZR6WHS 5)4)ROORZHGE\5)3  7KH7ZR6WHS5)45)3PHWKRGPD\EHXVHGZKHQWKHVFRSHRIZRUNLVFRPSOH[RUXQXVXDO7KLV PHWKRGDOVRPD\EHSUHIHUUHGE\ORFDODJHQFLHVWKDWDUHLQH[SHULHQFHGDERXWQHJRWLDWLRQVDQG SURFHGXUHVIRUHVWDEOLVKLQJFRPSHQVDWLRQ+RZHYHUWKH7ZR6WHS5)45)3PHWKRGLVUHFRPPHQGHG IRUSURFXUHPHQWRIPXOWLSOHRQFDOOFRQWUDFWVRURQFDOOOLVWWKURXJKDVLQJOHVROLFLWDWLRQ5HJDUGOHVVRI DQ\SURFHVVXWLOL]HGIRUSUHTXDOLILFDWLRQRIFRQVXOWDQWVRUIRUDQLQLWLDODVVHVVPHQWRIDFRQVXOWDQW V TXDOLILFDWLRQVXQGHUD5)4D5)3VSHFLILFWRWKHSURMHFWWDVNRUVHUYLFHLVUHTXLUHGIRUHYDOXDWLRQRID FRQVXOWDQW VVSHFLILFWHFKQLFDODSSURDFKDQGTXDOLILFDWLRQV)RUPRUHLQIRUPDWLRQUHIHUWRGHVFULSWLRQRI RQFDOOFRQWUDFWLQSection 10.1.2: Identifying & Defining a Need for Consultants. 7KLVPHWKRGUHTXLUHV VXEVWDQWLDOO\PRUHZRUNDQGWLPHWKDQWKHRWKHUWZRPHWKRGVGHVFULEHGDERYH WĂŐĞϮϯŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 66 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶInitiate Project Select Consultants &RPSOHWH)LUVW6WHSYSelect Project YSet Project Objectives YAppoint Contract Administrator YDetermine Project Schedule ,GHQWLI\QHHGIRUFRQVXOWDQW'HILQH6FRSHRI&RQVXOWDQW:RUN6SHFLI\3URGXFWVWREHGHOLYHUHG'HWHUPLQH0HWKRGRI&RQVXOWDQW6HOHFWLRQ6HJPHQW3URMHFW:RUN(VWDEOLVK'%(*RDOV(VWLPDWH&RVWRI&RQVXOWDQW:RUN'HWHUPLQH7\SHRI&RQWUDFWYLump Sum YCost-Plus-Fixed-Fee YCost Per Unit of Work YSpecific Rates of Compensation $SSRLQW&RQVXOWDQW6HOHFWLRQ&RPPLWWHHDQG'HYHORS6FKHGXOHIRU6HOHFWLRQ$SSRLQWPHQW&RQVXOWDQW6HOHFWLRQ&RPPLWWHHDQG'HYHORSPHQW6FKHGXOHIRU6HOHFWLRQ'HYHORS7HFKQLFDO&ULWHULDIRU(YDOXDWLRQRI3URSRVDOV3UHSDUH5HTXHVWIRU3URSRVDO$GYHUWLVHIRU&RQVXOWDQWV 5)4 $SSRLQW&RQVXOWDQW6HOHFWLRQ&RPPLWWHHDQG'HYHORS6FKHGXOHIRU6HOHFWLRQ$GYHUWLVHIRU&RQVXOWDQWV 5)4 'HYHORS4XDOLILFDWLRQ&ULWHULDIRU(YDOXDWLRQRI3URSRVDOV'HYHORS4XDOLILFDWLRQ&ULWHULDIRU(YDOXDWLRQRI3URSRVDOV5HFHLYH6WDWHPHQWVRI4XDOLILFDWLRQV5HFHLYH6WDWHPHQWVRI4XDOLILFDWLRQV$GYHUWLVHIRU&RQVXOWDQWV(YDOXDWH6WDWHPHQWVRI4XDOLILFDWLRQV 'HYHORS6KRUWOLVW(YDOXDWH6WDWHPHQWVRI4XDOLILFDWLRQV 'HYHORS6KRUWOLVW,VVXH5HTXHVWIRU3URSRVDO 5)3 1RWLI\&RQVXOWDQWVRI6KRUWOLVW1RWLI\&RQVXOWDQWVRI6KRUWOLVW,VVXH5HTXHVWIRU3URSRVDO 5)3 &RQGXFW&RQVXOWDQW¶V&RQIHUHQFHRU$QVZHU:ULWWHQ4XHVWLRQV5HFHLYHDQG(YDOXDWH7HFKQLFDO3URSRVDOV,QWHUYLHZ 'HYHORS)LQDO5DQNLQJRI&RQVXOWDQWV1RWLI\&RQVXOWDQWVRI5HVXOWV 5HTXHVW&RVW3URSRVDO 1HJRWLDWH&RQWUDFWZLWK7RS5DQNHG&RQVXOWDQW'HYHORS&RQWUDFW,QLWLDWH$ (&RQVXOWDQW$XGLW3URFHVV )LJXUH 1HJRWLDWH&RQWUDFWZLWK1H[W+LJKHVW5DQNHG&RQVXOWDQWXQWLO6XFFHVVIXO(YDOXDWH5HIHUHQFH&KHFNV 2WKHU,QIRUPDWLRQ*DWKHUHG,QGHSHQGDQWO\(YDOXDWH5HIHUHQFH&KHFNV 2WKHU,QIRUPDWLRQ*DWKHUHG,QGHSHQGHQWO\,QWHUYLHZ 'HYHORS)LQDO5DQNLQJRI&RQVXOWDQWV1RWLI\&RQVXOWDQWVRI5HVXOWV 5HTXHVW&RVW3URSRVDO 1HJRWLDWH&RQWUDFWZLWK7RS5DQNHG&RQVXOWDQW'HYHORS&RQWUDFW,QLWLDWH$ (&RQVXOWDQW$XGLW3URFHVV )LJXUH 1HJRWLDWH&RQWUDFWZLWK1H[W+LJKHVW5DQNHG&RQVXOWDQWXQWLO6XFFHVVIXO,QWHUYLHZ7RS5DQNHG&RQVXOWDQWV&RQGXFW&RQVXOWDQW¶V&RQIHUHQFHRU$QVZHU:ULWWHQ4XHVWLRQV5HFHLYHDQG(YDOXDWH7HFKQLFDO3URSRVDOV'HYHORS)LQDO,QWHUYLHZ 5DQNLQJRI&RQVXOWDQWV1RWLI\&RQVXOWDQWVRI5HVXOWV 5HTXHVW&RVW3URSRVDO 1HJRWLDWH&RQWUDFWZLWK7RS5DQNHG&RQVXOWDQW'HYHORS&RQWUDFW,QLWLDWH$ (&RQVXOWDQW$XGLW3URFHVV )LJXUH 1HJRWLDWH&RQWUDFWZLWK1H[W+LJKHVW5DQNHG&RQVXOWDQWXQWLO6XFFHVVIXO(YDOXDWH5HIHUHQFH&KHFNV 2WKHU,QIRUPDWLRQ*DWKHUHG,QGHSHQGHQWO\“One-Step, RFP” Method: Request for Proposal followed by Negotiation (Use when there are few consultants) “One-Step, RFQ” Method: Request for Qualifications followed by Interviews and Negotiation (Use when there are many consultants) “Two-Step, RFQ/RFP” Method: Request for Qualifications followed by Request for Proposal and Negotiation (Use when scope of work is complex) 'HYHORS)LQDO&RQWUDFW([HFXWH&RQWUDFW,VVXH1RWLFHWR3URFHHGWR&RQVXOWDQW$GPLQLVWHU&RQWUDFWComplete Project &RQGXFW&RQVXOWDQW¶V&RQIHUHQFHRU$QVZHU:ULWWHQ4XHVWLRQV&RQGXFW&RQVXOWDQW¶V&RQIHUHQFHRU$QVZHU:ULWWHQ4XHVWLRQV1RWLI\&RQVXOWDQWVRI6KRUW/LVW1RWLI\&RQVXOWDQWVRI6KRUW/LVW6DPHDV³2QH6WHS5)4´0HWKRG6DPHDV³2QH6WHS5)3´0HWKRG5HFHLYH&RQIRUPDQFH/HWWHUIURP$ ,DQG,PSOHPHQW)LQGLQJV&ŝŐƵƌĞϭϬͲϰ͗ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ&ůŽǁĐŚĂƌƚWĂŐĞϮϰŽĨϳϮ:ĂŶƵĂƌLJϮϬϭϵ67 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶWĂŐĞϮϱŽĨϳϮ:ĂŶƵĂƌLJϮϬϭϵ68 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ &2168/7$176(/(&7,2186,1*7+(21(67(35)30(7+2' 2IWKHWKUHHPHWKRGVGLVFXVVHGWKLVRQHLVPRVWHDVLO\PRGLILHGIRUQRQ$ (FRQVXOWLQJFRQWUDFWV 7KLVSURFXUHPHQWSURFHGXUHXVXDOO\LQYROYHVDVLQJOHVWHSSURFHVVZLWKLVVXDQFHRIDUHTXHVWIRU SURSRVDO 5)3 WRDOOLQWHUHVWHGFRQVXOWDQWV)RUQRQ$ (FRQVXOWLQJFRQWUDFWVDFRVWSURSRVDOVKDOO EHSDUWRIWKH5)3DQGWKHVHOHFWLRQFULWHULD)RU$ (FRQWUDFWVWKHFRVWSURSRVDOLVQRWUHTXHVWHG XQWLOWKHFRQVXOWDQWVKDYHEHHQILQDOUDQNHGEDVHGXSRQWKHLUVXEPLWWHGWHFKQLFDOSURSRVDO $SSRLQW&RQVXOWDQW6HOHFWLRQ&RPPLWWHH $FRQVXOWDQWVHOHFWLRQFRPPLWWHHZLWKDPLQLPXPRIWKUHHPHPEHUVLVDSSRLQWHGDWWKHEHJLQQLQJ RIWKHFRQVXOWDQWVHOHFWLRQSURFHVV7KHFRPPLWWHHUHYLHZVPDWHULDOVVXEPLWWHGE\FRQVXOWDQWV GHYHORSVDVKRUWOLVWRITXDOLILHGFRQVXOWDQWVDQGGHYHORSVDILQDOUDQNLQJRIWKHPRVWTXDOLILHG SURSRVDOV5HSUHVHQWDWLRQRQWKHFRPPLWWHHLQFOXGHVWKH&RQWUDFW$GPLQLVWUDWRUDQGVXEMHFWPDWWHU H[SHUWVIURPWKHSURMHFW·VIXQFWLRQDODUHD7KHPHPEHUVVKRXOGEHIDPLOLDUZLWKWKH SURMHFWVHJPHQWWREHFRQWUDFWHGRXWDQGZLWKWKHORFDODJHQF\VWDQGDUGVWKDWZLOOEHXVHGLQWKH FRQWUDFW3DUWLFLSDWLRQE\D&DOWUDQVGLVWULFWUHSUHVHQWDWLYHLVDWWKHRSWLRQRIWKHDJHQF\DQGVXEMHFW WRDYDLODELOLW\RIWKH'/$(VWDII&DOWUDQVSDUWLFLSDWLRQRQWKHLQWHUYLHZSDQHOGRHVQRWUHOLHYHWKH ORFDODJHQF\RILWVUHVSRQVLELOLW\WRHQVXUHWKDWSURSHUSURFXUHPHQWSURFHGXUHVDUHIROORZHGDQGDOO UHTXLUHPHQWVDUHPHW /RFDODJHQF\&RQWUDFW$GPLQLVWUDWRUHQVXUHVWKDWDOOFRPPLWWHHPHPEHUVPHHWWKHFRQIOLFWRI LQWHUHVWUHTXLUHPHQWV &)5 E\FRPSOHWLQJDQGVLJQLQJDFRQIOLFWRILQWHUHVWVWDWHPHQWSULRU WRVHOHFWLRQSURFHVVLQLWLDWLRQ$VDPSOHFRQIOLFWRILQWHUHVWIRUPLVSURYLGHGLQExhibit 10-T: Panel Member Conflict of Interest & Confidentiality Statement 'HYHORS7HFKQLFDO&ULWHULDIRU(YDOXDWLRQRI3URSRVDOV 7KH&RQWUDFW$GPLQLVWUDWRULVUHVSRQVLEOHIRUGHYHORSLQJWKHWHFKQLFDOFULWHULDDQGWKHLUUHODWLYH LPSRUWDQFHZKLFKDUHXVHGWRHYDOXDWHDQGUDQNWKHFRQVXOWDQWSURSRVDOV,Q6WDWHRUORFDO SUHIHUHQFHVKDOOQRWEHXVHGDVIDFWRULQWKHHYDOXDWLRQUDQNLQJDQGVHOHFWLRQSKDVH$OOQRQ WHFKQLFDOHYDOXDWLRQFULWHULDLQFOXGLQJ'%(SDUWLFLSDWLRQVKDOOQRWH[FHHGSHUFHQW &)5  D  LLL ' $OOSULFHRUFRVWUHODWHGLWHPVZKLFKLQFOXGHEXWDUHQRWOLPLWHGWRFRVW SURSRVDOVGLUHFWVDODULHVZDJHUDWHVLQGLUHFWFRVWUDWHVDQGRWKHUGLUHFWFRVWVDUHSURKLELWHGIURP EHLQJXVHGDVHYDOXDWLRQFULWHULD 7KHFULWHULDDQGUHODWLYHZHLJKWVPXVWEHLQFOXGHGLQWKH5)3DQGWKHVDPHFULWHULDDQGUHODWLYH ZHLJKWVPXVWEHXVHGLQWKHHYDOXDWLRQVKHHWV)DLOXUHWRLQFOXGHFULWHULDDQGUHODWLYHZHLJKWVDQG WRXVHWKHVDPHFULWHULDDQGZHLJKWVGXULQJWKHHYDOXDWLRQZLOOUHVXOWLQWKHFRQWUDFWFRVWVEHLQJ LQHOLJLEOHIRUIHGHUDORUVWDWHUHLPEXUVHPHQWExhibit 10-B: Suggested Consultant Evaluation Sheet LVD UHFRPPHQGHGHYDOXDWLRQVKHHWZLWKFULWHULDDQGUDWLQJSRLQWVIRU$ (FRQVXOWDQWVZKHUHFRVWLV QRWXVHGDVDUDWLQJIDFWRU7KLVIRUPDWLVQRWPDQGDWRU\EXWLWLVUHFRPPHQGHGLQWKHLQWHUHVWRI GHYHORSLQJFRQVLVWHQF\DPRQJWKHKXQGUHGVRIDJHQFLHVDQGFRQVXOWDQWVRSHUDWLQJLQWKHVWDWH7KH ORFDODJHQF\VKRXOGFRQVXOWZLWKWKH'/$(EHIRUHPDNLQJPDMRUFKDQJHVWRWKHVXJJHVWHG DSSURDFK WĂŐĞϮϲŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 69 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 'HYHORS6FKHGXOHIRU&RQVXOWDQW6HOHFWLRQ %HIRUHWKHFRQWUDFWLVDGYHUWLVHGWKH&RQWUDFW$GPLQLVWUDWRUFRPSOHWHVDFRQWUDFWSURFXUHPHQW VFKHGXOHLQFOXGLQJNH\GDWHVIRUFRQVXOWDQWVHOHFWLRQDFWLYLWLHV7KH&RQWUDFW$GPLQLVWUDWRUVKRXOG FRQILUPNH\GDWHVZLWKDOOVHOHFWLRQFRPPLWWHHPHPEHUVEHIRUHFRPSOHWLQJWKHVFKHGXOH 3UHSDUH5)3 7KHLQIRUPDWLRQUHTXLUHGLQDQ5)3VROLFLWDWLRQLQFOXGHVWKHIROORZLQJ x'HVFULSWLRQRISURMHFW x&OHDUDFFXUDWHGHWDLOHG6FRSHRIZRUNWHFKQLFDOUHTXLUHPHQWVDQG TXDOLILFDWLRQV x6HUYLFHVWREHSHUIRUPHG x'HOLYHUDEOHVWREHSURYLGHG x3URFXUHPHQWVFKHGXOH x$SSOLFDEOHVWDQGDUGVVSHFLILFDWLRQVDQGSROLFLHV x6FKHGXOHRIZRUN LQFOXGLQJHVWLPDWHGVWDUWDQGHQGGDWHVRIWKHFRQWUDFW  x0HWKRGRISD\PHQWDQGFRVWSURSRVDOUHTXLUHPHQWV7KHFRVWSURSRVDOLV VXEPLWWHGLQDVHSDUDWHFRQFHDOHGIRUPDW&RVWSURSRVDOVDUHUHTXHVWHGIURP WKHKLJKHVWUDQNHGILUP,IWKHVHQHJRWLDWLRQVDUHIRUPDOO\WHUPLQDWHGWKHFRVW SURSRVDOLVWKHQUHTXHVWHGIURPWKHQH[WKLJKHVWUDQNHGILUP6HHExhibit 10-H: Sample Cost Proposal (Example 3) IRUVDPSOHFRVWSURSRVDOIRUPDWV x&RQWUDFWDXGLWDQGUHYLHZSURFHVVUHTXLUHPHQWV VHHSection 10.3: A&E Consultant Audit and Review Process  x3URSRVDOIRUPDWDQGUHTXLUHGFRQWHQWV x0HWKRGFULWHULDDQGZHLJKWLQJIRUVHOHFWLRQ x5HTXLUHPHQWVIRUDQ\GLVFXVVLRQVWKDWPD\EHFRQGXFWHGZLWKWKUHHRUPRUHRI WKHPRVWKLJKO\TXDOLILHGFRQVXOWDQWVIROORZLQJVXEPLVVLRQDQGHYDOXDWLRQRI SURSRVDOV x6SHFLI\FRQWUDFWW\SH x6SHFLDOSURYLVLRQVRUFRQWUDFWVUHTXLUHPHQWV x$'%(FRQWUDFWJRDOLVVSHFLILHGLQWKHVROLFLWDWLRQ VHHExhibit 10-I: Notice to Proposers DBE Information LIDIHGHUDODLGFRQWUDFW x&RQVXOWDQWVDFWLQJLQDPDQDJHPHQWVXSSRUWUROHUHTXLUHPHQWVExhibit 10-U: Consultant in Management Support Role Conflict of Interest and Confidentiality Statement; x3URWHVWSURFHGXUHVDQGGLVSXWHUHVROXWLRQSURFHVVSHU&)53DUW N  &)5 F   WĂŐĞϮϳŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 70 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 7KH5)3VSHFLILHVWKHFRQWHQWRIDSURSRVDOWKHQXPEHURIFRSLHVUHTXLUHGGXHGDWHPDLOLQJ DGGUHVVDQGDSK\VLFDODGGUHVVZKHUHWKHVXEPLWWDOVPD\EHKDQGGHOLYHUHGLIGLIIHUHQWIURP WKHPDLOLQJDGGUHVV$PLQLPXPRIIRXUWHHQ  FDOHQGDUGD\VLVUHTXLUHGEHWZHHQWKHWLPH WKH5)3LVSXEOLVKHGDQGWLPHWKDWSURSRVDOVPXVWEHVXEPLWWHG0RUHWLPHPD\EHUHTXLUHGIRU FRPSOH[FRQWUDFWVRUSURMHFWV ,WHPVW\SLFDOO\UHTXLUHGLQDWHFKQLFDOSURSRVDOLQFOXGH x:RUNSODQ VSHFLI\ZKDWLVWREHFRYHUHG  x2UJDQL]DWLRQDOFKDUW x6FKHGXOHDQGGHDGOLQHV x6WDIILQJSODQ x3URSRVHG7HDP³FRPSOHWHIRUSULPHFRQVXOWDQWDQGDOONH\VXEFRQVXOWDQWV x.H\SHUVRQQHOQDPHVDQGFODVVLILFDWLRQV³NH\WHDPPHPEHUVLGHQWLILHGLQWKH RULJLQDOSURSRVDOFRVWSURSRVDOVKDOOQRWFKDQJH EHGLIIHUHQWWKDQ LQWKHH[HFXWHG FRQWUDFW x6WDIIUHVXPHV x1DPHVRIFRQVXOWDQW·VSURMHFWPDQDJHUDQGWKHLQGLYLGXDODXWKRUL]HGWR QHJRWLDWHWKHFRQWUDFWRQEHKDOIRIWKHFRQVXOWLQJILUP x&RQVXOWDQW'%(&RPPLWPHQWGRFXPHQWVHHExhibit 10-O1: Consultant Proposal DBE Commitment x5HIHUHQFHV )LQDQFLDO0DQDJHPHQWDQG$FFRXQWLQJ6\VWHP5HTXLUHPHQWV 7KHORFDODJHQF\PXVWHQVXUHWKDWFRQVXOWDQWFRQWUDFWVROLFLWDWLRQDQGDGYHUWLVLQJGRFXPHQWV 5)3V FOHDUO\VSHFLI\WKDWFRQWUDFWVVKDOOQRWEHDZDUGHGWRDFRQVXOWDQWZLWKRXWDQDGHTXDWH ILQDQFLDOPDQDJHPHQWDQGDFFRXQWLQJV\VWHPDVUHTXLUHGE\&)53DUW&)53DUW DQG&)53DUW7KHORFDODJHQF\PXVWHQVXUHWKHVHOHFWHGFRQVXOWDQWVKDYHDGHTXDWH ILQDQFLDOPDQDJHPHQWV\VWHPVDVUHTXLUHGE\WKHDSSOLFDEOHIHGHUDOUHJXODWLRQV $GYHUWLVHIRU&RQVXOWDQWV 7KHVROLFLWDWLRQSURFHVVIRUFRQVXOWDQWVHUYLFHVVKDOOEHE\SXEOLFDGYHUWLVHPHQWRUE\DQ\RWKHU SXEOLFIRUXPRUPHWKRGWKDWDVVXUHVTXDOLILHGLQ6WDWHDQGRXWRI6WDWHFRQVXOWDQWVDUHJLYHQD IDLURSSRUWXQLW\WREHFRQVLGHUHGIRUDZDUGRIFRQWUDFW7KHPLQLPXPOHQJWKRIDGYHUWLVHPHQW LVFDOHQGDUGD\V $GYHUWLVHPHQWRIWKH5)3LQDPDMRUQHZVSDSHURIJHQHUDOFLUFXODWLRQWHFKQLFDOSXEOLFDWLRQVRI ZLGHVSUHDGFLUFXODWLRQSURIHVVLRQDODVVRFLDWLRQVDQGVRFLHWLHVUHFRJQL]HG'%(RUJDQL]DWLRQV ZHEKRVWLQJRUFOHDULQJKRXVHVNQRZQIRUSRVWLQJJRYHUQPHQWFRQWUDFWVROLFLWDWLRQVVXFKDV %LG6\QF3ODQHWELGVRUSRVWLQJWKH5)3RQWKHORFDODJHQF\·VRURWKHUZLGHO\XVHGZHEVLWHVDUH DOODFFHSWDEOHPHWKRGVRIVROLFLWDWLRQ WĂŐĞϮϴŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 71 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 7RGRFXPHQWZHEVLWHSRVWLQJVWKHORFDODJHQF\VKRXOGUHWDLQFRSLHVRIVFUHHQVKRWVGLVSOD\LQJ WKHSRVWHGEHJLQHQGGDWHV ,VVXH3XEOLVK5)3 7KHORFDODJHQF\VKDOOSXEOLVKWKH5)3RQOLQHDQGDOVRLVVXHWKH5)3WRDOOFRQVXOWDQWV UHVSRQGLQJWRQHZVSDSHUDGYHUWLVHPHQW7KHORFDODJHQF\VKDOONHHSDUHFRUGRIDOOFRQVXOWDQWV WKDWKDYHGRZQORDGHG5)3RQOLQHDVZHOODVWKRVHUHFHLYLQJDQ5)3WKURXJKRWKHUPHDQVWR HQVXUHWKDWDQ\LQTXLU\UHVSRQVHVDGGHQGXPVRUDPHQGPHQWVWRWKH5)3DUHJLYHQWRDOO FRQVXOWDQWVWKDWUHFHLYHGWKH5)3 &RQGXFW3URSRVHU·V&RQIHUHQFHRU$QVZHU:ULWWHQ4XHVWLRQV 7KHORFDODJHQF\PD\DOORZIRUFODULILFDWLRQRIWKH5)3E\LQYLWLQJVXEPLWWDORIZULWWHQ TXHVWLRQVRUE\FRQGXFWLQJDSURSRVHU·VFRQIHUHQFHRUE\GRLQJERWK7KHORFDODJHQF\PXVW SXEOLVKRUPDLOWKHLUUHVSRQVHVWRDQ\ZULWWHQTXHVWLRQVWRDOOFRQVXOWDQWVUHFHLYLQJWKH5)3 1RUHVSRQVHVKRXOGEHJLYHQWRYHUEDOTXHVWLRQV,WLVLPSRUWDQWWKDWDOOFRPSHWLQJFRQVXOWDQWV UHFHLYHWKHVDPHLQIRUPDWLRQ,IDSURSRVHU·VFRQIHUHQFHLVWREHKHOGWKHH[DFWWLPHDQGSODFH PXVWEHVSHFLILHGLQWKH5)3$WWHQGDQFHDWDSURSRVHU·VFRQIHUHQFHQRUPDOO\LVQRWPDQGDWRU\ +RZHYHUFRQVXOWDQWVQRWDWWHQGLQJWKHFRQIHUHQFHGRQRWUHFHLYHQRWHVIURPWKHPHHWLQJ XQOHVVWKH\UHTXHVWWKHQRWHV 5HFHLYHDQG(YDOXDWH7HFKQLFDO3URSRVDOV 7KH&RQWUDFW$GPLQLVWUDWRUPXVWYHULI\WKDWHDFKSURSRVDOFRQWDLQVDOORIWKHIRUPVDQGRWKHU LQIRUPDWLRQUHTXLUHGE\WKH5)3,IDOOUHTXLUHGLQIRUPDWLRQLVQRWSURYLGHGDSURSRVDOPD\EH FRQVLGHUHGQRQUHVSRQVLYHDQGUHMHFWHGZLWKRXWHYDOXDWLRQ/DWHVXEPLWWDOVVXEPLWWDOVWRWKH ZURQJORFDWLRQRUVXEPLWWDOVZLWKLQDGHTXDWHFRSLHVDUHFRQVLGHUHGQRQUHVSRQVLYHDQGVKDOOEH UHMHFWHG6XEPLWWDORIDGGLWLRQDOLQIRUPDWLRQDIWHUWKHGXHGDWHVKDOOQRWEHDOORZHG 'RFXPHQWDWLRQRIZKHQHDFKSURSRVDOZDVUHFHLYHGPXVWEHPDLQWDLQHGLQWKHSURMHFWILOHV &RSLHVRIGDWHVWDPSHGHQYHORSHFRYHUVRUER[WRSVDUHUHFRPPHQGHG7KHPHPEHUVRIWKH FRQVXOWDQWVHOHFWLRQFRPPLWWHHPXVWHYDOXDWHHDFKSURSRVDODFFRUGLQJWRWKHWHFKQLFDOFULWHULD OLVWHGLQWKH5)30LQLPXPRIWKUHHSURSRVDOVPXVWEHUHFHLYHGDQGHYDOXDWHG,IRQO\WZR SURSRVDOVDUHUHFHLYHGDMXVWLILFDWLRQPXVWEHGRFXPHQWHGWRSURFHHGZLWKWKHSURFXUHPHQW 7KHMXVWLILFDWLRQVKRXOGVWDWHWKDWWKHVROLFLWDWLRQGLGQRWFRQWDLQFRQGLWLRQVRUUHTXLUHPHQWV WKDWDUELWUDULO\OLPLWHGFRPSHWLWLRQSHU&)5 D  LY  ' DQGFRPSHWLWLRQLVGHWHUPLQHG WREHLQDGHTXDWHDQGLWLVQRWIHDVLEOHRUSUDFWLFDOWRUHFRPSHWHXQGHUDQHZVROLFLWDWLRQSHU &)5 D  LLL & ,IRQO\RQHSURSRVDOLVUHFHLYHGD1RQ&RPSHWLWLYHSURFHVVPXVWEH MXVWLILHGDQGD3XEOLF,QWHUHVW)LQGLQJ 3,) PXVWEHGRFXPHQWHGDQGVLJQHGE\WKH'/$(,Q HLWKHUFDVHWKHUHDGYHUWLVHPHQWRIWKH5)3VKRXOGEHFRQVLGHUHGDVDQRSWLRQ 7KHFRPPLWWHHPXVWDOVRHYDOXDWHUHIHUHQFHFKHFNVDQGRWKHULQIRUPDWLRQJDWKHUHG LQGHSHQGHQWO\5HIHUHQFHFKHFNVVKDOOEHFRPSOHWHGDQGRWKHULQIRUPDWLRQJDWKHUHGEHIRUHWKH LQWHUYLHZVDUHFRQGXFWHG,IQHFHVVDU\WKHUHVXOWVRIWKHUHIHUHQFHFKHFNVRURWKHULQIRUPDWLRQ PD\EHGLVFXVVHGZLWKWKHKLJKHVWUDQNHGTXDOLILHGFRQVXOWDQWVDWWKHLQWHUYLHZV WĂŐĞϮϵŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 72 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 'HYHORS)LQDO5DQNLQJDQG1RWLI\&RQVXOWDQWVRI5HVXOWV 7KHVHOHFWLRQFRPPLWWHHGLVFXVVHVDQGGRFXPHQWVWKHVWUHQJWKVDQGZHDNQHVVHVRIHDFK SURSRVDOLQWHUYLHZVWKHWKUHHRUPRUHKLJKHVWUDQNHGFRQVXOWDQWV VKRUWOLVWHG DQGGHYHORSVD ILQDOUDQNLQJRIWKHKLJKHVWUDQNHGFRQVXOWDQWV$OOFRQVXOWDQWVWKDWVXEPLWWHGSURSRVDOVPXVW EHLQIRUPHGDERXWWKHILQDOUDQNLQJRIFRQVXOWDQWV,WLVLPSRUWDQWWKDWDOOFRPSHWLQJ FRQVXOWDQWVUHFHLYHWKHVDPHLQIRUPDWLRQ 0RVWFRQVXOWDQWVZLOOUHTXHVWLQIRUPDWLRQDVWRZK\WKH\ZHUHQRWWKHKLJKHVWUDQNHG 7KHUHIRUHWKHVHOHFWLRQFRPPLWWHHVKRXOGNHHSQRWHVDVWRZK\DSDUWLFXODUFRQVXOWDQWZDVQRW VHOHFWHG:KHQDFRQVXOWDQWUHTXHVWVGHEULHILQJWKHUHDVRQVIRUQRWEHLQJVHOHFWHGPXVWEH REMHFWLYHUHDVRQV7KHFRQVXOWDQWVKRXOGQRWEHFRPSDUHGWRRWKHUVDQGVKRXOGQRWEHSURYLGHG ZLWKLQIRUPDWLRQDERXWRWKHUFRQVXOWDQWVGXULQJWKLVGHEULHILQJ1RUPDOO\WKH&RQWUDFW $GPLQLVWUDWRUGRHVWKHGHEULHILQJKRZHYHUDQ\PHPEHURIWKHVHOHFWLRQFRPPLWWHHPD\EH GHVLJQDWHGWRGRWKHGHEULHILQJ 1HJRWLDWH&RQWUDFWZLWK7RS5DQNHG&RQVXOWDQW &RVWSURSRVDO IRUERWK3ULPHDQGDOO6XEFRQVXOWDQW DQGFRQWUDFWDXGLWDQGUHYLHZGRFXPHQWV VXFKDVExhibit 10-K: Consultant Certification of Contract Costs and financial Management System RI &RVWVDQG)LQDQFLDO0DQDJHPHQW6\VWHPDQGExhibit 10-A: A&E Consultant Financial Document Review Request and Checklist, ZKLFKHYHULVDSSOLFDEOH VHHSection 10.1.3: A&E Consultant Audit and Review Process VKRXOGEHVXEPLWWHGLQDVHSDUDWHVHDOHGHQYHORSH7\SLFDOO\WKHFRVW SURSRVDOVDUHVXEPLWWHGE\WKHVKRUWOLVWHGFRQVXOWDQWVRQO\DWWLPHRILQWHUYLHZ+RZHYHULI WLPHLVRIWKHHVVHQFHDQGLWFDQEHMXVWLILHGRULIQRLQWHUYLHZVDUHSODQQHGWKHFRVWSURSRVDO FDQEHUHTXHVWHGIURPDOOFRQVXOWDQWVZLWKWKHLUWHFKQLFDOSURSRVDO 7KHFRVWSURSRVDOIRUWKHPRVWTXDOLILHGFRQVXOWDQWZLOOEHRSHQHGDQGXVHGWREHJLQ QHJRWLDWLRQV,IDJUHHPHQWFDQQRWEHUHDFKHGWKHQQHJRWLDWLRQVSURFHHGVWRWKHQH[WPRVW TXDOLILHGFRQVXOWDQW(DFKFRQVXOWDQW·VFRVWSURSRVDOPXVWUHPDLQVHDOHGXQWLOQHJRWLDWLRQV FRPPHQFHZLWKWKDWSDUWLFXODUFRQVXOWDQW7KHJRDORIQHJRWLDWLRQVLVWRDJUHHRQDILQDO FRQWUDFWWKDWGHOLYHUVWKHVHUYLFHVRUSURGXFWVUHTXLUHGDWDIDLUDQGUHDVRQDEOHFRVWWRWKHORFDO DJHQF\$WWKHFRPSOHWLRQRIVXFFHVVIXOFRVWQHJRWLDWLRQVDOOUHPDLQLQJVHDOHGHQYHORSHV FRQWDLQLQJFRVWSURSRVDOVVKDOOEHUHWXUQHGWRFRQVXOWDQWV &RVWSURSRVDOVLQHOHFWURQLFIRUPVKDOOEHVXEPLWWHGVHSDUDWHO\IURPWKH5)3DQGFRQWDLQHGLQD VHFXUHGDWDEDVHWKDWLVLQDFFHVVLEOHWRWKHPHPEHUVLQYROYHGLQWKH$ (FRQVXOWDQWFRQWUDFW SURFXUHPHQWSURFHVV2QO\WKHFRVWSURSRVDORIWKHPRVWTXDOLILHGFRQVXOWDQWZLOOEHUHTXHVWHG WREHVHQWWRWKHPHPEHUV&RVWSURSRVDOVRIXQVXFFHVVIXOFRQVXOWDQWVDUHFRQILGHQWLDODQGVKDOO QRWEHRSHQHGE\WKHORFDODJHQF\RUDQ\SULYDWHHQWLW\WKDWWKHORFDODJHQF\XVHVWRVWRUHWKH FRVWSURSRVDOV$Q\FRQFHDOHGFRVWSURSRVDOVRIWKHXQVXFFHVVIXOFRQVXOWDQWVPXVWEHUHWXUQHG XQRSHQHGRUSURSHUO\GLVSRVHGRILQDFFRUGDQFHZLWKWKHORFDODJHQF\·VZULWWHQSROLFLHVDQG SURFHGXUHV 7KHLQGHSHQGHQWFRVWHVWLPDWHGHYHORSHGE\WKHORFDODJHQF\LQDGYDQFHRIUHTXHVWLQJDFRVW SURSRVDOIURPWKHWRSUDQNHGFRQVXOWDQWLVDQLPSRUWDQWEDVLVDQGWRROIRUQHJRWLDWLRQVRU WHUPLQDWLQJXQVXFFHVVIXOQHJRWLDWLRQVZLWKWKHPRVWTXDOLILHGFRQVXOWDQW,WHPVQHFHVVDU\IRU WKHLQGHSHQGHQWFRVWHVWLPDWHLQFOXGHKRXUVGHWDLOHGZRUNGLUHFWODERUFRVWVLQGLUHFWODERU WĂŐĞϯϬŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 73 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ FRVWVRWKHUGLUHFWFRVWVDQGSURILWIHH$JHQFLHVPXVWUHWDLQGRFXPHQWDWLRQRIKRZWKHFRVW HVWLPDWHZDVGHYHORSHG,WFDQEHUHYLVHGLIQHHGHGIRUXVHLQQHJRWLDWLRQVZLWKWKHQH[WPRVW TXDOLILHGFRQVXOWDQW$FRQWUDFWDXGLWDQGUHYLHZPD\EHUHTXLUHG VHHSection 10.1.3: A&E Consultant Audit and Review Process LQWKLVFKDSWHU /RFDODJHQF\&RQWUDFW$GPLQLVWUDWRU HQVXUHVWKDWDOOUHTXLUHGGRFXPHQWDWLRQVDUHSURYLGHGWR&DOWUDQV,2$,ZLWKLQGD\VRI ZULWWHQUHTXHVWLQFOXGLQJDOOGRFXPHQWVIRUD)LQDQFLDO5HYLHZLIDSSOLFDEOH &DOWUDQV,2$, ZLOOQRWSURFHHGZLWKD)LQDQFLDO'RFXPHQW5HYLHZXQWLODOOUHTXLUHGGRFXPHQWDWLRQLV FRPSOHWHGFRUUHFWO\DQGVXEPLWWHG 1HJRWLDWLRQVVKRXOGEHILQDOL]HGDIWHUDGGUHVVLQJDOO GHILFLHQFLHVQRWHGLQWKH&DOWUDQV,2$,)LQDQFLDO5HYLHZ/HWWHULIDSSOLFDEOH $QLQGLUHFWFRVW DXGLWPD\EHSHUIRUPHGZLWKLQWKHUHFRUGUHWHQWLRQSHULRGRIWKHFRQWUDFW ,WHPVW\SLFDOO\QHJRWLDWHGLQFOXGH x:RUNSODQ x6FKHGXOHDQGGHDGOLQHV IRUGHOLYHUDEOHVDQGILQDOGXUDWLRQRIFRQWUDFW  x3URGXFWVWREHGHOLYHUHG x&ODVVLILFDWLRQZDJHUDWHVDQGH[SHULHQFHOHYHORISHUVRQQHOWREHDVVLJQHG x&RVWLWHPVSD\PHQWVDQGIHHV )HHLVUHTXLUHGWREHQHJRWLDWHGDVDVHSDUDWH HOHPHQW x+RXUVOHYHORIHIIRUWE\WDVNDQGRUFODVVLILFDWLRQ 7KHFRQVXOWDQW·V,&5LVQRWDQHJRWLDEOHLWHP$ORZHUUDWHFDQQRWEHQHJRWLDWHGE\WKHORFDO DJHQF\7KHORFDODJHQF\DQGWKHFRQVXOWDQWZLOODJUHHRQWKHILQDOFRVWSURSRVDODQG LQFRUSRUDWHLQWRILQDOFRQWUDFW5HWDLQDOOGRFXPHQWDWLRQUHODWHGWRQHJRWLDWLRQV %HIRUHH[HFXWLQJWKHFRQVXOWDQWFRQWUDFWWKHORFDODJHQF\PXVWUHYLHZFRQWUDFWWRHQVXUHWKDWDOO IHGHUDODQGVWDWHUHTXLUHPHQWVKDYHEHHQPHW VHHExhibit 10-C: A&E Consultant Contract Reviewers Checklist DQGDGMXVWPHQWRUGHQLDORI,&5DVLGHQWLILHGLQWKH)LQDQFLDO5HYLHZ/HWWHU KDVEHHQLQFOXGHGLQWKHILQDOFRVWSURSRVDOLIDSSOLFDEOH 3ULRUWRFRQWUDFWDZDUGWKHORFDODJHQF\PXVWVXEPLWDFRPSOHWHGExhibit 10-C VLJQHGE\WKH &RQWUDFW$GPLQLVWUDWRUIRUDOOQHZRUDPHQGHGIHGHUDOIXQGHG$ (FRQVXOWDQWFRQWUDFWVWR DHRYHUVLJKW#GRWFDJRYIRU&DOWUDQVUHYLHZDQGDFFHSWDQFH,IWKHUHDUHDQ\FKDQJHVWRWKH FRQWUDFWDIWHU&DOWUDQVDFFHSWDQFHRIExhibit 10-CWKHORFDODJHQF\PXVWQRWLI\&DOWUDQVDQG SURYLGHDFRS\RIDQXSGDWHGExhibit 10-C DQGDOOFRQWUDFWDPHQGPHQWVWR DHRYHUVLJKW#GRWFDJRY([HFXWLRQRIDQ$ (FRQVXOWDQWFRQWUDFWZLWKRXW&DOWUDQVDFFHSWDQFH PD\UHVXOWLQLQHOLJLELOLW\IRUUHLPEXUVHPHQW 6XEPLVVLRQRIExhibit 10-C WR&DOWUDQV+4IRU DFFHSWDQFHLVQRWUHTXLUHGIRUQRQ$ (FRQVXOWDQWFRQWUDFWV  &2168/7$176(/(&7,2186,1*7+(21(67(35)40(7+2' 7KH5)4PHWKRGLVXVHGZKHQWKHVHUYLFHVEHLQJSURFXUHGDUHVSHFLDOL]HGRUWKHVFRSHRIZRUN LVGHILQHGEURDGO\DQGPD\LQFOXGHPXOWLSOHSURMHFWV WĂŐĞϯϭŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 74 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ $SSRLQW&RQVXOWDQW6HOHFWLRQ&RPPLWWHH $FRQVXOWDQWVHOHFWLRQFRPPLWWHHZLWKDPLQLPXPRIWKUHHPHPEHUVLVDSSRLQWHGDWWKH EHJLQQLQJRIWKHFRQVXOWDQWVHOHFWLRQSURFHVV7KHFRPPLWWHHUHYLHZVDQGVFRUHVWKHPDWHULDOV VXEPLWWHGE\FRQVXOWDQWVLQUHVSRQVHWRWKH5)4GHYHORSVDVKRUWOLVWRITXDOLILHGFRQVXOWDQWV LQWHUYLHZVWKRVHFRQVXOWDQWVDQGGHYHORSVDILQDOUDQNLQJRIWKHPRVWTXDOLILHGFRQVXOWDQWV 5HSUHVHQWDWLRQRQWKHFRPPLWWHHLQFOXGHVWKH&RQWUDFW$GPLQLVWUDWRUDQGVXEMHFWPDWWHU H[SHUWVIURPWKHSURMHFW·VIXQFWLRQDODUHD7KHPHPEHUVVKRXOGEHIDPLOLDUZLWKWKHVFRSHRI ZRUNWREHFRQWUDFWHGRXWDQGZLWKWKHORFDODJHQF\VWDQGDUGVWKDWZLOOEHXVHGLQWKHFRQWUDFW 3DUWLFLSDWLRQE\D&DOWUDQVGLVWULFWUHSUHVHQWDWLYHLVDWWKHRSWLRQRIWKHORFDODJHQF\DQGVXEMHFW WRWKHDYDLODELOLW\RIWKH'/$(VWDII&DOWUDQVSDUWLFLSDWLRQRQWKHLQWHUYLHZSDQHOGRHVQRW UHOLHYHWKHORFDODJHQF\RILWVUHVSRQVLELOLW\WRHQVXUHWKDWSURSHUSURFXUHPHQWSURFHGXUHVDUH IROORZHGDQGDOOUHTXLUHPHQWVDUHPHW /RFDODJHQF\&RQWUDFW$GPLQLVWUDWRUHQVXUHVWKDWDOOFRPPLWWHHPHPEHUVPHHWWKHFRQIOLFWRI LQWHUHVWUHTXLUHPHQWV &)5 E\FRPSOHWLQJDQGVLJQLQJDFRQIOLFWRILQWHUHVWVWDWHPHQW SULRUWRVHOHFWLRQSURFHVVLQLWLDWLRQ$VDPSOHFRQIOLFWRILQWHUHVWIRUPLVSURYLGHGLQExhibit 10- T: Panel Member Conflict of Interest & Confidentiality Statement. 'HYHORS7HFKQLFDO&ULWHULDIRU(YDOXDWLRQRI4XDOLILFDWLRQV 7KH&RQWUDFW$GPLQLVWUDWRULVUHVSRQVLEOHIRUGHYHORSLQJWKHWHFKQLFDOFULWHULDDQGWKHLU UHODWLYHLPSRUWDQFHZKLFKDUHXVHGWRHYDOXDWHDQGUDQNWKHFRQVXOWDQWTXDOLILFDWLRQV7KH FULWHULDDQGUHODWLYHZHLJKWVPXVWEHLQFOXGHGLQWKH5)4DQGWKHVDPHFULWHULDDQGUHODWLYH ZHLJKWVPXVWEHXVHGLQWKHHYDOXDWLRQVKHHWV)DLOXUHWRLQFOXGHFULWHULDDQGUHODWLYHZHLJKWV DQGWRXVHWKHVDPHFULWHULDDQGZHLJKWVGXULQJWKHHYDOXDWLRQZLOOUHVXOWLQWKHFRQWUDFWFRVWV EHLQJLQHOLJLEOHIRUIHGHUDORUVWDWHUHLPEXUVHPHQWExhibit 10-B: Suggested Consultant Evaluation Sheet LVDUHFRPPHQGHGHYDOXDWLRQVKHHWZLWKFULWHULDDQGUDWLQJSRLQWVIRU$ (FRQVXOWDQWV ZKHUHFRVWLVQRWXVHGDVDUDWLQJIDFWRU7KLVIRUPDWLVQRWPDQGDWRU\EXWLWLVUHFRPPHQGHGLQ WKHLQWHUHVWRIGHYHORSLQJFRQVLVWHQF\DPRQJWKHKXQGUHGVRIDJHQFLHVDQGFRQVXOWDQWV RSHUDWLQJLQWKHVWDWH7KHORFDODJHQF\VKRXOGFRQVXOWZLWKWKH'/$(EHIRUHPDNLQJPDMRU FKDQJHVWRWKHVXJJHVWHGDSSURDFK 'HYHORS6FKHGXOHIRU&RQVXOWDQW6HOHFWLRQ %HIRUHDFRQWUDFWLVDGYHUWLVHGWKH&RQWUDFW$GPLQLVWUDWRUFRPSOHWHVDFRQWUDFWSURFXUHPHQW VFKHGXOHLQFOXGLQJNH\GDWHVIRUFRQVXOWDQWVHOHFWLRQDFWLYLWLHV7KH&RQWUDFW$GPLQLVWUDWRU VKRXOGFRQILUPWDUJHWGDWHVZLWKDOOVHOHFWLRQFRPPLWWHHPHPEHUVEHIRUHFRPSOHWLQJWKH VFKHGXOH 3UHSDUH5)4 $VDPLQLPXPWKH5)4JHQHUDOO\LQFOXGHVWKHIROORZLQJ x*HQHUDOGHVFULSWLRQRIWKHVHUYLFHVRUSURMHFW V  x6FRSHRIZRUN x6FKHGXOHRIZRUN LQFOXGLQJFRQWUDFWEHJLQDQGHQGGDWHV  WĂŐĞϯϮŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 75 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ x0HWKRGRISD\PHQWDQGFRVWSURSRVDOUHTXLUHPHQWV7KHFRVWSURSRVDOLV VXEPLWWHGLQDVHSDUDWHVHDOHGHQYHORSH6HHExhibit 10-H: Sample Cost Proposal IRUVDPSOHFRVWSURSRVDOIRUPDWV x&RQWUDFWDXGLWDQGUHYLHZSURFHVVUHTXLUHPHQWV VHHSection 10.1.3: A&E Consultant Audit and Review Process  x6WDWHPHQWRI4XDOLILFDWLRQ 624 IRUPDWDQGUHTXLUHGFRQWHQWWREHVXEPLWWHG x0HWKRGDQGFULWHULDDQGZHLJKWVIRUVHOHFWLRQ x$'%(FRQWUDFWJRDOLVVSHFLILHGLQWKHVROLFLWDWLRQ VHHExhibit 10-I: Notice to Proposers DBE Information LIDIHGHUDODLGFRQWUDFW x&RQVXOWDQWVDFWLQJLQDPDQDJHPHQWVXSSRUWUROHUHTXLUHPHQWVExhibit 10-U: Consultant in Management Support Role Conflict of Interest and Confidentiality Statement3URWHVWSURFHGXUHVDQGGLVSXWHUHVROXWLRQSURFHVVSHU&)53DUW  N  7KH5)4VSHFLILHVWKHFRQWHQWRIWKH624WKHQXPEHURIFRSLHVUHTXLUHGGXHGDWHPDLOLQJ DGGUHVVDQGDSK\VLFDODGGUHVVZKHUHWKHVXEPLWWDOVPD\EHKDQGGHOLYHUHGLIGLIIHUHQWIURP WKHPDLOLQJDGGUHVV7ZRWRIRXUZHHNVLVXVXDOO\DOORZHGEHWZHHQWKHWLPHWKH5)4LV SXEOLVKHGDQGWLPHWKDW624VPXVWEHVXEPLWWHG0RUHWLPHPD\EHUHTXLUHGIRUFRPSOH[ FRQWUDFWVRUVFRSHRIZRUN ,WHPVW\SLFDOO\UHTXLUHGLQDVWDWHPHQWRITXDOLILFDWLRQLQFOXGH x4XDOLILFDWLRQVRINH\SHUVRQQHO LQFOXGLQJFRQVXOWDQWSURMHFWPDQDJHU SURSRVHGIRU WKHFRQWUDFW.H\WHDPPHPEHUVLGHQWLILHGLQWKHRULJLQDOSURSRVDOFRVWSURSRVDO VKDOOQRWFKDQJH EHGLIIHUHQWWKDQ LQWKHH[HFXWHGFRQWUDFW x6WDIIUHVXPHV x5HODWHGSURMHFWVWKDWNH\SHUVRQQHOKDYHZRUNHGRQ x4XDOLILFDWLRQVH[SHULHQFHRIWKHILUP x2UJDQL]DWLRQDOFKDUW x)RUHFDVWRU6FKHGXOHRIZRUN x&RQVXOWDQW'%(&RPPLWPHQWGRFXPHQWVHHExhibit 10-O1: Consultant Proposal DBE Commitment x5HIHUHQFHV )LQDQFLDO0DQDJHPHQWDQG$FFRXQWLQJ6\VWHP5HTXLUHPHQWV 7KHORFDODJHQF\PXVWHQVXUHWKDW&RQVXOWDQWFRQWUDFWVROLFLWDWLRQDQGDGYHUWLVLQJGRFXPHQWV 5)4V FOHDUO\VSHFLI\WKDWFRQWUDFWVVKDOOQRWEHDZDUGHGWRDFRQVXOWDQWZLWKRXWDQDGHTXDWH ILQDQFLDOPDQDJHPHQWDQGDFFRXQWLQJV\VWHPDVUHTXLUHGE\&)53DUW&)53DUW DQG&)53DUW7KHORFDODJHQF\PXVWHQVXUHWKHVHOHFWHGFRQVXOWDQWVKDYHDGHTXDWH ILQDQFLDOPDQDJHPHQWV\VWHPVDVUHTXLUHGE\WKHDSSOLFDEOHIHGHUDOUHJXODWLRQV WĂŐĞϯϯŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 76 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ $GYHUWLVHIRU&RQVXOWDQWV 7KHVROLFLWDWLRQSURFHVVIRUFRQVXOWDQWVHUYLFHVVKDOOEHE\SXEOLFDGYHUWLVHPHQWRUDQ\RWKHU SXEOLFIRUXPRUPHWKRGWKDWDVVXUHVTXDOLILHGLQ6WDWHDQGRXWRI6WDWHFRQVXOWDQWDUHJLYHQD IDLURSSRUWXQLW\WREHFRQVLGHUHGIRUDZDUGRIFRQWUDFW7KH5)4PXVWFRQWDLQVXIILFLHQWSURMHFW ZRUNLQIRUPDWLRQVRWKDWLQWHUHVWHGFRQVXOWDQWVFDQVXEPLWDQDSSURSULDWH624 $GYHUWLVHPHQWVIRU5)4PD\WDNHRQHRIWZRDSSURDFKHV7KHPRVWFRPPRQLVDQ DGYHUWLVHPHQWRUSXEOLFDWLRQRIWKH5)4LQDPDMRUQHZVSDSHURIJHQHUDOFLUFXODWLRQWHFKQLFDO SXEOLFDWLRQRIZLGHVSUHDGFLUFXODWLRQSURIHVVLRQDODVVRFLDWLRQVDQGVRFLHWLHVUHFRJQL]HG'%( RUJDQL]DWLRQVZHEKRVWLQJRUFOHDULQJKRXVHVNQRZQIRUSRVWLQJFRQWUDFWVROLFLWDWLRQVVXFKDV %LG6\QF3ODQHW%LGVRUSRVWLQJWKH5)4RQRWKHUZLGHO\XVHGZHEVLWHV7RGRFXPHQWZHEVLWH SRVWLQJVWKHORFDODJHQF\VKRXOGUHWDLQFRSLHVRIVFUHHQVKRWVGLVSOD\LQJWKHSRVWHGEHJLQHQG GDWHV ,QWKHVHFRQGDSSURDFKWKHORFDODJHQF\DGYHUWLVHVWKHDYDLODELOLW\RIWKH5)4LQDPDMRU QHZVSDSHURIJHQHUDOFLUFXODWLRQWHFKQLFDOSXEOLFDWLRQVRIZLGHVSUHDGFLUFXODWLRQSURIHVVLRQDO DVVRFLDWLRQVDQGVRFLHWLHVUHFRJQL]HG'%(RUJDQL]DWLRQVRUWKURXJKDZHEKRVWLQJRUFOHDULQJ KRXVHVNQRZQIRUSRVWLQJFRQWUDFWVROLFLWDWLRQVVXFKDV%LG6\QFRU3ODQHW%LGVDQGUHTXHVWVWKDW LQWHUHVWHGFRQVXOWDQWVVHQGDOHWWHURILQWHUHVWWRWKHORFDODJHQF\IRUWKH5)47KH5)4VVKDOO WKHQEHVHQWWRWKRVHILUPVZKRLQGLFDWHGLQWHUHVWLQWKH5)4,QVRPHFDVHVLWPD\EHGHVLUDEOH WRDGYHUWLVHQDWLRQZLGHIRUDSDUWLFXODUSURMHFWRUVHUYLFH7KLVDSSURDFKSURYLGHVDUHJLVWU\IRU ILUPVZKRUHFHLYHGWKH5)4DQGWKHUHIRUHIDFLOLWDWHVWKHEURDGFDVWRIDQ\UHYLVLRQVRUDGGHQGD WRWKH5)4LIQHFHVVDU\ ,VVXH3XEOLVK5)4 7KHORFDODJHQF\VKDOOSXEOLVKWKH5)4RQOLQHDQGDOVRLVVXHWKH5)4WRDOOFRQVXOWDQWV UHVSRQGLQJWRQHZVSDSHUDGYHUWLVHPHQW7KHORFDODJHQF\VKDOONHHSDUHFRUGRIDOOFRQVXOWDQWV WKDWKDYHGRZQORDGHGWKH5)4RQOLQHDVZHOODVWKRVHUHFHLYLQJDQ5)4WKURXJKRWKHUPHDQV WRHQVXUHWKDWDQ\LQTXLU\UHVSRQVHVDGGHQGXPVRUDPHQGPHQWVWRWKH5)4DUHJLYHQWRDOO FRQVXOWDQWVWKDWUHFHLYHGWKH5)4 5HFHLYH(YDOXDWH6WDWHPHQWVRI4XDOLILFDWLRQVDQG'HYHORS6KRUWOLVW 7KHILUVWVWHSLQWKHHYDOXDWLRQSURFHVVLVWRGHWHUPLQHWKDWHDFK624FRQWDLQVDOOIRUPVDQG RWKHULQIRUPDWLRQUHTXLUHGE\WKH5)42WKHUZLVHWKHVXEPLWWDOVPD\EHFRQVLGHUHG QRQUHVSRQVLYHDQGUHMHFWHGZLWKRXWHYDOXDWLRQ/DWHVXEPLWWDOVVXEPLWWDOVWRWKHZURQJ ORFDWLRQDQGVXEPLWWDOVZLWKLQDGHTXDWHFRSLHVDUHFRQVLGHUHGQRQUHVSRQVLYHDQGVKDOOEH UHMHFWHG6XEPLWWDORIDGGLWLRQDOLQIRUPDWLRQDIWHUWKHGXHGDWHVKDOOQRWEHDOORZHG 'RFXPHQWDWLRQRIZKHQHDFKSURSRVDOZDVUHFHLYHGPXVWEHPDLQWDLQHGLQWKHSURMHFWILOHV &RSLHVRIGDWHVWDPSHGHQYHORSHFRYHUVRUER[WRSVDUHUHFRPPHQGHG 0LQLPXPRIWKUHHSURSRVDOVPXVWEHUHFHLYHGDQGHYDOXDWHG,IRQO\WZRSURSRVDOVDUH UHFHLYHGDMXVWLILFDWLRQPXVWEHGRFXPHQWHGWRSURFHHGZLWKWKHSURFXUHPHQW,IRQO\RQH SURSRVDOLVUHFHLYHGD1RQ&RPSHWLWLYHSURFHVVPXVWEHMXVWLILHGDQGD3XEOLF,QWHUHVW)LQGLQJ 3,) PXVWEHGRFXPHQWHGDQGVLJQHGE\WKH'/$(,QHLWKHUFDVHWKHUHDGYHUWLVHPHQWRIWKH 5)3VKRXOGEHFRQVLGHUHGDVDQRSWLRQ WĂŐĞϯϰŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 77 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 7KHFRQVXOWDQWVHOHFWLRQFRPPLWWHHUHYLHZVWKHVXEPLWWHG624DFFRUGLQJWRWKHSXEOLVKHG HYDOXDWLRQFULWHULDDQGZHLJKWLQJIDFWRUV7KHFRPPLWWHHPDNHVDQLQGHSHQGHQWUDQGRPFKHFN RIRQHRUPRUHRIWKHFRQVXOWDQW·VUHIHUHQFHV7KLVFKHFNDSSOLHVWRPDMRUVXEFRQVXOWDQWVDOVR 7KHFRPPLWWHHHVWDEOLVKHVDVKRUWOLVWRIFRQVXOWDQWVZKRDUHFRQVLGHUHGWREHEHVWTXDOLILHGWR SHUIRUPWKHFRQWUDFWZRUN7KHVKRUWOLVWLQFOXGHVHQRXJKTXDOLILHGFRQVXOWDQWVWRHQVXUHWKDWDW OHDVWWKUHHFRQVXOWDQWVDUHLQWHUYLHZHG 1RWLI\&RQVXOWDQWVRI6KRUWOLVW $OOFRQVXOWDQWVWKDWVXEPLWWHGDQ624PXVWEHQRWLILHGRIWKHUHVXOWVRIWKHUHYLHZ7KH QRWLILFDWLRQDOVRLGHQWLILHVWKRVHFRQVXOWDQWV VKRUWOLVW WKDWZLOOEHUHTXHVWHGWRDWWHQG LQWHUYLHZV0RVWFRQVXOWDQWVZLOOUHTXHVWLQIRUPDWLRQDVWRZK\WKH\ZHUHQRWSODFHGRQWKH VKRUWOLVW7KHUHIRUHWKHVHOHFWLRQFRPPLWWHHVKRXOGNHHSQRWHVZK\DSDUWLFXODUFRQVXOWDQWZDV QRWVHOHFWHGIRUWKHVKRUWOLVW:KHQDFRQVXOWDQWUHTXHVWVDGHEULHILQJWKHUHDVRQVJLYHQIRUQRW EHLQJVHOHFWHGPXVWEHREMHFWLYHUHDVRQV&RQVXOWDQWVVKRXOGQRWEHFRPSDUHGZLWKHDFKRWKHU GXULQJWKHGHEULHILQJ1RUPDOO\WKH&RQWUDFW$GPLQLVWUDWRUGRHVWKHGHEULHILQJKRZHYHUDQ\ PHPEHURIWKHVHOHFWLRQFRPPLWWHHPD\EHGHVLJQDWHGWRGRWKHGHEULHILQJ ,QWHUYLHZ7RS5DQNHG&RQVXOWDQWV (DFKFRQVXOWDQWWREHLQWHUYLHZHGLVJLYHQDFRS\RIWKHGUDIWRIWKHSURSRVHGFRQWUDFWGHILQLQJ WKHGHWDLOHGVFRSHRIZRUNDQGRUGHVFULSWLRQRIUHTXLUHGVHUYLFHVDQGRWKHULQIRUPDWLRQ 7KLVVKRXOGEHVHQWZLWKWKHLQLWLDOQRWLILFDWLRQRIWKHLQWHUYLHZ %HWZHHQWKHWLPHRIWKHQRWLILFDWLRQRIWKHVKRUWOLVWDQGLQWHUYLHZVWKHORFDODJHQF\PD\DQVZHU DQ\TXHVWLRQVFRQFHUQLQJWKHVFRSHRIZRUNWREHFRQWUDFWHGRXWLIQRWGRQHHDUOLHUGXULQJWKH VROLFLWDWLRQ,QDGGLWLRQWKHORFDODJHQF\PD\FRQGXFWDGGLWLRQDOUHIHUHQFHFKHFNVIRUHDFK FRQVXOWDQWWREHLQWHUYLHZHG&RQVXOWDQWVVKRXOGVXEPLWWKHLUTXHVWLRQVDERXWWKH5)4DQG UHFHLYHWKHLUDQVZHUVIURPWKHORFDODJHQF\LQZULWLQJ,WLVUHTXLUHGWKDWDOOFRQVXOWDQWVRQWKH VKRUWOLVWUHFHLYHWKHTXHVWLRQVDQGDQVZHUVDQGDUHJLYHQWKHVDPHLQIRUPDWLRQ 7KHFRPPLWWHHVKRXOGHYDOXDWHUHIHUHQFHFKHFNVDQGRWKHULQIRUPDWLRQWKDWLVJDWKHUHG LQGHSHQGHQWO\5HIHUHQFHFKHFNVVKDOOEHFRPSOHWHGDQGRWKHULQIRUPDWLRQJDWKHUHGEHIRUHWKH LQWHUYLHZVDUHFRQGXFWHG,IQHFHVVDU\WKHUHVXOWVRIWKHUHIHUHQFHFKHFNVDQGRWKHULQIRUPDWLRQ PD\EHGLVFXVVHGZLWKWKHFRQVXOWDQWDWWKHLQWHUYLHZ ,QWHUYLHZVDUHWREHVWUXFWXUHGDQGFRQGXFWHGLQDIRUPDOPDQQHU(DFKFRQVXOWDQWVKDOOEH DOORZHGWKHRSSRUWXQLW\WRPDNHDSUHVHQWDWLRQLIGHVLUHGKRZHYHUDWLPHOLPLWVKRXOGEH VSHFLILHG,QWHUYLHZTXHVWLRQVDUHSUHSDUHGLQDGYDQFH 7ZRW\SHVRITXHVWLRQVPD\EHDVNHG x4XHVWLRQVWKDWDUHWREHDVNHGRIDOOFRPSHWLQJFRQVXOWDQWVDQG x4XHVWLRQVUHODWLQJWRHDFKVSHFLILFFRQVXOWDQWEDVHGXSRQWKHUHIHUHQFHFKHFNV DQGWKHVWUHQJWKVDQGZHDNQHVVHVLGHQWLILHGGXULQJHYDOXDWLRQRIWKH624 7KHDJHQF\FDQUHTXHVWFRPSHWLQJFRQVXOWDQWVWREULQJDGGLWLRQDOLQIRUPDWLRQRUH[DPSOHVRI WKHLUZRUNWRWKHLQWHUYLHZVLIWKHDGGLWLRQDOLQIRUPDWLRQIDFLOLWDWHVWKHLQWHUYLHZRUHYDOXDWLRQ SURFHVV$GGLWLRQDOLQIRUPDWLRQUHTXHVWHGVKRXOGEHNHSWDWDPLQLPXPWKDWLVRQO\ WĂŐĞϯϱŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 78 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ LQIRUPDWLRQUHTXLUHGWRVHOHFWWKHPRVWTXDOLILHGFRQVXOWDQWIRUWKHFRQWUDFW7KHVHOHFWLRQ FRPPLWWHHRUORFDODJHQF\VKDOOQRWJDWKHUDGGLWLRQDOLQIRUPDWLRQFRQFHUQLQJWKHFRQVXOWDQWV DIWHUWKHLQWHUYLHZVDUHFRPSOHWHG 'HYHORS)LQDO5DQNLQJDQG1RWLI\&RQVXOWDQWVRI5HVXOWV $OOFRQVXOWDQWVLQWHUYLHZHGPXVWEHLQIRUPHGDERXWWKHILQDOUDQNLQJRIFRQVXOWDQWV,WLV LPSRUWDQWWKDWDOOFRPSHWLQJFRQVXOWDQWVUHFHLYHWKHVDPHLQIRUPDWLRQ 0RVWFRQVXOWDQWVZLOOUHTXHVWLQIRUPDWLRQDVWRZK\WKH\ZHUHQRWVHOHFWHGDVWKHPRVW TXDOLILHG7KHUHIRUHWKHVHOHFWLRQFRPPLWWHHVKRXOGNHHSQRWHVDVWRZK\DSDUWLFXODU FRQVXOWDQWZDVQRWVHOHFWHG:KHQDFRQVXOWDQWUHTXHVWVGHEULHILQJWKHUHDVRQVIRUQRWEHLQJ VHOHFWHGPXVWEHREMHFWLYH&RQVXOWDQWVVKRXOGQRWEHFRPSDUHGZLWKHDFKRWKHURUSURYLGHG ZLWKLQIRUPDWLRQDERXWRWKHUFRQVXOWDQWVGXULQJWKHGHEULHILQJ 1RUPDOO\WKH&RQWUDFW$GPLQLVWUDWRUGRHVWKHGHEULHILQJKRZHYHUDQ\PHPEHURIWKH VHOHFWLRQFRPPLWWHHPD\EHGHVLJQDWHGWRGRWKHGHEULHILQJ7KHQH[WWZRVHFWLRQVSURYLGH JXLGDQFHZKHQWKH5)4LVVROLFLWHGIRUVSHFLDOL]HGVHUYLFHVDQGDGGLWLRQDOLQIRUPDWLRQLV UHTXLUHGSULRUWRFRVWQHJRWLDWLRQVZLWKFRQVXOWDQW)RURQFDOOFRQWUDFWVVNLSWKHQH[WWZR VHFWLRQVDQGEHJLQ1HJRWLDWLRQSKDVH &RQGXFW6FRSLQJ0HHWLQJ 7KH&RQWUDFW$GPLQLVWUDWRUPHHWVZLWKWKHILUVWUDQNHGFRQVXOWDQW·VSURMHFWPDQDJHUWRUHYLHZ WKHSURMHFWDQGWRHQVXUHWKDWWKHFRQVXOWDQWKDVDFRPSOHWHXQGHUVWDQGLQJRIWKHZRUNWKDWLV UHTXLUHG7KHFRQVXOWDQWLVVKRZQDVPXFKPDWHULDODVLVDYDLODEOHUHJDUGLQJWKHSURMHFW$Q\ WHFKQLFDOTXHVWLRQVUHJDUGLQJWKHSURMHFWDUHDQVZHUHGIRUWKHFRQVXOWDQW 5HTXHVW&RVW3URSRVDO 7KHILUVWUDQNHGFRQVXOWDQWLVDVNHGWRSURYLGHDFRVWSURSRVDOWRSHUIRUPWKHZRUNGHVFULEHGLQ WKHGUDIWFRQWUDFWDQGGLVFXVVHGDWWKHVFRSLQJPHHWLQJ7KHZRUNLVWREHSHUIRUPHGDFFRUGLQJ WRWKHFRQGLWLRQVGHVFULEHGLQWKHGUDIWFRQWUDFWXVLQJWKHSD\PHQWPHWKRGGHVFULEHGWKHUHLQ $OWHUQDWLYHO\LIWLPHLVRIWKHHVVHQFHDQGLWFDQEHMXVWLILHGVHDOHGFRVWSURSRVDOVPD\EH UHTXHVWHGIURPDOORIWKHFRQVXOWDQWVRQWKHVKRUWOLVW ,IWKHFRQWUDFWLQYROYHVPRUHWKDQRQHSURMHFWWKHFRQVXOWDQWPXVWSURYLGHDVHSDUDWHFRVW SURSRVDOIRUHDFKSURMHFWLQDGGLWLRQWRDVXPPDU\FRVWSURSRVDOIRUWKHWRWDOFRQWUDFW,IWKH FRQWUDFWLQYROYHVPLOHVWRQHVWKHFRQVXOWDQWPXVWIXUQLVKDVHSDUDWHFRVWSURSRVDOIRUHDFK PLOHVWRQHZLWKDVXPPDU\FRVWSURSRVDOIRUWKHWRWDOFRVWV,IWKHFRQWUDFWLQYROYHV VXEFRQVXOWDQWVWKHSULPHFRQVXOWDQWPXVWLQFOXGHDVHSDUDWHFRVWSURSRVDOIRUHDFK VXEFRQVXOWDQW(DFKVXEFRQVXOWDQW·VFRVWSURSRVDOPXVWIROORZWKHVDPHIRUPDWDVWKHSULPH FRQVXOWDQW·VFRVWSURSRVDO 1HJRWLDWH&RQWUDFWZLWK7RS5DQNHG&RQVXOWDQW &RVWSURSRVDO IRUERWK3ULPHDQGDOO6XEFRQVXOWDQW DQGFRQWUDFWDXGLWDQGUHYLHZGRFXPHQWV VXFKDVExhibit 10-K: Consultant Certification of Contract Costs and Financial Management System DQGExhibit 10-A: A&E Consultant Financial Document Review Request and Checklist ZKLFKHYHU WĂŐĞϯϲŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 79 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ DSSOLFDEOH VHHSection 10.1.3: A&E Consultant Audit and Review Process ZLOOEHVXEPLWWHGLQD VHSDUDWHVHDOHGHQYHORSH7\SLFDOO\WKHFRVWSURSRVDOVDUHVXEPLWWHGE\WKHVKRUWOLVWHG FRQVXOWDQWVRQO\DWWLPHRILQWHUYLHZ+RZHYHULIWLPHLVRIWKHHVVHQFHDQGLWFDQEHMXVWLILHG RULIQRLQWHUYLHZVDUHSODQQHGWKHFRVWSURSRVDOFDQEHUHTXHVWHGIURPDOOFRQVXOWDQWZLWKWKHLU VWDWHPHQWVRITXDOLILFDWLRQ $IWHUWKHWRSUDQNHGFRQVXOWDQWVXEPLWVDVHDOHGFRVWSURSRVDOWKHORFDODJHQF\UHYLHZVWKH FRVWSURSRVDODQGFRPSDUHVLWZLWKWKHORFDODJHQF\·VFRQILGHQWLDOGHWDLOHGLQGHSHQGHQWFRVW HVWLPDWHDQGHQWHUVLQWRQHJRWLDWLRQV7KHJRDORIQHJRWLDWLRQLVWRDJUHHRQDILQDOFRQWUDFWWKDW GHOLYHUVWRWKHORFDODJHQF\WKHVHUYLFHVRUSURGXFWVUHTXLUHGDWDIDLUDQGUHDVRQDEOHFRVW7KH LQGHSHQGHQWFRVWHVWLPDWHGHYHORSHGE\WKHORFDODJHQF\LQDGYDQFHRIUHTXHVWLQJDFRVW SURSRVDOIURPWKHWRSUDQNHGFRQVXOWDQWLVDQLPSRUWDQWEDVLVDQGWRROIRUQHJRWLDWLRQV 1HJRWLDWLRQVVKRXOGFRPPHQFHZLWKWKHPRVWTXDOLILHGFRQVXOWDQW,IDJUHHPHQWRQDIDLUDQG UHDVRQDEOHSULFHFDQQRWEHUHDFKHGQHJRWLDWLRQVVKRXOGWKHQEHIRUPDOO\WHUPLQDWHG 1HJRWLDWLRQVWKHQSURFHHGWRWKHQH[WPRVWTXDOLILHGFRQVXOWDQWDQGVRRQ(DFKFRQVXOWDQW·V FRVWSURSRVDOPXVWUHPDLQVHDOHGXQWLOQHJRWLDWLRQVFRPPHQFHZLWKWKDWSDUWLFXODUFRQVXOWDQW $WWKHFRPSOHWLRQRIVXFFHVVIXOFRVWQHJRWLDWLRQVDOOUHPDLQLQJVHDOHGHQYHORSHVFRQWDLQLQJ FRVWSURSRVDOVVKDOOEHUHWXUQHGWRFRQVXOWDQWV &RVWSURSRVDOVLQHOHFWURQLFIRUPVKDOOEHVXEPLWWHGVHSDUDWHO\IURPWKH5)4DQGFRQWDLQHGLQD VHFXUHGDWDEDVHWKDWLVLQDFFHVVLEOHWRWKHPHPEHUVLQYROYHGLQWKH$ (FRQVXOWDQWFRQWUDFW SURFXUHPHQWSURFHVV2QO\WKHFRVWSURSRVDORIWKHPRVWTXDOLILHGFRQVXOWDQWZLOOEHUHTXHVWHG WREHVHQWWRWKHPHPEHUV&RVWSURSRVDOVRIXQVXFFHVVIXOFRQVXOWDQWVDUHFRQILGHQWLDODQGVKDOO QRWEHRSHQHGE\WKHORFDODJHQF\RUDQ\SULYDWHHQWLW\WKDWWKHORFDODJHQF\XVHVWRVWRUHWKH FRVWSURSRVDOV$Q\FRQFHDOHGFRVWSURSRVDOVRIWKHXQVXFFHVVIXOFRQVXOWDQWVPXVWEHUHWXUQHG XQRSHQHGRUSURSHUO\GLVSRVHGRIE\SHUPDQHQWO\GHOHWLQJWKHFRVWSURSRVDOVLQDFFRUGDQFH ZLWKORFDODJHQF\·VZULWWHQSROLFLHVDQGSURFHGXUHV $FRQWUDFWDXGLWDQGUHYLHZPD\EHUHTXLUHG VHHSection 10.1.3: A&E Consultant Audit and Review Process HDUOLHULQWKLVFKDSWHU /RFDODJHQF\&RQWUDFW$GPLQLVWUDWRULVUHVSRQVLEOHIRU WKHVXEPLWWDORIDOOUHTXLUHGGRFXPHQWDWLRQVWR&DOWUDQV,2$,LQDWLPHO\IDVKLRQLQFOXGLQJDOO GRFXPHQWVIRUD)LQDQFLDO5HYLHZLIDSSOLFDEOH&DOWUDQV,2$,ZLOOQRWSURFHHGZLWKD)LQDQFLDO 5HYLHZXQWLODOOUHTXLUHGGRFXPHQWDWLRQLVFRPSOHWHGFRUUHFWO\DQGVXEPLWWHG1HJRWLDWLRQV PD\EHFRPSOHWHGDIWHUUHFHLSWRIWKH&DOWUDQV,2$,)LQDQFLDO5HYLHZ/HWWHU$QLQGLUHFWFRVW DXGLWPD\EHSHUIRUPHGZLWKLQWKHUHFRUGUHWHQWLRQSHULRGRIWKHFRQWUDFW 7KHLWHPVW\SLFDOO\QHJRWLDWHGLQFOXGH x:RUNSODQ x6WDIILQJSODQ x6FKHGXOH LQFOXGLQJFRQWUDFWEHJLQDQGHQGGDWHV  x3URGXFWVWREHGHOLYHUHG x&ODVVLILFDWLRQZDJHUDWHVDQGH[SHULHQFHOHYHORISHUVRQQHOWREHDVVLJQHG WĂŐĞϯϳŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 80 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ x&RVWLWHPVSD\PHQWVDQGIHH )HHLVUHTXLUHGWREHQHJRWLDWHGDVDVHSDUDWH HOHPHQW 7KHFRQVXOWDQW·V,&5LVQRWDQHJRWLDEOHLWHP$ORZHUUDWHFDQQRWEHQHJRWLDWHGE\WKHORFDO DJHQF\)RURQFDOOFRQWUDFWVW\SLFDOO\DSULFHDJUHHPHQWLVUHDFKHGEDVHGRQVSHFLILFUDWHRI FRPSHQVDWLRQIRUWKHWHUPRIWKHFRQWUDFW7KHVXEVHTXHQWWDVNRUGHUV RUPLQLDJUHHPHQWVIRU LQGLYLGXDOSURMHFWZRUN LVQHJRWLDWHGEDVHGRQDFWXDOFRVWSOXVIHHRUOXPSVXPZKLFKLV GHULYHGIURPWKHZDJHUDWHVDJUHHGXSRQHDUOLHUIRUWKHRQFDOOFRQWUDFW %HIRUHH[HFXWLQJWKHFRQVXOWDQWFRQWUDFWWKHORFDODJHQF\PXVWUHYLHZFRQWUDFWWRHQVXUHWKDWDOO IHGHUDODQGVWDWHUHTXLUHPHQWVKDYHEHHQPHW VHHExhibit 10-C: A&E Consultant Contract Reviewers Checklist DQGUHFHLYH&DOWUDQV,2$,·V)LQDQFLDO5HYLHZDFFHSWDQFHOHWWHULI DSSOLFDEOH 3ULRUWRFRQWUDFWDZDUGWKHORFDODJHQF\PXVWVXEPLWDFRPSOHWHGExhibit 10-C VLJQHGE\WKH &RQWUDFW$GPLQLVWUDWRUIRUDOOQHZRUDPHQGHGIHGHUDOIXQGHG$ (FRQVXOWDQWFRQWUDFWVWR DHRYHUVLJKW#GRWFDJRYIRU&DOWUDQVUHYLHZDQGDFFHSWDQFH,IWKHUHDUHDQ\FKDQJHVWRWKH FRQWUDFWDIWHU&DOWUDQVDFFHSWDQFHRIExhibit 10-CWKHORFDODJHQF\PXVWQRWLI\&DOWUDQVDQG SURYLGHDFRS\RIDQXSGDWHGExhibit 10-C DQGDOOFRQWUDFWDPHQGPHQWVWR DHRYHUVLJKW#GRWFDJRY([HFXWLRQRIDQ$ (FRQVXOWDQWFRQWUDFWZLWKRXW&DOWUDQVDFFHSWDQFH PD\UHVXOWLQLQHOLJLELOLW\IRUUHLPEXUVHPHQW6XEPLVVLRQRIExhibit 10-C LVQRWUHTXLUHGIRUQRQ $ (FRQVXOWDQWFRQWUDFWV  &2168/7$176(/(&7,2186,1*7+(7:267(35)45)30(7+2' &RPELQHG5)4DQG5)3 6HOHFWLQJFRQVXOWDQWVXVLQJWKH7ZR6WHS5)45)3PHWKRGUHTXLUHVFRPELQLQJFHUWDLQVWHSV IURPHDFKRIWKHRWKHUWZRPHWKRGVSUHYLRXVO\GHVFULEHG7KHFRQVXOWDQWVDUHUDWHGEDVHGXSRQ ERWKWKHLUTXDOLILFDWLRQVDQGWKHLUWHFKQLFDOSURSRVDOV7KLVSURFXUHPHQWSURFHGXUHLQYROYHVD PXOWLSKDVHSURFHVVZLWKLVVXDQFHRIDUHTXHVWIRUTXDOLILFDWLRQV 5)4 ZKHUHE\UHVSRQGLQJ FRQVXOWDQWVDUHHYDOXDWHGDQGUDQNHGEDVHGRQTXDOLILFDWLRQVDQGDQ5)3LVWKHQSURYLGHGWR WKUHHRUPRUHRIWKHPRVWKLJKO\TXDOLILHGFRQVXOWDQWV $GLIIHUHQWSURFHVVPD\DOVREHXVHGWKDWLQFOXGHVDVVHVVLQJPLQLPXPTXDOLILFDWLRQVRI FRQVXOWDQWVWRSHUIRUPVHUYLFHVXQGHUJHQHUDOZRUNFDWHJRULHVRUDUHDVRIH[SHUWLVHWKURXJKD SUHTXDOLILFDWLRQSURFHVVZKHUHE\DQQXDOVWDWHPHQWVRITXDOLILFDWLRQVDQGSHUIRUPDQFHGDWDDUH HQFRXUDJHG7KHVHFRQVXOWDQWVDUHQRWUDQNHGDQGDQ5)3PXVWEHVXEPLWWHGWRWKHHQWLUHOLVW IRUHYDOXDWLRQDQGFRQVLGHUDWLRQ5HJDUGOHVVRIDQ\SURFHVVXWLOL]HGIRUSUHTXDOLILFDWLRQRI FRQVXOWDQWVRUIRUDQLQLWLDODVVHVVPHQWRIDFRQVXOWDQW VTXDOLILFDWLRQVXQGHUD5)4D5)3 VSHFLILFWRWKHSURMHFWWDVNRUVHUYLFHLVUHTXLUHGIRUHYDOXDWLRQRIDFRQVXOWDQW VVSHFLILF WHFKQLFDODSSURDFKDQGTXDOLILFDWLRQV 7KHLQLWLDOVWHSVLQWKLVPHWKRG XSWRWKHGHYHORSPHQWDQGQRWLILFDWLRQRIWKHVKRUWOLVW DUH VLPLODUWRWKHVWHSVIROORZHGZKHQXVLQJWKH2QH6WHS5)4PHWKRG$WWKLVSRLQWWKH FRQVXOWDQWVIURPWKHVKRUWOLVWDUHLVVXHGDQDGGLWLRQDO5)37KHUHPDLQLQJVWHSVDUHWKHVDPHDV WKHODWHUVWHSVIROORZHGLQWKH2QH6WHS5)3PHWKRG7KHFRPELQDWLRQRIWKHVHVWHSVLV LQGLFDWHGLQ)LJXUH&RQVXOWDQW6HOHFWLRQ)ORZFKDUW%HFDXVHLWLVDFRPELQDWLRQRIWKH2QH WĂŐĞϯϴŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 81 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 6WHS5)4DQG2QH6WHS5)3PHWKRGVWKLVPHWKRGRIFRQVXOWDQWVHOHFWLRQUHTXLUHVPRUHZRUN DQGWLPHWKDQWKHRWKHUWZRPHWKRGV&RQVHTXHQWO\WKHFRPELQHG5)45)3PHWKRGLV UHFRPPHQGHGIRUXVHRQO\ZKHQWKHVFRSHRIZRUNLVQRWFOHDUO\NQRZQYHU\FRPSOH[RU XQXVXDO 7KH7ZR6WHS5)45)3LVDOVRZHOOVXLWHGIRUSURFXULQJPXOWLSOHRQFDOOFRQWUDFWVWKURXJKD VLQJOHVROLFLWDWLRQ7KHRXWFRPHRIWKHILUVWVWHS5)4ZLOOEHPXOWLSOHFRQWUDFWVRURQFDOOOLVWRI FRQVXOWDQWV)RUPXOWLSOHRQFDOOFRQWUDFWVSURMHFWZRUNZLOOEHSURFXUHGWKUXVXEVHTXHQW FRPSHWLWLRQRUPLQL5)3VDPRQJVWWKHRQFDOOFRQVXOWDQWV7KHPLQL5)3RUWKHWDVNRUGHUZLOO EHQHJRWLDWHGZLWKILUVWUDQNHGILUPIURPHDFKFRPSHWLWLRQ7DVNRUGHU PLQL5)3 FRVWZLOOEH EDVHGRQZDJHUDWHVHVWDEOLVKHGLQWKHPDVWHURQFDOOFRQWUDFWDQGWKHWLPHDQGGHOLYHUDEOH UHTXLUHPHQWVLQWKHWDVNRUGHU /RFDODJHQFLHVPD\DOVRXVHWKLVPHWKRGWRGHYHORSDQGPDLQWDLQDSUHTXDOLILHGILOHOLVWRI FRQVXOWDQWILUPVE\VSHFLILFZRUNFDWHJRULHVRUDUHDVRIH[SHUWLVHRUWRFUHDWHDEHQFKOLVWRI HYDOXDWHGDQGUDQNHGFRQVXOWDQWV7KHSUHTXDOLILHGGDWDILOHRULQWHUHVWOLVWFDQEHXSGDWHG DQQXDOO\RUHYHU\WZR\HDUV7KLVOLVWFRQWDLQVPLQLPXPTXDOLILFDWLRQVDQGKDVQRWJRQHWKURXJK WKHHYDOXDWLRQSURFHVV7KHSUHTXDOLILFDWLRQOLVWPXVWEHPDLQWDLQHGE\WKHDJHQF\ 7KHPLQL5)3FRQWDLQVHYDOXDWLRQFULWHULDWKDWPDWFKHVWKHVWUHQJWKVRIWKHTXDOLILHGILUPVWRWKH VSHFLILFV RI WKH NQRZQ WDVNV WKHUHE\ VHOHFWLQJ WKH PRVW TXDOLILHG ILUP IRU HDFK WDVN 7KH HYDOXDWLRQFDQLQFOXGHDYDLODELOLW\RISHUVRQQHOVWDIIFDSDELOLWLHV'%( RUOHVVRIRYHUDOO VFRUH FRPSOHWLRQWLPHH[SHULHQFHRIFRQVXOWDQWVSHFLDOL]HGH[SHUWLVHDQGSDVWSHUIRUPDQFH 7KHRYHUDOO'%(JRDOZDVHVWDEOLVKHGDWWKHPDVWHURQFDOOFRQWUDFW %HFDXVHLWLVDFRPELQDWLRQRIWKH2QH6WHS5)4DQG2QH6WHS5)3PHWKRGVWKLVPHWKRGRI FRQVXOWDQWVHOHFWLRQUHTXLUHVPRUHZRUNDQGWLPHWKDQWKHRWKHUWZRPHWKRGV&RQVHTXHQWO\WKH FRPELQHG5)45)3PHWKRGLVUHFRPPHQGHGIRUXVHZKHQWKHVFRSHRIZRUNLVYHU\FRPSOH[RU XQXVXDO &DWHJRUL]HZRUN 'HVFULSWLRQVRIWKHFDWHJRULHVRIZRUNGHOLYHUDEOHVDQGWKHPLQLPXPTXDOLILFDWLRQVWDQGDUGVIRU HDFKFDWHJRU\PXVWEHFOHDUO\LGHQWLILHG 7KHORFDODJHQF\PD\SUHTXDOLI\FRQVXOWLQJILUPVLQWKHIROORZLQJ RUPRUH FDWHJRULHV x5RDGZD\'HVLJQ x%ULGJH'HVLJQ x%ULGJH,QVSHFWLRQ x7UDIILF(QJLQHHULQJ x(QYLURQPHQWDO6HUYLFHV x5RDGZD\&RQVWUXFWLRQ,QVSHFWLRQDQG$GPLQLVWUDWLRQ x/DQGVFDSH$UFKLWHFWXUH x/DQG6XUYH\LQJ x,QWHOOLJHQW7UDQVSRUWDWLRQ6\VWHP ,76  x)HGHUDO²DLG+LJKZD\3URMHFW'HYHORSPHQW6XSSRUW6HUYLFHV WĂŐĞϯϵŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 82 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ (VWDEOLVK0LQLPXP4XDOLILFDWLRQV ,QDQHIIRUWWRHQVXUHTXDOLW\SHUIRUPDQFHDQGUHVXOWVDFRQVXOWDQWVKRXOGEHUHTXLUHGWRPHHW FHUWDLQPLQLPXPTXDOLILFDWLRQVWREHHOLJLEOHIRUFRQVLGHUDWLRQLQWKHSUHTXDOLILFDWLRQSURFHVV *HQHUDOFULWHULDJXLGHOLQHVVKRXOGEHHVWDEOLVKHGIRUFRQVXOWDQWVHOHFWLRQIRUDSUHTXDOLILHGOLVW 7KHFULWHULDPD\EHHVWDEOLVKHGE\DQLQGLYLGXDORUDSDQHORIVXEMHFWPDWWHUH[SHUWVIRUWKH VSHFLILFWDVNRIGHYHORSLQJWKHFULWHULD6RPHDJHQFLHVDOVRHVWDEOLVKDSSURSULDWHZHLJKWVIRUHDFK FULWHULRQ,WPD\EHQHFHVVDU\WRPRGLI\WKHFULWHULDWRILWVSHFLILFFDVHV:KHQD5)4LVSXEOLVKHG LWVKRXOGVWDWHWKHFULWHULDWKDWZLOOEHXVHGLQWKHVHOHFWLRQSURFHVV &ULWHULDIRUHYDOXDWLQJVWDWHPHQWVRITXDOLILFDWLRQVPD\LQFOXGHEXWDUHQRWOLPLWHGWR x6SHFLDOH[SHUWLVHDQGH[SHULHQFHRIWKHILUP·VNH\HPSOR\HHV x3URSRVHGVWDIILQJ LQFOXGHQXPEHURIOLFHQVHGDQGVSHFLDOL]HGVWDII IRUWKHSURMHFWDQG SUHYLRXVH[SHULHQFHRIWKRVHLGHQWLILHG x([SHULHQFHRIWKHILUPDQGWKHLUSHUVRQQHORQSUHYLRXVSURMHFWVVLPLODUWRWKHRQHXQGHU FRQVLGHUDWLRQ x&RQVXOWDQW'%(&RPPLWPHQWGRFXPHQW VHH([KLELW2  x3URIHVVLRQDOUHIHUHQFHVE\WKHILUPZLWKWKHORFDODJHQF\ x8QGHUVWDQGLQJRIWKHSURMHFWE\WKHILUPDVGHPRQVWUDWHGE\WKHLUDSSURDFKWRRUJDQL]LQJ DQGPDQDJHPHQWRIWKHZRUN x&XUUHQWZRUNORDGRIWKHILUPDQGWKHLUDELOLW\WRPHHWWKHSURSRVHGSURMHFWVFKHGXOH x4XDOLW\RISUHYLRXVSHUIRUPDQFHE\WKHILUPZLWKWKHORFDODJHQF\ x8VHRIVXEFRQVXOWDQWVWRDFFRPSOLVKZRUNRQWKHSURMHFW x(TXLSPHQWWKHILUPKDVDYDLODEOHDQGSURSRVHVWRXVHDVFRPSDWLELOLW\ZLWK&RPSXWHU $LGHG'UDIWLQJDQG'HVLJQ &$'' DQGRWKHUHTXLSPHQWSURSRVHGWR EH XVHG LQ DFFRPSOLVKLQJWKHZRUN x)DPLOLDULW\ZLWKIHGHUDOVWDWHDQGORFDOFRGHVUHTXLUHPHQWVVWDQGDUGVDQGSURFHGXUH x([DPSOHVRIPLQLPXPTXDOLILFDWLRQVIRUZRUNFDWHJRULHVDERYHDUHSURYLGHGKHUHEDVHG RQ&DOWUDQVEHVWSUDFWLFHV ,VVXH5)4 7KHQHHGIRUVHUYLFHVRIDFRQVXOWLQJILUPPD\EHDGYHUWLVHGLQDSSURSULDWHQDWLRQDOVWDWHDQG ORFDOSXEOLFDWLRQVDQGZHEVLWHV1RWLFHVFDQDOVREHVHQWWRILUPVNQRZQWREHTXDOLILHGWRGR VSHFLILFZRUNWRSURIHVVLRQDOVRFLHWLHVDQGWRUHFRJQL]HG'LVDGYDQWDJHG%XVLQHVV(QWHUSULVHV '%( RUJDQL]DWLRQV7KHDGYHUWLVHPHQWVDQGQRWLFHVVHHNVWDWHPHQWV RI LQWHUHVW DQG TXDOLILFDWLRQVIURPFRQVXOWDQWVZKRDUHLQWHUHVWHGLQWKHSURMHFW7KH'%(JRDOLVHVWDEOLVKHGDW WKHPDVWHURQFDOOFRQWUDFWDQGLQFOXGHGLQWKHVROLFLWDWLRQGRFXPHQW 7KH624VKRXOGOLVWFRQVXOWLQJILUPGHWDLOVQDPHVRISULQFLSDOVRIILFHORFDWLRQVSHUVRQQHOE\ GLVFLSOLQHSURMHFWH[SHULHQFHDQGH[DPSOHVFXUUHQWZRUNORDGW\SHVRIVHUYLFHWKHILUPVDUH TXDOLILHGWRSHUIRUPDQGSUHYLRXVSHUIRUPDQFH$OVRUHVXPHVRINH\SHUVRQVVSHFLDOLVWVDQG RWKHUDVVRFLDWHVWKDWPD\EHDVVLJQHGWRWKHSURMHFWRUSURMHFWV VKRXOG EH LQFOXGHG 7KLV WĂŐĞϰϬŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 83 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ LQIRUPDWLRQVKRXOGEHWKHEDVLVIRUHYDOXDWLQJDQGSODFLQJDFRQVXOWLQJILUPRQDJHQHUDOSUH TXDOLILFDWLRQOLVW )HGHUDO UHJXODWLRQV UHTXLUH WKDW DQ\ SURFHGXUHV UHODWHG WR SUHTXDOLI\LQJ FRQVXOWDQW FDQQRW UHVWULFWFRPSHWLWLRQ 3UHTXDOLILFDWLRQRIFRQVXOWDQWVPD\EHDOORZHGDVDFRQGLWLRQIRUVXEPLWWLQJDWHFKQLFDOSURSRVDO IRUDFRQWUDFWRQO\LIWKHSHULRGEHWZHHQWKHGDWHRIWKHLVVXDQFHRIWKH5)3DQGWKHGHDGOLQHIRU VXEPLWWLQJDWHFKQLFDOSURSRVDODIIRUGVVXIILFLHQWWLPHWRHQDEOHDFRQVXOWDQWWRREWDLQSUH TXDOLILFDWLRQVWDWXV $QRWKHUSUDFWLFHLVWRTXDOLI\FRQVXOWDQWVRQDSURMHFWE\SURMHFWEDVLV7KLVLVDFFRPSOLVKHGIRU VRPHDJHQFLHVE\DGYHUWLVLQJRUSXEOLVKLQJQRWLFHVLQQDWLRQDOVWDWHDQGORFDOSXEOLFDWLRQVIRU QHHGHGVHUYLFHVIRUVSHFLILFLQGLYLGXDOSURMHFWV7KHVHQRWLFHVLQFOXGHDSUHFLVHSURMHFWORFDWLRQ DGHILQHGSUHOLPLQDU\VFRSHRIVHUYLFHVWREHSHUIRUPHGDVSHFLILFVFKHGXOHZLWKLQZKLFKWKH ZRUNLVWREHFRPSOHWHGDQGDOLVWRISURGXFWVDQGGHOLYHUDEOHVWREHSURYLGHGE\WKHFRQVXOWDQW 6SHFLILFSURMHFWDGYHUWLVHPHQWVXVXDOO\DUHSXEOLVKHGZKHQWKHSURSRVHGSURMHFWLVODUJHDQG FRPSOH[LQKRXVHUHVRXUFHVDUHQRWDYDLODEOHVSHFLDOH[SHUWLVHLVUHTXLUHGRUWKHREMHFWLYLW\RI DQRXWVLGHDXWKRULW\LVGHVLUHG $SSURSULDWH)HGHUDODLGUHTXLUHPHQWVVKRXOGEHFRPSOLHGZLWKRQ)HGHUDODLGSURMHFWV 6HW8S(YDOXDWLRQ3URFHVV 7KHILUVWVWHSLQWKHHYDOXDWLRQSURFHVVLVWRGHWHUPLQHWKDWHDFK 624 FRQWDLQV DOO IRUPV TXDOLILFDWLRQVDQGRWKHULQIRUPDWLRQUHTXLUHGE\WKH5)42WKHUZLVHWKHVXEPLWWDOVPD\EH FRQVLGHUHGQRQUHVSRQVLYHDQGUHMHFWHGZLWKRXWHYDOXDWLRQ'RFXPHQWDWLRQRIZKHQHDFK624 ZDVUHFHLYHGPXVWEHPDLQWDLQHGLQWKHSURMHFWILOHV&RSLHVRIGDWHVWDPSHGHQYHORSHFRYHUVRU ER[WRSVDUHUHFRPPHQGHG ,IDOOUHTXLUHGLQIRUPDWLRQLVQRWSURYLGHGD624PD\EHFRQVLGHUHGQRQUHVSRQVLYHDQGUHMHFWHG ZLWKRXW HYDOXDWLRQ /DWH VXEPLWWDOV VXEPLWWDOV WR WKH ZURQJ ORFDWLRQ RU VXEPLWWDOV ZLWK LQDGHTXDWHFRSLHVDUHFRQVLGHUHGQRQUHVSRQVLYHDQGVKDOOEHUHMHFWHG6XEPLWWDORIDGGLWLRQDO LQIRUPDWLRQDIWHUWKHGXHGDWHVKDOOQRWEHDOORZHG /RFDODJHQF\PXVWHVWDEOLVKDSURFHVVE\ZKLFK624VDUHHYDOXDWHGDQGFRQVXOWDQWVZKRDUH GHHPHGPHHWLQJWKHPLQLPXPTXDOLILFDWLRQVDUHDFFHSWHGDQGSODFHGRQDSHUTXDOLILHGOLVW :KHWKHUWKH/RFDODJHQF\KDVD´FRPPLWWHHµRIH[SHUWVHYDOXDWLQJWKH624VRULQGLYLGXDOV UHVSRQVLEOHIRUWKHHYDOXDWLRQWKHSURFHVVPXVWEHZHOOGHILQHGRSHQDQGWUDQVSDUHQW7KHSUH TXDOLILFDWLRQSURFHVVPXVWDOVRDOORZIRUFRQVXOWDQWVWREHUHHYDOXDWHGLQFDVHVRIGHQLDOV7KH ORFDODJHQF\PXVWVSHFLI\KRZORQJWKHSUHTXDOLILHGOLVWODVWQRWWRH[FHHGWZR\HDUV)HGHUDO UHJXODWLRQUHFRPPHQGVUHIUHVKLQJWKH624VRQDQDQQXDOEDVLV /RFDODJHQF\&RQWUDFW$GPLQLVWUDWRUHQVXUHVWKDWDOOFRPPLWWHHPHPEHUVPHHWWKHFRQIOLFWRI LQWHUHVWUHTXLUHPHQWV &)5 E\FRPSOHWLQJDQGVLJQLQJDFRQIOLFWRILQWHUHVWVWDWHPHQWSULRU WRVHOHFWLRQSURFHVVLQLWLDWLRQ$VDPSOHFRQIOLFWRILQWHUHVWIRUPLVSURYLGHGLQ([KLELW7 WĂŐĞϰϭŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 84 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ (YDOXDWH4XDOLILFDWLRQVDQG$GG)LUPWR/LVW $OO624VUHFHLYHGVKRXOGILUVWEHUHYLHZHGIRUFRPSOHWHQHVV(DFKUHVSRQVHPXVWFRQWDLQDOO UHTXLUHGIRUPVDQGDQ\RWKHULQIRUPDWLRQUHTXHVWHGLQWKHDGYHUWLVHPHQW7KHUHVSRQVHPD\EH FRQVLGHUHGLQFRPSOHWHDQGUHMHFWHGZLWKRXWIXUWKHUHYDOXDWLRQLIDOOUHTXLUHGLQIRUPDWLRQLVQRW SURYLGHGRULIWKHVXEPLWWDOLVODWH 7KHTXDOLILFDWLRQVRIDOOUHVSRQGLQJILUPVDUHWKHQUHYLHZHGDFFRUGLQJWRHVWDEOLVKHGHYDOXDWLRQ FULWHULDRUIDFWRUV7KHDJHQF\WKHQHVWDEOLVKHVDVKRUWOLVWRIDWOHDVWWKUHHFRQVXOWDQWVWKDWDUH GHWHUPLQHGWREHWKHPRVWKLJKO\TXDOLILHGWRSHUIRUPWKHUHTXLUHGZRUN)LUPVQRWVHOHFWHG VKRXOGEHQRWLILHGLQZULWLQJ 0DLQWDLQ/LVW 3UHTXDOLILFDWLRQRIDFRQVXOWDQWH[SLUHVLQWZR\HDUV3UHTXDOLILHGFRQVXOWDQWVPXVWUHQHZWKHLU SUHTXDOLILFDWLRQVWDWXVHYHU\WZR\HDUV)LUPVFDQDSSO\WREHRQWKHOLVWDWDQ\WLPH$IWHUD SHULRGRIWZR\HDUVILUPVVKRXOGUHDSSO\ UHSHDWWKHSURFHVVRIVXEPLWWLQJ624V WREHRQWKH OLVW,QDGGLWLRQWRWKHUHTXLUHGWZR\HDUUHQHZDOSURFHVVWKHFRQVXOWDQWVKRXOGDOVREHUHTXLUHG WRXSGDWHWKHILUP·VRUJDQL]DWLRQDOVWUXFWXUHZLWKLQRQH\HDUZKHQWKHUHLVDFRUSRUDWHDIILOLDWH FKDQJHRZQHUVKLSFRQWUROW\SHRIZRUNH[SHUWLVHFDSDFLW\RUDQ\RWKHUPDMRUFKDQJH ,IWKHFRQVXOWDQWGRHVQRWPHHWWKHPLQLPXPUHTXLUHPHQWVDQGWKHLU624LVUHMHFWHGWKH FRPPLWWHHPXVWUHVSRQGWRWKHFRQVXOWDQWH[SODLQLQJWKHUHDVRQIRUWKHLUUHMHFWLRQ7KHFRQVXOWDQW LVDOORZHGWRUHDSSO\WREHRQWKHOLVWDJDLQSURYLGHGWKHUHDVRQVIRUUHMHFWLRQDUHFRUUHFWHG 7KHOLVWRITXDOLILHGILUPVFDQEHPDLQWDLQHGRQOLQHWKURXJKWKHDJHQF\·VZHEVLWH)LUPVFDQDOVR DSSO\WREHRQWKHOLVWWKURXJKWKHDJHQF\ZHEVLWHIRUHDVHRIRSHUDWLRQ ,VVXH5)3WR3UH4XDOLILHG&RQVXOWDQWVRQ/LVW $Q5)3LVVHQWWRWKHVKRUWOLVWHGILUPV7KH5)3VKRXOGLQGLFDWHWKHFRQWHQWRIWKHWHFKQLFDO SURSRVDOWHFKQLFDOUHYLHZSURFHGXUHVDQWLFLSDWHGVFKHGXOHRIDFWLYLWLHVVFRSHRIZRUNSURMHFW GHVFULSWLRQZKHUHWKHWHFKQLFDOSURSRVDOVDUHWREHGHOLYHUHGWKHQXPEHURIFRSLHVUHTXLUHGDQG WKHGXHGDWH 6RPHDJHQFLHVUHFHLYHWKHWHFKQLFDOSURSRVDORUDOO\DVSDUWRIDQLQWHUYLHZFRQGXFWHGIRUWKLV SXUSRVH,QWKHVHFDVHVZULWWHQGRFXPHQWDWLRQPD\QRWEHUHTXLUHG ,WHPVW\SLFDOO\UHTXLUHGLQDWHFKQLFDOSURSRVDOLQFOXGH x:RUNSODQ x2UJDQL]DWLRQSODQ x6FKHGXOHIRUPHHWLQJWLPHIUDPH x$YDLODEOHFRPSXWHUHTXLSPHQWDQGSURJUDPV x6WDIILQJSODQDQGUHVXPHVLQFOXGLQJVXEFRQVXOWDQWV x3UHDZDUGDXGLWILQDQFLDOSDFNDJHLQIRUPDWLRQ LIGHHPHGDSSURSULDWH  x([DPSOHVRIVLPLODUZRUNSUHYLRXVO\FRPSOHWHG x6XEFRQVXOWDQWV'%(WKHLUSURSRVHGSDUWLFLSDWLRQDQGRWKHUUHODWHGLQIRUPDWLRQ WĂŐĞϰϮŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 85 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ &RQGXFW3URSRVHU·V&RQIHUHQFHRU$QVZHU:ULWWHQ4XHVWLRQV 7KHORFDODJHQF\PD\DOORZIRUFODULILFDWLRQRIWKH5)3E\LQYLWLQJVXEPLWWDORIZULWWHQTXHVWLRQV RUE\FRQGXFWLQJDSURSRVHU·VFRQIHUHQFHRUE\GRLQJERWK7KHORFDODJHQF\PXVWSXEOLVKRU PDLOWKHLUUHVSRQVHVWRDQ\ZULWWHQTXHVWLRQVWRDOOFRQVXOWDQWVUHFHLYLQJWKH5)31RUHVSRQVH VKRXOGEHJLYHQWRYHUEDOTXHVWLRQV,WLVLPSRUWDQWWKDWDOOFRPSHWLQJFRQVXOWDQWVUHFHLYHWKH VDPHLQIRUPDWLRQ,IDSURSRVHU·VFRQIHUHQFHLVWREHKHOGWKHH[DFWWLPHDQGSODFHPXVWEH VSHFLILHGLQWKH5)3$WWHQGDQFHDWDSURSRVHU·VFRQIHUHQFHQRUPDOO\LVQRWPDQGDWRU\+RZHYHU FRQVXOWDQWVQRWDWWHQGLQJWKHFRQIHUHQFHGRQRWUHFHLYHQRWHVIURPWKHPHHWLQJXQOHVVWKH\ UHTXHVWWKHQRWHV 5HFHLYHDQG(YDOXDWH7HFKQLFDO3URSRVDOV 7KH&RQWUDFW$GPLQLVWUDWRUPXVWYHULI\WKDWHDFKWHFKQLFDOSURS RVDOFRQWDLQVDOOIRUPVDQGRWKHU LQIRUPDWLRQUHTXLUHGE\WKH5)3,IDOOUHTXLUHGLQIRUPDWLRQLVQRWSURYLGHGDWHFKQLFDOSURSRVDO PD\EHFRQVLGHUHGQRQUHVSRQVLYHDQGUHMHFWHGZLWKRXWHYDOXDWLRQ/DWHVXEPLWWDOVVXEPLWWDOVWR WKHZURQJORFDWLRQRUVXEPLWWDOVZLWKLQDGHTXDWHFRSLHVDUHFRQVLGHUHGQRQUHVSRQVLYHDQGVKDOO EHUHMHFWHG6XEPLWWDORIDGGLWLRQDOLQIRUPDWLRQDIWHUWKHGXHGDWHVKDOOQRWEHDOORZHG 'RFXPHQWDWLRQRIZKHQHDFKWHFKQLFDOSURSRVDOZDVUHFHLYHGPXVWEHPDLQWDLQHGLQWKHSURMHFW ILOHV&RSLHVRIGDWHVWDPSHGHQYHORSHFRYHUVRUER[WRSVDUHUHFRPPHQGHG $ FRQVXOWDQW VHOHFWLRQ FRPPLWWHH ZLWK D PLQLPXP RI WKUHH PHPEHUVLVDSSRLQWHGDWWKH EHJLQQLQJRIWKHFRQVXOWDQWVHOHFWLRQSURFHVV7KHPHPEHUVRIWKHFRQVXOWDQWVHOHFWLRQFRPPLWWHH PXVWHYDOXDWHHDFKWHFKQLFDOSURSRVDODFFRUGLQJWRWKHWHFKQLFDOFULWHULDOLVWHGLQWKH5)3$ PLQLPXPRIWKUHHWHFKQLFDOSURSRVDOVPXVWEHUHFHLYHGDQGHYDOXDWHG ,IRQO\WZRWHFKQLFDOSURSRVDOVDUHUHFHLYHGDMXVWLILFDWLRQPXVWEHGRFXPHQWHGWRSURFHHGZLWK WKHSURFXUHPHQW,IRQO\RQHWHFKQLFDOSURSRVDOLVUHFHLYHGD1RQ&RPSHWLWLYHSURFHVVPXVWEH MXVWLILHGDQGD3XEOLF,QWHUHVW)LQGLQJ /$30([KLELW) PXVWEHGRFXPHQWHG,QHLWKHUFDVH WKHUHDGYHUWLVHPHQWRIWKH5)3VKRXOGEHFRQVLGHUHGDVDQRSWLRQ 7KH FRPPLWWHH PXVW DOVR HYDOXDWH UHIHUHQFH FKHFNV DQG RWKHU LQIRUPDWLRQ JDWKHUHG LQGHSHQGHQWO\5HIHUHQFHFKHFNVVKDOOEHFRPSOHWHGDQGRWKHULQIRUPDWLRQJDWKHUHGEHIRUHWKH LQWHUYLHZVDUHFRQGXFWHG,IQHFHVVDU\WKHUHVXOWVRIWKHUHIHUHQFHFKHFNVRURWKHULQIRUPDWLRQ PD\EHGLVFXVVHGZLWKWKHKLJKHVWUDQNHGTXDOLILHGFRQVXOWDQWVDWWKHLQWHUYLHZV 'HYHORS)LQDO5DQNLQJDQG1RWLI\&RQVXOWDQWVRI5HVXOWV 7KHVHOHFWLRQFRPPLWWHHGLVFXVVHVDQGGRFXPHQWVWKHVWUHQJWKVDQGZHDNQHVVHVRIHDFKWHFKQLFDO SURSRVDOLQWHUYLHZVWKHWKUHHRUPRUHKLJKHVWUDQNHGFRQVXOWDQWV VKRUWOLVWHG DQGGHYHORSVD ILQDOUDQNLQJRIWKHKLJKHVWUDQNHGFRQVXOWDQWV$OOFRQVXOWDQWVWKDWVXEPLWWHGWHFKQLFDOSURSRVDOV PXVWEHLQIRUPHGDERXWWKHILQDOUDQNLQJRIFRQVXOWDQWV,WLVLPSRUWDQWWKDWDOOFRPSHWLQJ FRQVXOWDQWVUHFHLYHWKHVDPHLQIRUPDWLRQ 0RVWFRQVXOWDQWVZLOOUHTXHVWLQIRUPDWLRQDVWRZK\WKH\ZHUHQRWWKHKLJKHVWUDQNHG7KHUHIRUH WKHVHOHFWLRQFRPPLWWHHVKRXOGNHHSQRWHVDVWRZK\DSDUWLFXODUFRQVXOWDQWZDVQRWVHOHFWHG :KHQDFRQVXOWDQWUHTXHVWVGHEULHILQJWKHUHDVRQVIRUQRWEHLQJVHOHFWHGPXVWEHREMHFWLYH UHDVRQV7KHFRQVXOWDQWVKRXOGQRWEHFRPSDUHGWRRWKHUVDQGVKRXOGQRWEHSURYLGHGZLWK LQIRUPDWLRQ DERXW RWKHU FRQVXOWDQWV GXULQJ WKLV GHEULHILQJ 1RUPDOO\ WKH &RQWUDFW WĂŐĞϰϯŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 86 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ $GPLQLVWUDWRUGRHVWKHGHEULHILQJKRZHYHUDQ\PHPEHURIWKHVHOHFWLRQFRPPLWWHHPD\EH GHVLJQDWHGWRGRWKHGHEULHILQJ 5HTXHVW&RVW3URSRVDODQG1HJRWLDWH&RQWUDFWZLWK7RS5DQNHG&RQVXOWDQW 7KHILUVWUDQNHGFRQVXOWDQWLVDVNHGWRSURYLGHDFRVWSURSRVDOWRSHUIRUPWKHZRUNGHVFULEHGLQ WKHGUDIWFRQWUDFWDQGGLVFXVVHGDWWKHVFRSLQJPHHWLQJ7KHZRUNLVWREHSHUIRUPHGDFFRUGLQJ WRWKHFRQGLWLRQVGHVFULEHGLQWKHGUDIWFRQWUDFWXVLQJWKHSD\PHQWPHWKRGGHVFULEHGWKHUHLQ $OWHUQDWLYHO\LIWLPHLVRIWKHHVVHQFHDQGLWFDQEHMXVWLILHGVHDOHGFRVWSURSRVDOVPD\EH UHTXHVWHGIURPDOORIWKHFRQVXOWDQWVRQWKHVKRUWOLVW ,I WKHFRQWUDFWLQYROYHVPRUH WKDQ RQH SURMHFW WKHFRQVXOWDQWPXVW SURYLGH DVHSDUDWHFRVW SURSRVDOIRUHDFKSURMHFWLQDGGLWLRQWRDVXPPDU\FRVWSURSRVDOIRUWKHWRWDOFRQWUDFW,IWKH FRQWUDFW LQYROYHV PLOHVWRQHV WKH FRQVXOWDQW PXVW IXUQLVK D VHSDUDWH FRVW SURSRVDO IRU HDFK PLOHVWRQH ZLWK D VXPPDU\ FRVW SURSRVDO IRU WKH WRWDO FRVWV ,IWKH FRQWUDFW LQYROYHV VXEFRQVXOWDQWV WKH SULPH FRQVXOWDQW PXVW LQFOXGH D VHSDUDWH FRVW SURSRVDO IRU HDFK VXEFRQVXOWDQW(DFKVXEFRQVXOWDQW·VFRVWSURSRVDOPXVWIROORZWKHVDPHIRUPDWDVWKHSULPH FRQVXOWDQW·VFRVWSURSRVDO &RVWSURSRVDO IRUERWKSULPHDQGDOOVXEFRQVXOWDQWV DQGFRQWUDFWDXGLWDQGUHYLHZGRFXPHQWV VXFKDV([KLELW.DQG([KLELW$ZKLFKHYHUDSSOLFDEOH VHHSection 10.1.3: A&E Consultant Audit and Review Process ZLOOEHVXEPLWWHGLQDVHSDUDWHVHDOHGHQYHORSH $IWHUWKHWRSUDQNHGFRQVXOWDQWVXEPLWVDVHDOHGFRVWSURSRVDOWKHORFDODJHQF\UHYLHZVWKHFRVW SURSRVDODQGHQWHUVLQWRQHJRWLDWLRQV7KHJRDORIQHJRWLDWLRQLVWRDJUHHRQDILQDOFRQWUDFWWKDW GHOLYHUVWRWKHORFDODJHQF\WKHVHUYLFHVRUSURGXFWVUHTXLUHGDWDIDLUDQGUHDVRQDEOHFRVW7KH LQGHSHQGHQW FRVW HVWLPDWH GHYHORSHG E\ WKH ORFDO DJHQF\ LQ DGYDQFHRIUHTXHVWLQJDFRVW SURSRVDOIURPWKHWRSUDQNHGFRQVXOWDQWLVDQLPSRUWDQWEDVLVDQGWRROIRUQHJRWLDWLRQV 1HJRWLDWLRQVVKRXOGFRPPHQFHZLWKWKHPRVWTXDOLILHGFRQVXOWDQW,IDJUHHPHQWRQDIDLUDQG UHDVRQDEOH SULFH FDQQRW EH UHDFKHG QHJRWLDWLRQV VKRXOG WKHQ EH IRUPDOO\ WHUPLQDWHG 1HJRWLDWLRQVWKHQSURFHHGWRWKHQH[WPRVWTXDOLILHGFRQVXOWDQWDQGVRRQ(DFKFRQVXOWDQW·VFRVW SURSRVDOPXVWUHPDLQVHDOHGXQWLOQHJRWLDWLRQVFRPPHQFHZLWKWKDWSDUWLFXODUFRQVXOWDQW$WWKH FRPSOHWLRQ RI VXFFHVVIXO FRVW QHJRWLDWLRQV DOO UHPDLQLQJ VHDOHG HQYHORSHV FRQWDLQLQJ FRVW SURSRVDOVVKDOOEHUHWXUQHGWRFRQVXOWDQWV $FRQWUDFWDXGLWDQGUHYLHZPD\EHUHTXLUHG VHHSection 10.1.3: A&E Consultant Audit and Review Process 7KHORFDODJHQF\&RQWUDFW$GPLQLVWUDWRULVUHVSRQVLEOHIRUWKHVXEPLWWDORIDOOUHTXLUHG GRFXPHQWDWLRQVWR&DOWUDQV,2$,LQDWLPHO\IDVKLRQLQFOXGLQJDOOGRFXPHQWVIRUD&RQIRUPDQFH 5HYLHZ LI DSSOLFDEOH 1HJRWLDWLRQVPD\EHFRPSOHWHGDIWHUUHFHLSWRIWKH&DOWUDQV,2$, &RQIRUPDQFH/HWWHU$QLQGLUHFWFRVWDXGLWPD\EHSHUIRUPHGZLWKLQWKHUHFRUGUHWHQWLRQSHULRG RIWKHFRQWUDFW ,WHPVW\SLFDOO\QHJRWLDWHGLQFOXGH x:RUNSODQ x6FKHGXOHDQGGHDGOLQHV IRUGHOLYHUDEOHVDQGILQDOGXUDWLRQRIFRQWUDFW  x3URGXFWVWREHGHOLYHUHG x&ODVVLILFDWLRQZDJHUDWHVDQGH[SHULHQFHOHYHORISHUVRQQHOWREHDVVLJQHG WĂŐĞϰϰŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 87 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ x2WKHU'LUHFW&RVWLWHPVDQGSURILWRUIHH 7KHFRQVXOWDQW·V,&5LVQRWDQHJRWLDEOHLWHP$ORZHUUDWHFDQQRWEHQHJRWLDWHGE\WKHORFDO DJHQF\ 7KHORFDODJHQF\DQGWKHFRQVXOWDQWZLOODJUHHRQWKHILQDOFRVWSURSRVDODQGLQFRUSRUDWHLQWR ILQDOFRQWUDFW %HIRUHH[HFXWLQJWKHFRQVXOWDQWFRQWUDFWWKHORFDODJHQF\PXVWUHYLHZFRQWUDFWWRHQVXUHWKDWDOO IHGHUDODQGVWDWHUHTXLUHPHQWVKDYHEHHQPHW VHHExhibit 10-C DQGDOOGHILFLHQFLHVLGHQWLILHGLQ WKH&RQIRUPDQFH/HWWHUKDYHEHHQDGGUHVVHGDQGUHVROYHGLIDSSOLFDEOH7KHFRPSOHWHGFKHFNOLVW LVWREHVLJQHGE\WKH&RQWUDFW$GPLQLVWUDWRUDQGWKHRULJLQDOUHWDLQHGLQWKHSURMHFWILOHRQHFRS\ LVWREHVHQWWRWKH'/$( IRUUHYLHZRIFRPSOHWHQHVV DQGILOLQJZLWKLQGD\VDIWHUDZDUGLQJ WKHFRQWUDFW &203/(7,1*7+(352-(&7 'HYHORSWKH)LQDO&RQWUDFW 7KH&RQWUDFW$GPLQLVWUDWRUUHTXHVWVDUHYLVHGFRVWSURSRVDOIURPWKHFRQVXOWDQWDIWHU  QHJRWLDWLRQVKDYHEHHQFRPSOHWHG  WKHORFDODJHQF\DQGFRQVXOWDQWKDYHDJUHHGWRDIDLU DQGUHDVRQDEOHSULFHDQG  DOHWWHULIDSSOLFDEOHLVUHOHDVHGE\&DOWUDQV,2$,WKDWDFFHSWV GHQLHVRUPDNHVDQDGMXVWPHQWWRWKHSURSRVHG,&57KH&RQWUDFW$GPLQLVWUDWRUVKRXOGUHYLHZ WKHUHYLVHGFRVWSURSRVDOWRHQVXUHWKDWDOOWKHLWHPVDQGFKDQJHVGLVFXVVHGGXULQJQHJRWLDWLRQ ZHUHLQFOXGHG7KLVUHYLVHGFRVWSURSRVDOWKHQEHFRPHVWKHILQDOFRVWSURSRVDOLVDWWDFKHGWR DQGPDGHDSDUWRIWKHFRQVXOWDQWFRQWUDFW6DPSOHFRQWUDFWODQJXDJHDQGIRUPDWKDYHEHHQ LQFOXGHGDVExhibit 10-R: A&E Boilerplate Agreement Language. 7KH&RQWUDFW$GPLQLVWUDWRUKDVUHVSRQVLELOLW\WRHQVXUHWKDWWKHILQDOQHJRWLDWHGFRQWUDFWLV FRPSOHWHDQGKDVYHULILHGWKDWDOOUHTXLUHGEDFNXSGRFXPHQWVKDYHEHHQSURYLGHG&RSLHVRI WKHFRQWUDFWDUHVHQWWRWKHFRQVXOWDQWIRUVLJQDWXUHILUVW 5HYLHZDQG$SSURYDORI&RQWUDFWV 3URSRVHGFRQWUDFWVIRUFRQVXOWDQWVHUYLFHV LQFOXGLQJVXEFRQWUDFWHGZRUN PXVWEHUHYLHZHGE\ WKHORFDODJHQF\WRYHULI\WKDW x&RPSHQVDWLRQLVIDLUDQGUHDVRQDEOHDQGLQFOXGHVSUHYDLOLQJZDJHUDWHVLI DSSOLFDEOH x:RUNDFWLYLWLHVDQGVFKHGXOHVDUHFRQVLVWHQWZLWKWKHQDWXUHDQGVFRSHRIWKH SURMHFW x'%(JRDOExhibit 10-O2: Consultant Contract DBE Commitment LVLQFOXGHGIRUDOO FRQWUDFWVUHJDUGOHVVRIJRDO xExhibit 10-K: Consultant Certification of Contract Costs and Financial Management System IRU3ULPHDQG6XEV DQGExhibit 10-A: A&E Consultant Financial Document Review Request DQG&KHFNOLVWDQGDOOVXSSRUWLQJGRFXPHQWVLI DSSOLFDEOH FRQWUDFWVDERYH KDYHEHHQVXEPLWWHGWR&DOWUDQV,2$, WĂŐĞϰϱŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 88 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ x,IDSSOLFDEOHDGMXVWPHQWRUGHQLDORIWKH,&5LGHQWLILHGLQWKH)LQDQFLDO5HYLHZ /HWWHUKDYHEHHQLQFOXGHGLQWKHILQDOFRVWSURSRVDO xExhibit 10-C: A&E Consultant Contract Reviewers Checklist PXVWEHXVHGWRHQVXUH WKDWUHTXLUHGGRFXPHQWDWLRQKDVEHHQSURYLGHG x$FRVWSURSRVDO VHHExhibit 10-H: Sample Cost Proposal PXVWLQFOXGHWKHFRVWV RIPDWHULDOVGLUHFWVDODULHVSD\UROODGGLWLRQVRWKHUGLUHFWFRVWVLQGLUHFWFRVWV IHHVDQGEDFNXSFDOFXODWLRQV %HIRUHDSSURYLQJDFRQWUDFWIRUFRQVXOWLQJVHUYLFHVWKH&RQWUDFW$GPLQLVWUDWRUPXVWEH VDWLVILHGWKDWWKHFRQVXOWDQW·VRUJDQL]DWLRQ x,VTXDOLILHGWRSHUIRUPWKHVHUYLFHVUHTXLUHG x,VLQDSRVLWLRQFRQVLGHULQJRWKHUZRUNFRPPLWPHQWVWRSURYLGHFRPSHWHQW DQGH[SHULHQFHGSHUVRQQHOWRSHUIRUPWKHVHUYLFHVLQWKHWLPHDOORZHG x,VIXOO\DZDUHRIDOODSSOLFDEOHIHGHUDODQGVWDWHODZVLQFOXGLQJLPSOHPHQWLQJ UHJXODWLRQVGHVLJQVWDQGDUGVVSHFLILFDWLRQVSUHYLRXVFRPPLWPHQWVWKDWPXVW EHLQFRUSRUDWHGLQWRWKHGHVLJQRIWKHSURMHFWDQGDGPLQLVWUDWLYHFRQWUROV LQFOXGLQJWKRVHRI&DOWUDQVDQG)+:$ x+DVDQDGHTXDWHILQDQFLDOPDQDJHPHQWV\VWHPDVUHTXLUHGE\WKHDSSOLFDEOH IHGHUDOUHJXODWLRQV x,VQRWGLVEDUUHGRUVXVSHQGHGIURPVWDWHRUIHGHUDOO\IXQGHGFRQWUDFWV3HU &)5 E  ´$FRQWUDFWLQJDJHQF\VKDOOYHULI\VXVSHQVLRQDQGGHEDUPHQW DFWLRQVDQGHOLJLELOLW\VWDWXVRIFRQVXOWDQWVDQGVXEFRQVXOWDQWVSULRUWRHQWHULQJ LQWRDQDJUHHPHQWRUFRQWUDFWLQDFFRUGDQFHZLWK&)5SDUWDQG&)5SDUW  7KHFRQWUDFWPXVWSURYLGHIRUDGHILQHGOHYHORIDFFHSWDELOLW\DQGDVWDWHPHQWWRWKHHIIHFWWKDW WKHFRQVXOWDQWPD\EHUHTXLUHGWRPRGLI\LWVZRUNDVQHFHVVDU\WRPHHWWKDWOHYHORI DFFHSWDELOLW\DVGHILQHGLQWKHFRQWUDFW7KHFRQWUDFWVKDOOSURYLGHIRUORFDODJHQF\UHYLHZVDW DSSURSULDWHVWDJHVGXULQJSHUIRUPDQFHRIWKHZRUNWRGHWHUPLQHLIDQ\FKDQJHVRURWKHU DFWLRQVDUHZDUUDQWHG 7KHFRQWUDFWVKDOOSURYLGHWKDWWKHFRQVXOWDQWDQGVXEFRQVXOWDQWVVKDOOPDLQWDLQDOOERRNV GRFXPHQWVSDSHUVDFFRXQWLQJUHFRUGVDQGRWKHULQIRUPDWLRQSHUWDLQLQJWRFRVWVLQFXUUHG 6XFKPDWHULDOVPXVWEHDYDLODEOHIRULQVSHFWLRQDQGDXGLWE\IHGHUDO6WDWHDQGORFDODJHQF\ DXWKRUL]HGUHSUHVHQWDWLYHVDQGFRSLHVWKHUHRIVKDOOEHIXUQLVKHGLIUHTXHVWHG )ROORZLQJILQDOVHWWOHPHQWRIWKHFRQWUDFWDFFRXQWVZLWKWKH6WDWHRU)+:$VXFKUHFRUGVDQG GRFXPHQWVPD\EHDUFKLYHGDWWKHRSWLRQRIWKHORFDODJHQF\DQGVKDOOEHUHWDLQHGIRUDWKUHH \HDUSHULRGDIWHUSURFHVVLQJRIWKHILQDOYRXFKHUE\)+:$ ([HFXWH&RQWUDFWDQG,VVXH1RWLFHWR3URFHHGWR&RQVXOWDQW 7KH&RQWUDFW$GPLQLVWUDWRUVHQGVWKHFRQVXOWDQWDIXOO\H[HFXWHGFRS\RIWKHFRQWUDFWZLWKDQ RULJLQDOVLJQDWXUHDQGLVVXHVDQRWLFHWRSURFHHG)XQGVPD\QRWEHXVHGWRUHLPEXUVHWKH DJHQF\IRUDQ\ZRUNRUFRVWVLQFXUUHGEHIRUHWKH$XWKRUL]DWLRQWR3URFHHGLVLVVXHGRUIRU WĂŐĞϰϲŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 89 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ FRQVXOWDQWFRVWVLQFXUUHGSULRUWRWKHH[HFXWLRQRIWKHFRQVXOWDQWFRQWUDFW$OOH[HFXWHG FRQWUDFWVVKDOOKDYHDEHJLQDQGHQGGDWH/RFDODJHQF\FRQVXOWDQWVHOHFWLRQDQGFRQWUDFW H[HFXWLRQFRVWVPD\EHUHLPEXUVDEOH )RURQFDOOFRQWUDFWVDIXOO\H[HFXWHGFRS\RIWKHFRQWUDFWZLWKRULJLQDOVLJQDWXUHVZLOOEHVHQG WRWKHFRQVXOWDQW(DFKVXEVHTXHQWWDVNRUGHU IRULQGLYLGXDOSURMHFW ZLOOEHDFFRPSDQLHGZLWK DFRS\RIWKHVLJQHGWDVNRUGHUDQGD1RWLFHWR3URFHHGRQFHLWLVQHJRWLDWHGDQGDSSURYHG 7DVNRUGHUH[SLUDWLRQGDWHVPD\QRWH[FHHGWKH0DVWHU2QFDOODJUHHPHQWHQGGDWH $GPLQLVWHUWKH&RQWUDFW 3URMHFWZRUNEHJLQVDVVSHFLILHGLQWKHFRQWUDFWDIWHUWKHQRWLFHWRSURFHHGLVLVVXHGWRWKH FRQVXOWDQW7KHUHDIWHUWKHORFDODJHQF\PDQDJHVDQGDGPLQLVWHUVWKHFRQWUDFWWRHQVXUHWKDWD FRPSOHWHDQGDFFHSWDEOHSURGXFWLVUHFHLYHGRQWLPHZLWKLQVWDQGDUGVDQGZLWKLQEXGJHWDQG WHUPVRIWKHFRQWUDFW &RQWUDFWDGPLQLVWUDWLRQDFWLYLWLHVKHOSWRHQVXUHWKDWFRQWUDFWXDOREOLJDWLRQVDUHFRPSOHWHG VDWLVIDFWRULO\*HQHUDOO\WKHVHDFWLYLWLHVLQFOXGH x0RQLWRULQJSURMHFWSURJUHVVDQGFRPSOLDQFHZLWKFRQWUDFWUHTXLUHPHQWV x5HFHLYLQJUHYLHZLQJDQGDVVHVVLQJUHSRUWVSODQVDQGRWKHUUHTXLUHG SURGXFWVGHOLYHUDEOHV x5HFHLYLQJDQGUHYLHZLQJVWDWHSUHYDLOLQJZDJHV 6HH'HSDUWPHQWRI,QGXVWULDO 5HODWLRQVZHEVLWHVEHORZ o',5)$4ZHEVLWH KWWSZZZGLUFDJRY235/)$4B3UHYDLOLQJ:DJHKWPO o',5:DJH'HWHUPLQDWLRQZHEVLWH KWWSZZZGLUFDJRYRSUO'3UH:DJH'HWHUPLQDWLRQKWP x5HYLHZLQJLQYRLFHVWRHQVXUHFRVWVFODLPHGDUHLQDFFRUGDQFHWRWKHPHWKRGRISD\PHQW DQGFRQWUDFWFRVWSURSRVDODSSURYLQJSD\PHQWV x,IQHZFRQVXOWDQWSHUVRQQHODUHDGGHGRUVXEVWLWXWHGODERUUDWHVPXVWEHYHULILHGSULRU WRDSSURYLQJLQYRLFHV x5HFRUGNHHSLQJDQGUHSRUWLQJ x&RQWUROOLQJFRVWV x,GHQWLI\LQJFKDQJHVWRWKHVFRSHRIZRUNDQGSUHSDUDWLRQRIDPHQGPHQWV PXVWHQVXUH WKDWDQ\FKDQJHVWRWKHVFRSHLVZLWKLQWKHFRQVWUDLQWVRIWKHRULJLQDO5)35)4 x&RPSOHWLQJWKHFRQVXOWDQWSHUIRUPDQFHHYDOXDWLRQV VHHExhibit 10-S: Consultant Performance Evaluation  6XEVWLWXWLRQRI&RQVXOWDQW3HUVRQQHODQG6XEFRQVXOWDQWV $IWHUFRQWUDFWH[HFXWLRQWKHFRQVXOWDQWVKRXOGQRWVXEVWLWXWHNH\SHUVRQQHO SURMHFWPDQDJHU DQGRWKHUVOLVWHGE\QDPHLQWKHFRVWSURSRVDO RUVXEFRQVXOWDQWVZLWKRXWSULRUZULWWHQ WĂŐĞϰϳŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 90 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ DSSURYDOIURPWKHORFDODJHQF\5HIHUWR/$30&KDSWHUCivil Rights & Disadvantaged Business Enterprise DQG7LWOH&)5IRU'%(VXEVWLWXWLRQUHTXLUHPHQWV7RGRVRFDQUHVXOWLQWKH FRVWVEHLQJLQHOLJLEOHIRUIHGHUDORUVWDWHUHLPEXUVHPHQW7KHFRQVXOWDQWPXVWUHTXHVWDQG MXVWLI\WKHQHHGIRUWKHVXEVWLWXWLRQDQGREWDLQDSSURYDOIURPWKHORFDODJHQF\SULRUWRXVHRID GLIIHUHQWVXEFRQVXOWDQWRQWKHFRQWUDFW 7KHSURSRVHGVXEVWLWXWHGSHUVRQPXVWEHDVTXDOLILHGDVWKHRULJLQDODQGDWWKHVDPHRUORZHU FRVW)RUHQJLQHHULQJW\SHVRIFRQVXOWDQWFRQWUDFWVWKHFRQVXOWDQW·VSURMHFWPDQDJHUPXVWEHD UHJLVWHUHGHQJLQHHULQWKH6WDWHRI&DOLIRUQLD ,QYRLFLQJ RU3URJUHVV3D\PHQWV  7KHIUHTXHQF\DQGIRUPDWRIWKHLQYRLFHVSURJUHVVSD\PHQWVDUHWREHGHWHUPLQHGE\WKH FRQWUDFW3URJUDP6XSSOHPHQW$JUHHPHQWV VHHLAPM Chapter 3: Project Authorization QHHGWR KDYHEHHQSUHSDUHGSULRUWRDQ\SD\PHQWVEHLQJUHTXHVWHG3D\PHQWVWRWKHFRQVXOWDQWDUHWR EHLQDUUHDUV,QRWKHUZRUGVWKHFRQVXOWDQWPXVWKDYHDFWXDOO\LQFXUUHGDQGSDLGWKHFRVWV EHIRUHLQYRLFLQJWKHORFDODJHQF\ )RUIHGHUDOUHLPEXUVHPHQWRIFRQVXOWDQWFRVWVRQDSURMHFWWKHORFDODJHQF\PXVWVXEPLWWKH IROORZLQJWRWKH'/$(IRUHDFKFRQVXOWDQWRUFRQVXOWLQJILUPXVHGRQWKHSURMHFW IDLOXUHWRGR VRZLOOUHVXOWLQWKHFRQVXOWDQW·VLQYRLFHVIRUUHLPEXUVHPHQWEHLQJUHWXUQHGWRWKHDJHQF\ XQSURFHVVHG  x&RS\RI([HFXWHG&RQVXOWDQWFRQWUDFW xExhibit 10-O1: Consultant Proposal DBE Commitment xExhibit 10-O2: Consultant Contract DBE Information '/$(PXVWFRQILUPWKDWWKHORFDODJHQF\KDVVXEPLWWHGFRSLHVRIExhibit 10-K: Consultant Certification of Contract Costs and Financial Management System IRU3ULPHDQG6XEFRQVXOWDQWV WR &DOWUDQV,2$,DQGUHFHLYHGDFFHSWDQFHRIExhibit 10-C: Consultant Contract Reviewers Checklist IURP&DOWUDQV 7KHORFDODJHQF\LVWRIROORZWKHSURFHGXUHVJLYHQLQLAPM Chapter 5: Invoicing, WRREWDLQ UHLPEXUVHPHQWRIIHGHUDORUVWDWHIXQGV &RQWUDFW$PHQGPHQWV &RQWUDFWDPHQGPHQWVDUHUHTXLUHGWRPRGLI\WKHWHUPVRIWKHRULJLQDOFRQWUDFWIRUFKDQJHVVXFK DVH[WUDWLPHDGGHGZRUNRULQFUHDVHGFRVWV2QO\ZRUNZLWKLQWKHRULJLQDODGYHUWLVHGVFRSHRI VHUYLFHVVKDOOEHDGGHGE\DPHQGPHQWWRWKHFRQWUDFW7KHDGGLWLRQRIZRUNRXWVLGHWKHRULJLQDO DGYHUWLVHGVFRSHZLOOPDNHWKDWZRUNLQHOLJLEOHIRUIHGHUDORUVWDWHUHLPEXUVHPHQW VHH4 $VDW KWWSZZZIKZDGRWJRYSURJUDPDGPLQTDBFIP  7KHUHLVQRSUHVFULEHGIRUPDWIRUFRQWUDFWDPHQGPHQWV7KH\PD\WDNHWKHIRUPRIOHWWHUW\SH DJUHHPHQWVPHHWLQJWKHOHJDOUHTXLUHPHQWVRIWKHORFDODJHQF\FOHDUO\RXWOLQLQJWKHFKDQJHV DQGFRQWDLQLQJDPXWXDOO\DJUHHGXSRQPHWKRGRIFRPSHQVDWLRQ6XFKDJUHHPHQWVPXVW FRQIRUPWRWKHUHTXLUHPHQWVRIWKLVPDQXDOZLWKUHJDUGWRSD\PHQW WĂŐĞϰϴŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 91 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ $FRQVXOWDQWFRQWUDFWPD\EHDPHQGHGDWDQ\WLPHSULRUWRWKHH[SLUDWLRQGDWHRIWKHRULJLQDO FRQWUDFW7KHPRVWFRPPRQDPHQGPHQWLVWRH[WHQGWKHHQGLQJGDWHRIWKHFRQWUDFW$OO FRQWUDFWDPHQGPHQWVPXVWEHIXOO\H[HFXWHGEHIRUHWKHHQGLQJGDWHRIWKHFRQWUDFW)DLOXrHWR DPHQGDFRQWUDFWSULRUWRWKHHQGLQJGDWHZLOOPDNHWKHVXEVHTXHQWFRVWVLQHOLJLEOHIRUIHGHUDO DQGVWDWHUHLPEXUVHPHQW )RURQFDOOFRQVXOWDQWFRQWUDFWVWKHDPHQGPHQWLVUHVWULFWHGWRWKHZRUN WDVNRUGHU WKDWKDV DOUHDG\EHHQVWDUWHGE\WKHFRQVXOWDQWDQGFDQQRWLQFOXGHDQ\QHZZRUN7DVNRUGHUVDUHQRW FRQVLGHUHGDQDPHQGPHQWDQGWKHUHIRUHQRWDSSURSULDWHWRH[WHQGWKHWHUPVRIWKHFRQWUDFW $OOFRQWUDFWDPHQGPHQWVVKDOOEHQHJRWLDWHGIROORZLQJWKHVDPHSURFHGXUHVDVWKHQHJRWLDWLRQ RIWKHRULJLQDOFRQWUDFWDQGPXVWEHLQZULWLQJDQGIXOO\H[HFXWHGE\WKHFRQVXOWDQWDQGORFDO DJHQF\EHIRUHUHLPEXUVDEOHZRUNEHJLQVRQWKHDPHQGPHQW)RUDQ\DGGLWLRQDOHQJLQHHULQJ DQGGHVLJQUHODWHGVHUYLFHVRXWVLGHRIWKHVFRSHRIZRUNHVWDEOLVKHGLQWKHRULJLQDOVROLFLWDWLRQD FRQWUDFWLQJDJHQF\VKDOOHLWKHUSURFXUHWKHVHULHVXQGHUDQHZVROLFLWDWLRQSHUIRUPWKHZRUN LWVHOIXVLQJDJHQF\VWDIIRUXVHDGLIIHUHQWH[LVWLQJFRQWUDFWXQGHUZKLFKWKHVHUYLFHVZRXOGEH ZLWKLQWKHVFRSHRIZRUN2YHUUXQVLQWKHFRVWVRIWKHZRUNVKDOOQRWDXWRPDWLFDOO\ZDUUDQWDQ LQFUHDVHLQWKHIL[HGIHHSRUWLRQRIDFRVWSOXVIL[HGIHHUHLPEXUVHGFRQWUDFW3HUPLWWHGFKDQJHV WRWKHVFRSHRIZRUNRUGXUDWLRQPD\ZDUUDQWFRQVLGHUDWLRQIRUDGMXVWPHQWRIWKHIL[HGIHH SRUWLRQRIFRVWSOXVIL[HGIHHRUOXPSVXPUHLPEXUVHGFRQWUDFWV,IDQHPHUJHQF\H[LVWVRIVXFK PDJQLWXGHWKDWDGHOD\FDQQRWEHWROHUDWHGWKHORFDODJHQF\DQGWKHFRQVXOWDQWPD\DJUHHRQ DQDPHQGPHQWLQLWLDWLQJWKHZRUNVRWKDWUHLPEXUVDEOHZRUNPD\EHJLQ7KHLQLWLDWLQJ DPHQGPHQWLVWKHQIROORZHGE\DILQDODPHQGPHQWRQFHWKHIXOOVFRSHRIWKHHPHUJHQF\ZRUNLV NQRZQDQGDJUHHGWRE\ERWKSDUWLHV,QERWKFDVHVVXIILFLHQWIXQGLQJVKRXOGEHLQFOXGHGLQWKH DPHQGPHQWVWRSD\IRUDOOZRUNWREHSHUIRUPHGE\WKHFRQVXOWDQW7KHILQDODPHQGPHQWPXVW EHH[HFXWHGDVTXLFNO\DVSRVVLEOH)DLOXUHWRIXOO\FRPSO\ZLWKWKLVVHFWLRQPD\UHVXOWLQWKH ORVVRIORFDODJHQF\IXQGLQJSection 10.1.3: A&E Consultant Audit and Review Process RIWKLV FKDSWHUVKDOODSSO\WRWKHHQWLUHFRQWUDFWDQGPXVWEHFRPSOHWHGSULRUWRH[HFXWLRQRIWKH FRQWUDFWDPHQGPHQW$OODPHQGPHQWVVKDOOLQFRUSRUDWHDQ\FXUUHQWUHTXLUHPHQWVRIWKHIHGHUDO UHJXODWLRQVLQFOXGLQJWKHIHGHUDOILVFDOSURYLVLRQVDQGVXEPLWExhibit 10-C: Consultant Contract Reviewers ChecklistWRDHRYHUVLJKW#GRWFDJRYIRUUHYLHZFRPSOHWLQJ6HFWLRQ'IRUDPHQGPHQWV 3HUIRUPDQFH(YDOXDWLRQ 3XUVXDQWWR&)5† G  DJHQFLHVDUHUHTXLUHGWRSUHSDUHDQHYDOXDWLRQRIWKHFRQVXOWDQW ZKHQWKHSURMHFWKDVEHHQFRPSOHWHG7KH&RQWUDFW$GPLQLVWUDWRUHYDOXDWHVWKHFRQVXOWDQW·V SHUIRUPDQFHDIWHUWKHFRQVXOWDQW·VILQDOUHSRUWKDVEHHQVXEPLWWHGDQGWKH&RQWUDFW $GPLQLVWUDWRUKDVFRQGXFWHGDGHWDLOHGHYDOXDWLRQZLWKWKHFRQVXOWDQW·VSURMHFWPDQDJHU6HH Exhibit 10-S: Consultant Performance Evaluation IRUDVXJJHVWHGIRUPDWIRUXVHE\WKHORFDO DJHQF\ 3URMHFW5HFRUGV )HGHUDO$LG+LJKZD\3URJUDPIXQGLQJUHFLSLHQWVDQGVXEUHFLSLHQWVPXVWPDLQWDLQDGHTXDWH DQGUHDGLO\DFFHVVLEOHSURMHFWSHUIRUPDQFHDQGILQDQFLDOUHFRUGVVXSSRUWLQJGRFXPHQWVDQG RWKHUUHFRUGVFRQVLGHUHGSHUWLQHQWWRWKHJUDQWDJUHHPHQWDQGLQFRPSOLDQFHZLWK)HGHUDOODZV DQGUHJXODWLRQV HJ86&86&&)5&)5DQG&)53DUW WĂŐĞϰϵŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 92 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ  7KHVHUHFRUGVVKDOOEHPDLQWDLQHGIRUDPLQLPXPRIWKUHH  \HDUVIROORZLQJLVVXDQFHRI WKHILQDOYRXFKHUIURP)+:$ IRUZDUGHGE\&DOWUDQV DQGWKHFORVXUHRIDOORWKHUSHQGLQJ PDWWHUV &)53DUW  )RUDXGLWSXUSRVHVSURMHFWUHFRUGVDQGGRFXPHQWDWLRQVKDOOEHNHSWIRUWKUHH  \HDUVDIWHU SD\PHQWRIWKHILQDOIHGHUDORUVWDWHYRXFKHU$PRQJWKHUHFRUGVWREHUHWDLQHGDUHDVIROORZV QRWDQDOOLQFOXVLYHOLVW  x&RSLHVRI5)3VDQG5)4VFKDQJHVDGGHQGXPVHWFDQGELGGHU·VOLVW x'RFXPHQWDWLRQRI'%(SDUWLFLSDWLRQ LQFOXGLQJExhibit 10-O1: Consultant Proposal DBE Commitment DQGExhibit 10-O2: Consultant Contract DBE Commitment  x6ROLFLWDWLRQDQGDGYHUWLVHPHQWUHFRUGV x,GHQWLILFDWLRQRIVHOHFWLRQFRPPLWWHHPHPEHUV x5HFRUGRIUHFHLYLQJSURSRVDOVVWDWHPHQWRITXDOLILFDWLRQV x(YDOXDWLRQDQGUDQNLQJUHFRUGVVXFKDVRULJLQDOVFRUHVKHHWVIURPDOOSDQHOPHPEHUV VKRUWOLVWTXHVWLRQVDQGRWKHUGRFXPHQWDWLRQ VHHExhibit 10-B: Suggested Consultant Evaluation Sheet  x,QGHSHQGHQWFRVWHVWLPDWH SUHSDUHGLQDGYDQFHRIUHTXHVWLQJDFRVWSURSRVDOIURPWKH WRSUDQNHGFRQVXOWDQW  x5HFRUGRIQHJRWLDWLRQV WRLQFOXGHDVHSDUDWHQHJRWLDWLRQRISURILWLQDFFRUGDQFHZLWK IHGHUDOJXLGHOLQHV  x)LQDQFLDO5HYLHZ/HWWHUDQG&RJQL]DQW$JHQF\/HWWHUZKHQDSSOLFDEOH x&3$DXGLWHG,&5$XGLW5HSRUWRU$SSURYHG6WDWH'27&RJQL]DQW,QGLUHFW5DWH/HWWHU LIDQ\ x&RQVXOWDQW&HUWLILFDWLRQRI&RVWVDQG)LQDQFLDO0DQDJHPHQW Exhibit 10-K: Consultant Certification of Contract Costs and Financial Management System IRUFRQWUDFWVRYHU RUPRUH x$ (&RQVXOWDQW$XGLW5HTXHVW/HWWHUDQG&KHFNOLVW Exhibit 10-A: A&E Consultant Audit Request Letter and Checklist IRUFRQWUDFWVRYHUDQGDOOVXSSRUWLQJ GRFXPHQWDWLRQ x([HFXWHGFRQVXOWDQWFRQWUDFWVFRVWSURSRVDOVDQGDPHQGPHQWV VHHExhibit 10-R: A&E Boilerplate Agreement Language DQGExhibit 10-H: Sample Cost Proposal  x&RQWUDFWRYHUVLJKWDQGSURJUHVVPHHWLQJGRFXPHQWV x3URJUHVVDQGILQDOSD\PHQWVDQGVXSSRUWLQJGRFXPHQWDWLRQ x3HUIRUPDQFHHYDOXDWLRQ VHHExhibit 10-S: Consultant Performance Evaluation) x&RQVXOWDQWFRQWUDFWFKHFNOLVWV VHHExhibit 10-C: A&E Consultant Contract Reviewers Checklist  WĂŐĞϱϬŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 93 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ x$FFRXQWLQJUHFRUGVGRFXPHQWLQJFRPSOLDQFHZLWK6WDWHDQGIHGHUDODGPLQLVWUDWLYH UHTXLUHPHQWV x&HUWLILFDWLRQVDQG&RQIOLFWRI,QWHUHVWIRUPV Exhibit 10-T: Conflict of Interest & Confidentiality StatementDOOSHUVRQQHOLQYROYHGLQWKHSURFXUHPHQWRIWKHDJUHHPHQW VKRXOGFRPSOHWH([KLELW7Exhibit 10-U: Consultant in Management Support Role Conflict of Interest and Confidentiality Statement DQGExhibit 10-Q: Disclosure of Lobbying ActivitiesDVDSSURSULDWH ([KLELW4LVLQFOXGHGLQWKHVROLFLWDWLRQDQGVKDOOEH FRPSOHWHGLIWKHFRQVXOWDQWQHHGVWRGLVFORVHDQ\OREE\LQJDFWLYLWLHV 5HWHQWLRQ&ODXVHV $WWKHRSWLRQRIWKHORFDODJHQF\DUHWHQWLRQFODXVHPD\EHLQFOXGHGLQWKHFRQVXOWDQWFRQWUDFW $UHWHQWLRQFODXVHLQWKHFRQVXOWDQWFRQWUDFWLVUHFRPPHQGHG VHHExhibit 10-R: A&E Boilerplate Agreement Language, $UWLFOH;;;,  5HYLHZRI/RFDO$JHQF\$FWLRQV )HGHUDODLGRUVWDWHUHLPEXUVHPHQWLVFRQWLQJHQWRQPHHWLQJWKHIHGHUDORUVWDWHUHTXLUHPHQWV DQGFDQEHZLWKGUDZQLIWKHVHSURFHGXUHVDUHQRWIROORZHGDQGGRFXPHQWHG7KHORFDODJHQF\ ILOHVDUHWREHPDLQWDLQHGLQDPDQQHUWRIDFLOLWDWHIXWXUH)+:$RU&DOWUDQVSURFHVVUHYLHZV DQGDXGLWV$VVSHFLILHGLQWKH5HYLHZDQG$SSURYDORI&RQWUDFWVDERYHWKH&RQWUDFW $GPLQLVWUDWRUPXVWUHYLHZWKHSURSRVHGFRQVXOWDQWFRQWUDFWEHIRUHH[HFXWLRQ Exhibit 10-C: A&E Consultant Contract Reviewers Checklist LVWREHFRPSOHWHGDQGVLJQHG$FRS\ VKDOOEHHPDLOHGWR&DOWUDQVDWDHRYHUVLJKW#GRWFDJRYSULRUWRFRQWUDFWDZDUGIRUDFFHSWDQFH 7KLVDFFHSWDQFHRIExhibit 10-C PXVWEHUHWDLQHGLQWKHORFDODJHQF\SURMHFWILOHV 0,6&(//$1(286&216,'(5$7,216 $JUHHPHQWVZLWK2WKHU*RYHUQPHQWDO$JHQFLHV ,QWHUJRYHUQPHQWDORULQWHUHQWLW\DJUHHPHQWVDUHHQFRXUDJHGLIDSSURSULDWH,IDQRWKHU JRYHUQPHQWDODJHQF\LVUHTXHVWHGWRGRZRUNRUSURYLGHVHUYLFHVWRDQDJHQF\DQLQWHUDJHQF\ DJUHHPHQWLVQHHGHG6HH&)5DQG&$*RYHUQPHQW&RGHVDQG 6PDOO3XUFKDVH&RQWUDFWV &RQWUDFWVWKDWDUHOHVVWKDQDUHFRQVLGHUHGVPDOOFRQWUDFWVLQDFFRUGDQFHZLWKIHGHUDO UHJXODWLRQV+RZHYHUZLWKLQWKH6WDWHRI&DOLIRUQLDWKHUHLVQRWDUHFRJQL]HGVPDOOSXUFKDVH SURFHGXUH)RUIHGHUDOFRQWUDFWVWKDWDUHOHVVWKDQDQGDUHQRWDQWLFLSDWHGWRH[FHHG WKLVDPRXQWWKHDJHQF\VKDOOXVHWKHState-Only Funded A&E Contracts: Section 10.2,IWKH FRQWUDFWLVDQWLFLSDWHGWRH[FHHGXVHRQHRIWKHDFFHSWHGSURFXUHPHQWSURFHGXUHV OLVWHGLQWKHSUHYLRXVVHFWLRQV6PDOOFRQWUDFWVXVLQJWKHVLPSOLILHGDFTXLVLWLRQSURFHGXUHVKDOO QRWH[FHHGRUWKHDGGLWLRQDOFRVWVDUHFRQVLGHUHGQRWUHLPEXUVDEOH7KHHQWLUHFRQWUDFW FRXOGDOVREHFRQVLGHUHGLQHOLJLEOHE\)+:$GHSHQGLQJRQFLUFXPVWDQFHV7KHVFRSHRIZRUN SURMHFWSKDVHVDQGFRQWUDFWUHTXLUHPHQWVVKDOOQRWEHEURNHQGRZQLQWRVPDOOHUFRPSRQHQWVWR WĂŐĞϱϭŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 94 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ SHUPLWWKHXVHRIVPDOOSXUFKDVHSURFHGXUH'%(UHTXLUHPHQWVDSSO\IRUDOOIHGHUDOO\IXQGHG SURMHFWV 1RQFRPSHWLWLYH1HJRWLDWHG&RQWUDFWV 6ROH6RXUFH  3URFXUHPHQWE\QRQFRPSHWLWLYHSURSRVDOVPD\EHXVHGRQO\ZKHQWKHDZDUGRIDFRQWUDFWLV LQIHDVLEOHXQGHUVHDOHGELGVRUFRPSHWLWLYHSURSRVDOV &)5 D   )+:$FRQVLGHUVWKHVHW\SHVRIFRQWUDFWVDV6ROH6RXUFHFRQWUDFWVDQGVKRXOGEHXVHGRQO\LQ YHU\OLPLWHGFLUFXPVWDQFHV$3XEOLF,QWHUHVW)LQGLQJSUHSDUHGE\WKHORFDODJHQF\DQG DSSURYHGE\&DOWUDQVLVUHTXLUHGEHIRUHHVWDEOLVKLQJWKHVHVHUYLFHV &)5 D  DOVRVHH Exhibit 12-F: Cost-Effectiveness/Public Interest Finding &RQGLWLRQVXQGHUZKLFKQRQFRPSHWLWLYHQHJRWLDWHGFRQWUDFWVPD\EHDFFHSWDEOHLQFOXGH x2QO\RQHRUJDQL]DWLRQLVTXDOLILHGWRGRWKHZRUN x$QHPHUJHQF\H[LVWVRIVXFKPDJQLWXGHWKDWFDQQRWSHUPLWGHOD\ x&RPSHWLWLRQLVGHWHUPLQHGWREHLQDGHTXDWHDIWHUVROLFLWDWLRQRIDQXPEHURIVRXUFHV 7KHORFDODJHQF\VKDOO x)ROORZLWVGHILQHGSURFHVVIRUQRQFRPSHWLWLYHQHJRWLDWLRQ x'HYHORSDQDGHTXDWHVFRSHRIZRUNHYDOXDWLRQIDFWRUVDQGFRVWHVWLPDWHEHIRUH VROLFLWDWLRQ x&RQGXFWQHJRWLDWLRQVWRHQVXUHDIDLUDQGUHDVRQDEOHFRVW 7KHORFDODJHQF\PXVWFDUHIXOO\GRFXPHQWGHWDLOVRIWKHVSHFLDOFRQGLWLRQVREWDLQ&DOWUDQV DSSURYDORQD3XEOLF,QWHUHVW)LQGLQJDQGUHWDLQDOOGRFXPHQWVLQWKHSURMHFWILOHVIRUIXWXUH &DOWUDQV·RU)+:$·VUHYLHZ $3XEOLF,QWHUHVW)LQGLQJ VHHExhibit 12-F: Cost-Effectiveness/Public Interest Finding LVQRW UHTXLUHGIRUDORFDODJHQF\WREHUHLPEXUVHGIRUFRQWUDFWDGPLQLVWUDWLRQDFWLYLWLHVDVVRFLDWHG ZLWKQRQLQIUDVWUXFWXUHW\SHSURMHFWVVXFKDVPDQ\6DIH5RXWHVWR6FKRRORU7UDQVSRUWDWLRQ $OWHUQDWLYHV3URJUDPSURMHFWV  3HUVRQDO6HUYLFHV&RQWUDFWV $SHUVRQDOVHUYLFHVFRQWUDFWLVFKDUDFWHUL]HGE\WKHHPSOR\HUHPSOR\HHUHODWLRQVKLSFUHDWHG EHWZHHQWKHORFDODJHQF\DQGWKHFRQWUDFWSHUVRQQHOZKRHVVHQWLDOO\SHUIRUPVLPLODUGXWLHVDV WKHHPSOR\HHV6XFKVHUYLFHVPXVWEHXQGHUWKHGLUHFWLRQDQGFRQWURORIDIXOOWLPHHPSOR\HHRI WKHORFDODJHQF\LQUHVSRQVLEOHFKDUJH&RPSHQVDWLRQIRUFRQVWUXFWLRQHQJLQHHULQJVHUYLFHV VKRXOGEHEDVHGRQDFWXDOFRVWVLQFXUUHGSOXVDIL[HGIHHRULQWKHFDVHRILQGLYLGXDO FRPSHQVDWLRQRQDQDJUHHGXSRQKRXUO\RUGDLO\UDWH/XPSVXPSD\PHQWVVKRXOGQRWEHXVHG IRUFRQVWUXFWLRQHQJLQHHULQJVHUYLFHV )RUSHUVRQDOVHUYLFHFRQWUDFWVWKHIROORZLQJLQIRUPDWLRQPXVWEHGRFXPHQWHGE\WKHORFDO DJHQF\DQGUHWDLQHGLQWKHSURMHFWILOHV WĂŐĞϱϮŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 95 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ x([SODQDWLRQRIWKHVHUYLFHVQHHGHGDQGZK\WKH\FDQQRWEHSURYLGHGE\WKHORFDO DJHQF\ x1DPHDQGTXDOLILFDWLRQRIWKHFRQVXOWDQWZKRSURYLGHGWKHVHUYLFHV x'RFXPHQWDWLRQRIWKHIHHVVKRZLQJKRZWKHIHHZDVFDOFXODWHGDQGWKDWLWLVUHDVRQDEOH E\FRPSDUDWLYHVWDQGDUGV x$Q\RWKHUUHFRUGVQHHGHGWRVKRZFRPSOLDQFHZLWKIHGHUDODLGSURJUDPUHJXODWLRQV 5HWDLQLQJD&RQVXOWDQWDVDQ$JHQF\(QJLQHHURULQ0DQDJHPHQW6XSSRUW5ROH $ORFDODJHQF\PD\UHWDLQTXDOLILHGFRQVXOWDQWVLQDPDQDJHPHQWVXSSRUWUROHRQLWVVWDIILQ SURIHVVLRQDOFDSDFLWLHVIRUIHGHUDODLGSURMHFWVVXFKDV x$&LW\(QJLQHHU RUHTXLYDOHQW ZKRPDQDJHVWKHHQJLQHHULQJXQLWIRUWKHFLW\ SURYLGLQJRYHUVLJKWRIDSURMHFWVHULHVRISURMHFWVPDQDJLQJRUGLUHFWLQJZRUNRIRWKHU FRQVXOWDQWVRUFRQWUDFWRUVRQEHKDOIRIWKH&LW\ x$&RXQW\(QJLQHHU RUHTXLYDOHQW ZKRPDQDJHVWKHHQJLQHHULQJXQLWIRUWKHFRXQW\ VXFKDVGXWLHVGHVFULEHGDERYH x$3URMHFW0DQDJHU RUHTXLYDOHQW ZKRPDQDJHVDQGRYHUVHHVDSURMHFWVHULHVRISURMHFWV RUWKHZRUNRIRWKHUFRQVXOWDQWVDQGFRQWUDFWRUVRQEHKDOIRIWKHSXEOLFDJHQF\ x$3URJUDP0DQDJHU RUHTXLYDOHQW ZKRPDQDJHVDQGRYHUVHHVDQHOHPHQWRID KLJKZD\SURJUDPIXQFWLRQRUVHUYLFHRQEHKDOIRIWKHSXEOLFDJHQF\ +RZHYHUW\SLFDOO\DFRQVXOWDQWLQDPDQDJHPHQWVXSSRUWUROHLVQRW x$FRQVXOWDQWHQJLQHHUSHUIRUPLQJSURMHFWVSHFLILFGHVLJQDQGRUFRQVWUXFWLRQFRQWUDFW DGPLQLVWUDWLRQDQGFRQVWUXFWLRQHQJLQHHULQJIRUWKHSXEOLFDJHQF\ x$FRQVXOWDQWSURYLGLQJVXSSRUWWRDGPLQLVWUDWLYHGXWLHVVXFKDVIHGHUDODXWKRUL]DWLRQ SURFHVVODERUFRPSOLDQFHDFWLYLWLHVDQGRWKHUPDQDJHPHQWDQGDGPLQLVWUDWLYHWDVNV 7KHXVHRIDFRQVXOWDQWLQDPDQDJHPHQWVXSSRUWUROHVKRXOGEHOLPLWHGWRXQLTXHRUYHU\ XQXVXDOVLWXDWLRQV7KHVHVLWXDWLRQVUHTXLUHDWKRURXJKMXVWLILFDWLRQDVWRZK\WKHORFDODJHQF\ FDQQRWSHUIRUPWKHPDQDJHPHQW&RQVXOWDQWVXVHGLQPDQDJHPHQWVXSSRUWUROHVPXVWEH VHOHFWHGXVLQJWKHVDPHSURFHGXUHVDVWKRVHIRURWKHUFRQVXOWDQWVVSHFLILHGLQWKLVFKDSWHU &RQVXOWDQWVLQD0DQDJHPHQW6XSSRUW5ROHIXQGHGE\ORFDORUVWDWHIXQGVPXVWKDYHDSSURYDO IURP)+:$WREHFRQVLGHUHGTXDOLILHGWRPDQDJHIHGHUDOSURMHFWVRUFRQVXOWDQWVSURYLGLQJ VHUYLFHVRQIHGHUDOSURMHFWV (OLJLELOLW\IRUIHGHUDORUVWDWHUHLPEXUVHPHQWIRUDFRQVXOWDQWLQDPDQDJHPHQWVXSSRUWUROH UHTXLUHVWKHIROORZLQJ x&RPSOLDQFHZLWKWKHVHOHFWLRQSURFHGXUHVVSHFLILHGLQWKLVFKDSWHU x([LVWHQFHRIDFRQWUDFWEHWZHHQWKHORFDODJHQF\DQGWKHFRQVXOWDQWVSHFLI\LQJWKHORFDO DJHQF\HQJLQHHULQJVHUYLFHVWREHSHUIRUPHG x:ULWWHQGHVLJQDWLRQE\WKHORFDODJHQF\RIWKHUHVSRQVLELOLWLHVDQGDXWKRULW\RIWKH FRQVXOWDQWDVDQDJHQF\HQJLQHHU WĂŐĞϱϯŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 96 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ x)RUDIHGHUDODLGSURMHFWFRPSOHWLRQRIExhibit 10-T: Conflict of Interest & Confidentiality Statement E\DOOPHPEHUV ERWKFRQVXOWDQWVDQGHPSOR\HHV SULRUWRSDUWLFLSDWLQJLQWKH $UFKLWHFW (QJLQHHULQJ $ ( 6HOHFWLRQ3DQHOSHUWDLQLQJWRWKHVSHFLILFVHOHFWLRQ SURFHVVDQGWKHILUPVEHLQJFRQVLGHUHG x6HOHFWLRQRIFRQVXOWDQWVIRU$ (PDQDJHPHQWSRVLWLRQVVKDOOEHE\WKHXVHRI TXDOLILFDWLRQEDVHGVHOHFWLRQSURFHGXUHVRQDQRSHQDQGFRPSHWLWLYHEDVLVUHVXOWLQJLQD FRQWUDFWZLWKGHILQHGEHJLQQLQJDQGHQGLQJGDWHVQRWWRH[FHHGILYH  \HDUV x)RUDIHGHUDODLGSURMHFWDORFDODJHQF\FRQVXOWDQWLQDPDQDJHPHQWVXSSRUWUROHVKDOO QRW o3DUWLFLSDWHLQRUH[HUFLVHDXWKRULW\RYHUWKH$ (VHOHFWLRQSURFHVVLIWKDW FRQVXOWDQW·VILUPLVRQHRIWKHSURSRVLQJILUPVRUVXEFRQVXOWDQWWRDSURSRVLQJ ILUP o3DUWLFLSDWHLQRUH[HUFLVHDXWKRULW\RYHUPDQDJHPHQWRIZRUNSHUIRUPHGE\WKH FRQVXOWDQW·VILUPRUWRDFRQVXOWDQW·VILUPRIZKLFKWKHORFDODJHQF\FRQVXOWDQWILUP LVDVXEFRQVXOWDQW7KLVZRXOGLQFOXGHEXWQRWEHOLPLWHGWRPDQDJLQJRUGLUHFWLQJ WKHZRUNDSSURYLQJFKDQJHVLQWKHVFKHGXOHVFRSHRUGHOLYHUDEOHVDQGDSSURYLQJ LQYRLFHV o$SSO\IRURUUHFHLYHUHLPEXUVHPHQWRIIHGHUDODLGIXQGVIRUWKHORFDODJHQF\·V IHGHUDODLGSURMHFWLIHLWKHURIWKHIRUHJRLQJKDVRFFXUUHG+RZHYHUUHLPEXUVHPHQW IRUWKHFRQVWUXFWLRQFRQWUDFWSRUWLRQRIWKHSURMHFWZLOOVWLOOEHDOORZHGSURYLGHGDOO RWKHUIHGHUDODLGUHTXLUHPHQWVKDYHEHHQPHW o:KHUHEHQHILWLQJPRUHWKDQDVLQJOHIHGHUDODLGSURMHFWDOORFDELOLW\RIFRQVXOWDQW FRQWUDFWFRVWVIRUVHUYLFHVUHODWHGWRDPDQDJHPHQWVXSSRUWUROHVKDOOEHGLVWULEXWHG FRQVLVWHQWZLWKWKHFRVWSULQFLSOHVDSSOLFDEOHWRWKHFRQWUDFWLQJDJHQF\LQ&)5  E   ,IHQJLQHHULQJVHUYLFHVIRUDSURMHFWDUHZLWKLQWKHVFRSHRIWKHVHUYLFHVGHVFULEHGLQWKHUHWDLQHG FRQVXOWDQW·VFRQWUDFWWKHVHVHUYLFHVPD\EHSHUIRUPHGE\WKHSHUVRQRUILUPGHVLJQDWHGDVDQ DJHQF\HQJLQHHU,IWKHVHUYLFHVDUHQRWZLWKLQWKHVFRSHHOLJLELOLW\IRUIHGHUDOUHLPEXUVHPHQW IRUWKHVHVHUYLFHVUHTXLUHDQHZFRQVXOWDQWFRQWUDFWWREHGHYHORSHGXVLQJWKHVHOHFWLRQ SURFHGXUHVLQWKLVFKDSWHU5HWDLQHGFRQVXOWDQWVLQYROYHGLQWKHSUHSDUDWLRQRIWKH5)3RU5)4 VKDOOQRWEHFRQVLGHUHGLQWKHVHOHFWLRQRIFRQVXOWDQWVIRUWKHUHVXOWLQJSURMHFWVSHFLILFZRUN :KHQHQJLQHHULQJRUDUFKLWHFWXUDOFRQVXOWDQWVLQDPDQDJHPHQWVXSSRUWUROHDUHSURFXUHGZLWK IHGHUDODLGIXQGVWKHORFDODJHQF\ VXEJUDQWHH VKDOOIXOO\FRPSO\ZLWKWKHIROORZLQJ x6XESDUDJUDSKVRI&)5PDLQWDLQDFRQWUDFWDGPLQLVWUDWLRQV\VWHPDQG PDLQWDLQDZULWWHQFRGHRIVWDQGDUGV1RHPSOR\HHRIILFHURUDJHQWRIWKHVXEJUDQWHH VKDOOSDUWLFLSDWHLQVHOHFWLRQRULQWKHDZDUGRUDGPLQLVWUDWLRQRIDFRQWUDFWVXSSRUWHG E\IHGHUDOIXQGVLIDFRQIOLFWRILQWHUHVWUHDORUDSSDUHQWZRXOGEHLQYROYHG x6XESDUDJUDSKRI&)5† E UHTXLUHVWKDWWKHORFDODJHQF\VKDOOUHFHLYHDSSURYDO IURP)+:$ ,QDGGLWLRQDQ\IHGHUDODLGSURMHFWVGHVLJQDWHGDV3URMHFWVRI'LYLVLRQ ,QWHUHVWPD\DOVRQHHGDSSURYDOIURP)+:$ WĂŐĞϱϰŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 97 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ x/LDELOLW\LQVXUDQFHVKRXOGQRUPDOO\EHUHTXLUHGIURPWKHFRQVXOWDQW HUURUVDQG RPLVVLRQVHWF  )RU IHGHUDOO\ IXQGHG SURMHFWV ORFDO DJHQFLHV WKDW VROLFLW WR KLUH $ ( FRQVXOWDQW V  LQ D PDQDJHPHQWVXSSRUWUROHPXVWREWDLQ)+:$DSSURYDOSULRUWRFRQWUDFWH[HFXWLRQ ,QRUGHUIRUDFRQWUDFWIRUDFRQVXOWDQWLQDPDQDJHPHQWVXSSRUWUROHWREHIHGHUDOO\HOLJLEOHWKH IROORZLQJDUHUHTXLUHGSULRUWRFRQWUDFWH[HFXWLRQ x7KHORFDODJHQF\VKDOOVXEPLWDUHTXHVWIRUDSSURYDOYLDHPDLOWKH6FRSHRI:RUN 62:  DQG&RQIOLFWRI,QWHUHVW &2, 3ROLF\WRWKH'LYLVLRQRI/RFDO$VVLVWDQFH+HDGTXDUWHUV '/$+4 DWDHRYHUVLJKW#GRWFDJRY SULRUWRVROLFLWDWLRQ x2QFHWKHORFDODJHQF\UHFHLYHV)+:$·VZULWWHQUHVSRQVHWKHORFDODJHQF\PD\QHHGWR UHYLVHWKHGRFXPHQWVUHIOHFWLQJ)+:$·VRSLQLRQVDQGFDQSURFHHGZLWKWKH5)4 x$IWHUFRQVXOWDQWVHOHFWLRQWKHORFDODJHQF\VKDOOVXEPLWWKHFRPSOHWHG([KLELW8 &RQVXOWDQWLQ0DQDJHPHQW6XSSRUW5ROH&RQIOLFWRI,QWHUHVWDQG&RQILGHQWLDOLW\ 6WDWHPHQWWRWKH'/$+4DWDHRYHUVLJKW#GRWFDJRY/RFDODJHQF\ZLOOUHFHLYH )+:$·VDSSURYHGExhibit 10-U YLDHPDLO &ŝŐƵƌĞϭϬͲϱ͗ ŽŶƐƵůƚĂŶƚŝŶĂDĂŶĂŐĞŵĞŶƚ^ƵƉƉŽƌƚZŽůĞ&ůŽǁĐŚĂƌƚ WĂŐĞϱϱŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 98 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ &RQVWUXFWLRQ(QJLQHHULQJ6HUYLFHV 8QGHUIHGHUDODLGUHJXODWLRQVDQGVWDWHSROLF\WKHSULPDU\UHVSRQVLELOLW\IRUJHQHUDO VXSHUYLVLRQRIFRQVWUXFWLRQPXVWUHPDLQZLWKWKHORFDODJHQF\7KHORFDODJHQF\PXVWDOVR HQVXUHWKDWWKHZRUNLVSHUIRUPHGLQDFFRUGDQFHZLWKWKHDSSURYHGSODQVDQGVSHFLILFDWLRQVE\ HPSOR\LQJRUUHWDLQLQJDVDFRQVXOWDQWDUHJLVWHUHGHQJLQHHUIRUFRQVWUXFWLRQHQJLQHHULQJ VHUYLFHVRQWKHSURMHFW $OOFRQVWUXFWLRQHQJLQHHULQJDFWLYLWLHVSHUIRUPHGE\DFRQVXOWDQWPXVWEHXQGHUWKHRYHUDOO VXSHUYLVLRQRIDIXOOWLPHHPSOR\HHRIWKHDJHQF\ZKRLVLQUHVSRQVLEOHFKDUJH7KHVHDFWLYLWLHV PD\LQFOXGHSUHSDUDWLRQRIFRQWUDFWFKDQJHRUGHUVFRQVWUXFWLRQVXUYH\VIRXQGDWLRQ LQYHVWLJDWLRQVPHDVXUHPHQWDQGFRPSXWDWLRQRITXDQWLWLHVWHVWLQJRIFRQVWUXFWLRQPDWHULDOV FKHFNLQJRIVKRSGUDZLQJVSUHSDUDWLRQRIHVWLPDWHVUHSRUWVDQGRWKHULQVSHFWLRQDFWLYLWLHV QHFHVVDU\WRHQVXUHWKDWWKHFRQVWUXFWLRQLVEHLQJSHUIRUPHGLQDFFRUGDQFHZLWKWKHSODQVDQG VSHFLILFDWLRQV7KHFRQVWUXFWLRQHQJLQHHULQJFRQVXOWDQW·VFRQWUDFWGHILQHVWKHUHODWLYHDXWKRULWLHV DQGUHVSRQVLELOLWLHVRIWKHIXOOWLPHHPSOR\HHRIWKHORFDODJHQF\LQFKDUJHRIWKHSURMHFWDQGWKH FRQVXOWDQW·VFRQVWUXFWLRQHQJLQHHULQJVWDII ,IDWHFKQLFDOLQVSHFWLRQFRQVXOWDQWLVWRSURYLGHSURIHVVLRQDODVVLVWDQFHWRWKHORFDODJHQF\D IRUPDOFRQVXOWDQWFRQWUDFWPXVWEHH[HFXWHGZKLFKIROORZVWKLVFKDSWHU·VUHTXLUHPHQWV7KH FRQWUDFWVKDOOSURYLGHIRUUHYLHZVDWDSSURSULDWHVWDJHVGXULQJSHUIRUPDQFHRIWKHZRUNWR GHWHUPLQHLIDQ\FKDQJHVRURWKHUDFWLRQVDUHZDUUDQWHG7KHVHUHYLHZVDUHWREHPDGHE\WKH ORFDODJHQF\ 352*5$00$1$*(0(17 $FFRUGLQJWR&)5§ORFDODJHQFLHVDUHUHTXLUHGWRDGRSWZULWWHQSROLFLHVDQG SURFHGXUHVSUHVFULEHGE\&DOWUDQV7KHORFDODJHQF\VKDOODGRSW&DOWUDQV/RFDO$VVLVWDQFH &KDSWHUConsultant Selection/RFDODJHQFLHVDUHUHVSRQVLEOHIRUSURYLGLQJDOOUHVRXUFHV QHFHVVDU\IRUWKHSURFXUHPHQWPDQDJHPHQWDQGDGPLQLVWUDWLRQRI$ (FRQVXOWDQWFRQWUDFWV LQFOXGLQJVXEFRQWUDFWV(QVXULQJFRQVXOWDQWFRVWVELOOHGDUHDOORZDEOHLQDFFRUGDQFHZLWKWKH )HGHUDOFRVWSULQFLSOHVDQGFRQVLVWHQWZLWKWKHFRQWUDFWWHUPVDVZHOODVWKHDFFHSWDELOLW\DQG SURJUHVVRIWKHFRQVXOWDQW VZRUN x0RQLWRULQJWKHFRQVXOWDQW VZRUNDQGFRPSOLDQFHZLWKWKHWHUPVFRQGLWLRQVDQG VSHFLILFDWLRQVRIWKHFRQWUDFW x3UHSDULQJDFRQVXOWDQW VSHUIRUPDQFHHYDOXDWLRQZKHQVHUYLFHVDUHFRPSOHWHGDQGXVLQJ VXFKSHUIRUPDQFHGDWDLQIXWXUHHYDOXDWLRQDQGUDQNLQJRIFRQVXOWDQWWRSURYLGHVLPLODU VHUYLFHV x&ORVLQJRXWDFRQWUDFW x5HWDLQLQJVXSSRUWLQJSURJUDPPDWLFDQGFRQWUDFWUHFRUGVDVVSHFLILHGLQ&)5 DQGWKHUHTXLUHPHQWVRIWKLVSDUW x'HWHUPLQLQJWKHH[WHQWWRZKLFKWKHFRQVXOWDQWZKLFKLVUHVSRQVLEOHIRUWKHSURIHVVLRQDO TXDOLW\WHFKQLFDODFFXUDF\DQGFRRUGLQDWLRQRIVHUYLFHVPD\EHUHDVRQDEO\OLDEOHIRU FRVWVUHVXOWLQJIURPHUURUVDQGRPLVVLRQVLQWKHZRUNIXUQLVKHGXQGHULWVFRQWUDFW x$VVHVVLQJDGPLQLVWUDWLYHFRQWUDFWXDORUOHJDOUHPHGLHVLQLQVWDQFHVZKHUHFRQVXOWDQWV YLRODWHRUEUHDFKFRQWUDFWWHUPVDQGFRQGLWLRQVDQGSURYLGLQJIRUVXFKVDQFWLRQVDQG SHQDOWLHVDVPD\EHDSSURSULDWHDQG WĂŐĞϱϲŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 99 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ x5HVROYLQJGLVSXWHVLQWKHSURFXUHPHQWPDQDJHPHQWDQGDGPLQLVWUDWLRQRIHQJLQHHULQJ DQGGHVLJQUHODWHGFRQVXOWDQWVHUYLFHV $QH[DPSOHUHVROXWLRQLVORFDWHGDW KWWSZZZGRWFDJRYKT/RFDO3URJUDPV$(3 3$GRSWLRQ5HVROXWLRQGRF 5()(5(1&(6 x23 CFR, Part 172 $GPLQLVWUDWLRQRI(QJLQHHULQJDQG'HVLJQ5HODWHG6HUYLFH&RQWUDFWV KWWSZZZHFIUJRYFJLELQWH[WLG["UJQ GLY QRGH  x40 USC, Section 1104 %URRNV$FW KWWSZZZIKZDGRWJRYSURJUDPDGPLQFIP x41 CFR 3XEOLF&RQWUDFWVDQG3URSHUW\0DQDJHPHQW KWWSZZZHFIUJRYFJLELQWH[WLG["WSO HFIUEURZVH7LWOHWDEBWSO x41 USC 3XEOLF&RQWUDFWV KWWSODZRQHFOHFRPXVFRGHLQGH[KWPO x23 USC /HWWLQJRI&RQWUDFWV KWWSZZZIKZDGRWJRYPDSGRFVWLWOHXVFSGI x48 CFR, Chapter 1, Part 15.404 KWWSVZZZDFTXLVLWLRQJRYIDUKWPO)$572&3KWPO x48 CFR, Chapter 1, Part 31 KWWSVZZZDFTXLVLWLRQJRYIDUKWPO)$572&3KWPO xTitle 48, Part 16 – Types of Contracts KWWSZZZHODZVXVVXEVFULEHUVLJQLQ"UHWXUQXUO KWWSIHGHUDOHODZVXVFIUWLWOH WLWOHFKDSWHUSDUW ,V+LVWRU\  $VS[$XWR'HWHFW&RRNLH6XSSRUW  x48 CFR 27, Subpart 27.3 – Patent Rights under Government Contracts KWWSVZZZODZFRUQHOOHGXFIUWH[WSDUWVXESDUW x48 CFR 31.201-3 KWWSVZZZJSRJRYIGV\VSNJ&)5WLWOHYROSGI&)5WLWOHYRO VHFSGI x48 CFR, Chapter 99 – Cost Accounting Standards, Subpart 9900 KWWSVZZZJSRJRYIGV\VJUDQXOH&)5WLWOHYRO&)5WLWOHYRO FKDS WĂŐĞϱϳŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 100 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ x x 2 CFR Part 200 KWWSZZZHFIUJRYFJLELQWH[W LG["6,' HEGEDFHIGFHIHGG PF WUXH WSO HFIUEURZVH7LWOHFIU BPDLQBWSO 49 CFR, Part 26 3DUWLFLSDWLRQE\'LVDGYDQWDJHG%XVLQHVV(QWHUSULVHVLQ'HSDUWPHQWRI 7UDQVSRUWDWLRQ)LQDQFLDO$VVLVWDQFH3URJUDPV KWWSZZZHFIUJRYFJLELQWH[WLG["WSO HFIUEURZVH7LWOHFIUBPDLQBWSO xAmerican Association of State Highway and Transportation Officials (AASHTO) Uniform Audit and Accounting Guide KWWSDXGLWWUDQVSRUWDWLRQRUJ3DJHVGHIDXOWDVS[ xCaltrans Division of Procurement and Contracts Website KWWSZZZGRWFDJRYGSDFLQGH[KWPO xCalifornia Labor Code, Section 1775 KWWSODZRQHFOHFRPFDOLIRUQLDODERUKWPO xGovernment Auditing Standards (GAS) issued by the United States Government Accountability Office KWWSZZZJDRJRY\HOORZERRNRYHUYLHZ xGovernment Code Sections 4525 through 4529.5 KWWSZZZOHJLQIRFDJRYFJLELQGLVSOD\FRGH"VHFWLRQ JRY JURXS   ILOH  xOMB Circular A-110 8QLIRUP$GPLQLVWUDWLYH5HTXLUHPHQWVIRU*UDQWVDQG$JUHHPHQWVZLWK,QVWLWXWLRQVRI +LJKHU(GXFDWLRQ+RVSLWDOVDQG2WKHU1RQ3URILW2UJDQL]DWLRQV KWWSVZZZZKLWHKRXVHJRYRPEFLUFXODUVBD xStandard Environmental Reference (SER) KWWSZZZGRWFDJRYVHU WĂŐĞϱϴŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 101 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ &,t͗ƚŚŝƐŝƐƚŚĞŶĞǁ^ƚĂƚĞͲKŶůLJĨƵŶĚĞĚƐĞĐƚŝŽŶƚŚĂƚǁŝůůďĞƵƐĞĚĨŽƌƐƚĂƚĞͲŽŶůLJĨƵŶĚĞĚƉƌŽũĞĐƚƐ͘ 67$7(21/<)81'('$ (&2175$&76 Θ ^ƚĂƚĞͲKŶůLJDivision of Local Assistance Minimum Requirements for State-only funded A&E Contracts $:ULWWHQ3URFHGXUHV %&RQIOLFWRI,QWHUHVW &5HFRUGV ')XOO 2SHQ&RPSHWLWLRQ (6HOHFWLRQ%DVLV )3XEOLFDWLRQ *6ROLFLWDWLRQ +&RVW$QDO\VLV ,1HJRWLDWLRQV -$XGLWDQG5HYLHZ3URFHVV .([KLELW&6WDWH2QO\)XQGHG$ (&RQVXOWDQW&RQWUDFWV WĂŐĞϱϵŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 102 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ *(1(5$/ /RFDO$JHQFLHVDUHUHTXLUHGWRIROORZDOODSSOLFDEOHORFDODQGVWDWHUHJXODWLRQVLQFOXGLQJWKRVHOLVWHGLQ /$30&KDSWHULQDFFRUGDQFHZLWKWKHLU6WDWH0DVWHU$JUHHPHQW$OWKRXJKWKHUHTXLUHPHQWVOLVWHGLQ WKLVVHFWLRQDUHPLQLPXPUHTXLUHPHQWVWKHORFDODJHQF\VKDOOXVHJRRGHQJLQHHULQJMXGJPHQWDQGEHVW SUDFWLFHVWRGRFXPHQWWKHLUSURFHVVHVDQGSURFHGXUHVZKHQSURFXULQJ$ (FRQWUDFWVXWLOL]LQJ TXDOLILFDWLRQVEDVHGVHOHFWLRQV $OOFRQVXOWDQWVPXVWFRPSO\ZLWK&RGHRI)HGHUDO5HJXODWLRQV &)5 3DUWContract Cost Principles and Procedures$OVRFRQVXOWDQWVDQG/RFDO$JHQFLHVPXVWFRPSO\ZLWK&)53DUW Uniform Administrative Requirements, Cost Principles, and Audit Requirements for Federal Awards H[FOXGLQJVHFWLRQV†Procurement Standards UHIHUHQFH)HGHUDO+LJKZD\ $GPLQLVWUDWLRQ'HFHPEHU0HPRUDQGXP$FWLRQ2 CFR 200 Implementation Guidance $WWDFKPHQW$  $JHQF\VWDWHRQO\IXQGHG 62) DJUHHPHQWVPXVWFRQWDLQWKHUHTXLUHGIHGHUDOILVFDOSURYLVLRQVIURP &)5LQDOO'LYLVLRQRI/RFDO$VVLVWDQFHIXQGHGDJUHHPHQWV([KLELW5A&E Boilerplate Agreement Language FRQWDLQV&)5UHTXLUHPHQWVDQGPD\DOVREHXVHGLQ62)DJUHHPHQWV 'HSHQGLQJXSRQWKHVFRSHRIZRUNWKHUHTXLUHGFRQWUDFWSURYLVLRQVPD\QHHGWRLQFOXGHWKH&DOLIRUQLD 6WDWH3UHYDLOLQJ:DJHV $OOSURSRVHG$ (FRQWUDFWVDQGVXSSRUWLQJGRFXPHQWV LQFOXGLQJVWDWHRQO\IXQGHG DUHVXEMHFWWRDXGLW RUUHYLHZE\&DOWUDQV¶,QGHSHQGHQW2IILFHRI,QGHSHQGHQW2IILFHRI$XGLWVDQG,QYHVWLJDWLRQV ,2$,  RWKHUVWDWHDXGLWRUJDQL]DWLRQVRUWKHIHGHUDOJRYHUQPHQWDQGUHTXLUHGWRIROORZ/$306HFWLRQ A&E Consultant Audit and Review Process )RUFRQVXOWDQWFRQWUDFWVSURFXUHGZLWKORFDORUVWDWHIXQGVWRSURYLGHVHUYLFHVIRUIHGHUDODLGSURMHFWV RUWRRYHUVHHRUPDQDJHRWKHUFRQVXOWDQWVSURYLGLQJWKHVHVHUYLFHVWKH&RQVXOWDQWLQ0DQDJHPHQW 6XSSRUW5ROHSURFHVVPXVWEHFRPSOHWHGWREHHOLJLEOHIRUUHLPEXUVHPHQW5HIHUWR&KDSWHU 0LVFHOODQHRXV&RQVLGHUDWLRQVRetaining a Consultant as an Agency Engineer or in a Management Support Role KWWSVGRWFDJRYPHGLDGRWPHGLDSURJUDPVORFDODVVLVWDQFHGRFXPHQWVODSPFKSGI '%(FRQWUDFWJRDOVDUHQRWUHTXLUHGIRUVWDWHRQO\IXQGHGFRQWUDFWV 7KLVJXLGDQFHLVIRUFRQWUDFWVXWLOL]LQJVWDWHIXQGVRQO\,IDQ\IHGHUDOIXQGVDUHDGGHGRUUHLPEXUVHG WKHIHGHUDOSURFHVVPXVWEHIROORZHG 1RQ$ (FRQVXOWDQWFRQWUDFWVUHIHUHQFH/$306HFWLRQNon-A&E Contracts Reference: California Government Code Title 1, Division 5, Chapter 10, Contracts with Private Architects, Engineering, Land Surveying, and Construction Project Management Firms §4525-4529.5. '(),1,7,212)$ ( $UFKLWHFWXUDOODQGVFDSHDUFKLWHFWXUDOHQJLQHHULQJHQYLURQPHQWDODQGODQGVXUYH\LQJVHUYLFHVLQFOXGHV WKRVHSURIHVVLRQDOVHUYLFHVRIDQDUFKLWHFWXUDOODQGVFDSHDUFKLWHFWXUDOHQJLQHHULQJHQYLURQPHQWDORU ODQGVXUYH\LQJQDWXUHDVZHOODVLQFLGHQWDOVHUYLFHVWKDWPHPEHUVRIWKHVHSURIHVVLRQVDQGWKRVHLQWKHLU HPSOR\PD\ORJLFDOO\RUMXVWLILDEO\SHUIRUP WĂŐĞϲϬŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 103 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ &RQVWUXFWLRQSURMHFWPDQDJHPHQWPHDQVWKRVHVHUYLFHVSURYLGHGE\DOLFHQVHGDUFKLWHFWUHJLVWHUHG HQJLQHHURUOLFHQVHGJHQHUDOFRQWUDFWRU$Q\LQGLYLGXDORUILUPSURSRVLQJWRSURYLGHFRQVWUXFWLRQ SURMHFWPDQDJHPHQWVHUYLFHVVKDOOSURYLGHHYLGHQFHWKDWWKHLQGLYLGXDORUILUPDQGLWVSHUVRQQHO FDUU\LQJRXWRQVLWHUHVSRQVLELOLWLHVKDYHH[SHUWLVHDQGH[SHULHQFHLQFRQVWUXFWLRQSURMHFWGHVLJQUHYLHZ DQGHYDOXDWLRQFRQVWUXFWLRQPRELOL]DWLRQDQGVXSHUYLVLRQELGHYDOXDWLRQSURMHFWVFKHGXOLQJFRVW EHQHILWDQDO\VLVFODLPVUHYLHZDQGQHJRWLDWLRQDQGJHQHUDOPDQDJHPHQWDQGDGPLQLVWUDWLRQRID FRQVWUXFWLRQSURMHFW (QYLURQPHQWDOVHUYLFHVPHDQWKRVHVHUYLFHVSHUIRUPHGLQFRQQHFWLRQZLWKSURMHFWGHYHORSPHQWDQG SHUPLWSURFHVVLQJLQRUGHUWRFRPSO\ZLWKIHGHUDODQGVWDWHHQYLURQPHQWDOODZV Reference: California Government Code §4527 0,1,080$8',75(48,5(0(176 A. Written Procedures /RFDODJHQFLHVVKDOOIROORZWKHPLQLPXPUHTXLUHPHQWVOLVWHGEHORZLQDGGLWLRQWRDQ\ORFDOODZVDQG UHJXODWLRQV Reference: California Government Code §4526 B. Conflict of Interest 7KHORFDODJHQF\PXVWGHYHORSDQGPDLQWDLQDZULWWHQFRGHRIFRQGXFWJRYHUQLQJWKHSHUIRUPDQFHRILWV HPSOR\HHVHQJDJHGLQWKHDZDUGDQGDGPLQLVWUDWLRQRIVWDWHIXQGHGFRQWUDFWVLQFOXGLQJWKHSUHYHQWLRQ RIFRQIOLFWVRILQWHUHVW References: California Government Code §4526 California Government Code §1090 California Government Code §4529.12 C. Records /RFDODJHQFLHVVKDOONHHSDGHTXDWHUHFRUGVRIDOOFRQWUDFWVLQFOXGLQJWKHSURFXUHPHQWSURMHFW PDQDJHPHQWDFFRXQWLQJDQGILQDQFLDODGPLQLVWUDWLRQ References: California Government Code §4529.14 California Government Code §4006 D. Full & Open competition $OO$ (FRQWUDFWVVKDOOEHSURFXUHGWKURXJKDTXDOLILFDWLRQVEDVHGVHOHFWLRQXWLOL]LQJRSHQDQGIDLU FRPSHWLWLRQ(YDOXDWHDWOHDVWWKUHHFRQVXOWDQWVXVLQJSXEOLVKHGHYDOXDWLRQFULWHULDDQGUDQNWKHVHILUPV LQRUGHURISUHIHUHQFH References: California Government Code §4526 California Government Code §4527 WĂŐĞϲϭŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 104 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ E. Selection Basis 6HOHFWLRQRIDILUPVKDOOEHEDVHGRQTXDOLILFDWLRQVDQGWKHRUGHURIUDQNHGSUHIHUHQFH References: California Government Code §4526 California Government Code §4527 F.Publication 6ROLFLWDWLRQVIRU$ (FRQWUDFWVVKDOOEHLQDPDQQHUWKDWLVRSHQDQGFRPSHWLWLYH Reference: California Government Code §4527 G.Solicitation 7KHVROLFLWDWLRQVVKDOOLQFOXGHSXEOLVKHGHYDOXDWLRQFULWHULDWRUDQNLQRUGHURISUHIHUHQFH&OHDUO\GHILQH H[SHFWDWLRQVLQWKHVROLFLWDWLRQLQRUGHUWRHYDOXDWHILUPV Reference: California Government Code §4527 H.Cost Analysis $QLQGHSHQGHQWFRVWFRPSDULVRQWRWKHFRQVXOWDQW¶VFRVWSURSRVDOVKDOOEHGRQHLQRUGHUWRHQVXUHWKH FRQWUDFWLVQHJRWLDWHGDWDIDLUDQGUHDVRQDEOHSULFH Reference: California Government Code §4528 I.Negotiations 1HJRWLDWLRQVPXVWEHGRFXPHQWHGWRYHULI\DIDLUDQGUHDVRQDEOHFRQWUDFWKDVEHHQH[HFXWHGXVLQJ SXEOLFIXQGV Reference: California Government Code §4528 J.Audit and Review Process $ (FRQWUDFWVSURFXUHGE\SXEOLFDJHQFLHVVKDOOEHVXEMHFWWRVWDQGDUGDFFRXQWLQJSUDFWLFHVDQGPD\ UHTXLUHILQDQFLDODQGSHUIRUPDQFHDXGLWV$OODJHQFLHVVKDOOIROORZWKH$XGLWDQG5HYLHZ3URFHVVDV VWDWHGLQ/$306HFWLRQA&E Consultant Audit and Review Process KWWSVGRWFDJRYPHGLDGRWPHGLDSURJUDPVORFDODVVLVWDQFHGRFXPHQWVODSPFKSGI KWWSVGRWFDJRYPHGLDGRWPHGLDSURJUDPVORFDODVVLVWDQFHGRFXPHQWVODSPFDSGI Reference: California Government Code §4529.14 K. Exhibit 10-C.2: State-Only Funded A&E Contracts ([KLELW&State-Only Funded A&E Consultant Contract Reviewers Checklist PXVWEHVHQWWR DHRYHUVLJKW#GRWFDJRYIRUUHYLHZSULRUWRFRQWUDFWDZDUG WĂŐĞϲϮŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 105 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ CA Government Code References California GOV §1090 (a) Members of the Legislature, state, county, district, judicial district, and city officers or employees shall not be financially interested in any contract made by them in their official capacity, or by any body or board of which they are members. Nor shall state, county, district, judicial district, and city officers or employees be purchasers at any sale or vendors at any purchase made by them in their official capacity. (b) An individual shall not aid or abet a Member of the Legislature or a state, county, district, judicial district, or city officer or employee in violating subdivision (a). (c) As used in this article, “district” means any agency of the state formed pursuant to general law or special act, for the local performance of governmental or proprietary functions within limited boundaries. California GOV §4006 Plans, specifications, work authorizations describing work to be performed, and all other information referred to in this chapter are open to inspection and examination as a public record. California GOV §4525 For purposes of this chapter, the following terms have the following meaning: (a) “Firm” means any individual, firm, partnership, corporation, association, or other legal entity permitted by law to practice the profession of architecture, landscape architecture, engineering, environmental services, land surveying, or construction project management. (b) “State agency head” means the secretary, administrator, or head of a department, agency, or bureau of the State of California authorized to contract for architectural, landscape architectural, engineering, environmental, land surveying, and construction project management services. (c) “Local agency head” means the secretary, administrator, or head of a department, agency, or bureau of any city, county, city and county, whether general law or chartered, or any district which is authorized to contract for architectural, landscape architectural, engineering, environmental, land surveying, and construction project management services. (d) “Architectural, landscape architectural, engineering, environmental, and land surveying services” includes those professional services of an architectural, landscape architectural, engineering, environmental, or land surveying nature as well as incidental services that members of these professions and those in their employ may logically or justifiably perform. (e) “Construction project management” means those services provided by a licensed architect, registered engineer, or licensed general contractor which meet the requirements of Section 4529.5 for management and supervision of work performed on state construction projects. (f) “Environmental services” means those services performed in connection with project development and permit processing in order to comply with federal and state environmental laws. “Environmental services” also includes the processing and awarding of claims pursuant to Chapter 6.75 (commencing with Section 25299.10) of Division 20 of the Health and Safety Code. California GOV §4526 Notwithstanding any other provision of law, selection by a state or local agency head for professional services of private architectural, landscape architectural, engineering, environmental, land surveying, or construction project management firms shall be on the basis of demonstrated competence and on the professional qualifications necessary for the satisfactory performance of the services required. In order to implement this method of selection, state agency heads contracting for private architectural, landscape architectural, professional engineering, environmental, land surveying, and construction project management services shall adopt by regulation, and local agency heads contracting for private architectural, landscape architectural, professional engineering, environmental, land surveying, and construction project management services may adopt by ordinance, procedures that assure that these services are engaged on the basis of demonstrated competence and qualifications for the types of services to be performed and at fair and reasonable prices to the public WĂŐĞϲϯŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 106 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ agencies. Furthermore, these procedures shall assure maximum participation of small business firms, as defined by the Director of General Services pursuant to Section 14837. In addition, these procedures shall specifically prohibit practices which might result in unlawful activity including, but not limited to, rebates, kickbacks, or other unlawful consideration, and shall specifically prohibit government agency employees from participating in the selection process when those employees have a relationship with a person or business entity seeking a contract under this section which would subject those employees to the prohibition of Section 87100. California GOV §4527 In the procurement of architectural, landscape architectural, engineering, environmental, land surveying, and construction project management services, the state agency head shall encourage firms engaged in the lawful practice of their profession to submit annually a statement of qualifications and performance data. (a) When the selection is by a state agency head, statewide announcement of all projects requiring architectural, landscape architectural, engineering, environmental, land surveying, or construction project management services shall be made by the agency head through publications of the respective professional societies. The agency head, for each proposed project, shall evaluate current statements of qualifications and performance data on file with the agency, together with those that may be submitted by other firms regarding the proposed project, and shall conduct discussions with no less than three firms regarding anticipated concepts and the relative utility of alternative methods of approach for furnishing the required services and then shall select therefrom, in order of preference, based upon criteria established and published by him or her, no less than three of the firms deemed to be the most highly qualified to provide the services required. (b) When the selection is by a local agency head, the agency head may undertake the procedures described in subdivision (a). In addition, these procedures shall specifically prohibit practices which might result in unlawful activity including, but not limited to, rebates, kickbacks, or other unlawful consideration, and shall specifically prohibit government agency employees from participating in the selection process when these employees have a relationship with a person or business entity seeking a contract under this section. California GOV §4528 (a) When the selection is by a state agency head the following procedures shall apply: (1) The state agency head shall negotiate a contract with the best qualified firm for architectural, landscape architectural, engineering, environmental, land surveying, and construction project management services at compensation which the state agency head determines is fair and reasonable to the State of California or the political subdivision involved. (2) Should the state agency head be unable to negotiate a satisfactory contract with the firm considered to be the most qualified, at a price the agency head determines to be fair and reasonable to the State of California or the political subdivision involved, negotiations with that firm shall be formally terminated. The state agency head shall then undertake negotiations with the second most qualified firm. Failing accord with the second most qualified firm, the state agency head shall terminate negotiations. The state agency head shall then undertake negotiations with the third most qualified firm. (3) Should the state agency head be unable to negotiate a satisfactory contract with any of the selected firms, the state agency head shall select additional firms in order of their competence and qualification and continue negotiations in accordance with this chapter until an agreement is reached. (b) When the selection is by a local agency head, the local agency head may undertake the procedures described in subdivision (a). California GOV §4529 This chapter shall not apply where the state or local agency head determines that the services needed are more of a technical nature and involve little professional judgment and that requiring bids would be in the public interest. WĂŐĞϲϰŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 107 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ California GOV §4529.12 All architectural and engineering services shall be procured pursuant to a fair, competitive selection process which prohibits governmental agency employees from participating in the selection process when they have a financial or business relationship with any private entity seeking the contract, and the procedure shall require compliance with all laws regarding political contributions, conflicts of interest or unlawful activities. California GOV §4529.14 Architectural and engineering services contracts procured by public agencies shall be subject to standard accounting practices and may require financial and performance audits as necessary to ensure contract services are delivered within the agreed schedule and budget. California GOV §4529.20 This act seeks to comprehensively regulate the matters which are contained within its provisions. These are matters of statewide concern and when enacted are intended to apply to charter cities as well as all other governmental entities. Federal Highway Administration Memorandum 2 CFR 200 Implementation Guidance 12/4/2014 Attachment A: FHWA 2 CFR 200 Uniform Guidance – Questions and Answers Question 21: “Will the FHWA/USDOT provide a waiver of the requirements in 2 CFR 200.317 for subrecipients to comply with State procurement requirements or other policies and procedures approved by the State (200.317)?” Answer: Yes. The USDOT requested and received an OMB waiver of the requirements in 2 CFR 200.317 concerning procurement by subrecipients. This waiver provides an exception to the requirement for all subrecipients of a state to follow the procurement requirements in Sections 200.318 through 200.326. The waiver will allow States and subrecipients to continue to use state-approved procurement procedures as they did under part 18 prior to the adoption of the Uniform Guidance. WĂŐĞϲϱŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 108 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ &ŝŐƵƌĞϭϬ͘Ϯ^ƚĂƚĞͲKŶůLJ&ƵŶĚĞĚWƌŽĐƵƌĞŵĞŶƚƌŝƚĞƌŝĂ WĂŐĞϲϲŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 109 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 121$ (&2175$&76 6&23( 7KLVVHFWLRQFRYHUVWKHSURFXUHPHQWUHTXLUHPHQWVIRUWKHVHUYLFHVWKDWDUHQRWLQFOXGHGLQ 6HFWLRQ)HGHUDODQG6HFWLRQ6WDWH2QO\7KLVJXLGDQFHLVIRUFRQWUDFWVXWLOL]LQJIHGHUDO DLGIXQGVDQGVWDWHIXQGV)HGHUDOUHJXODWLRQVUHIHUWRVWDWHDQGORFDOUHJXODWLRQVIRUQRQ$ ( W\SHFRQWUDFWV$OWKRXJKORFDODJHQFLHVDUHUHTXLUHGWRIROORZ2 CFR 200: Uniform Administrative Requirements, Cost Principles, and Audit Requirements for Federal Awards IRUDOOFRQWUDFWVWKH 3URFXUHPHQW6WDQGDUGVVHFWLRQ†LVH[HPSW7KHJXLGDQFHLQWKLVVHFWLRQIROORZV WKHHVWDEOLVKHGUHJXODWLRQVLQWKH&DOLIRUQLD3XEOLF&RQWUDFW&RGH'HSHQGLQJXSRQWKHVFRSHRI ZRUNWKHUHTXLUHGFRQWUDFWSURYLVLRQVPD\QHHGWRLQFOXGHWKH&DOLIRUQLD6WDWH3UHYDLOLQJ:DJHV /RFDODJHQF\VKDOOGHVLJQDWHRQHSHUVRQZLWKLQWKHORFDODJHQF\DVDFRQWUDFWPDQDJHU 3&&  '(7(50,1,1*121$ ( $IWHULGHQWLI\LQJWKDWWKHUHLVDQHHGIRUFRQVXOWLQJVHUYLFHVWKHORFDODJHQF\VKDOOGHWHUPLQHWKDW WKHVHUYLFHVQHHGHGDUHPRUHRIDWHFKQLFDOQDWXUHDQGLQYROYHPLQLPDOSURIHVVLRQDOMXGJHPHQW DQGWKDWUHTXLULQJDFRVWSURSRVDOZRXOGEHLQWKHSXEOLF·VEHVWLQWHUHVW7KHVHW\SHRIFRQVXOWDQW VHUYLFHVWKDWDUHQRWGLUHFWO\UHODWHGWRDKLJKZD\FRQVWUXFWLRQSURMHFWRUWKDWDUHQRWLQFOXGHGLQ WKHGHILQLWLRQRIHQJLQHHULQJDQGGHVLJQUHODWHGVHUYLFHVDUHFRQVLGHUHGQRQ$ (7KHVHUYLFHV PXVWQRWEHLQFOXGHGLQ6HFWLRQ'HILQLWLRQRI$ ( 7KHGHWHUPLQLQJIDFWRULVZKHWKHUWKHVHUYLFHVEHLQJSURFXUHGDUHUHODWHGWRDVSHFLILFFRQVWUXFWLRQ SURMHFWDQGZKHWKHUWKHVHUYLFHVUHTXLUHZRUNWREHSHUIRUPHGSURYLGHGE\RUXQGHUWKHGLUHFWLRQ RIDUHJLVWHUHGHQJLQHHURUDUFKLWHFW (;$03/(2)'(7(50,1,1*121$ ( 0DWHULDOWHVWLQJKDVEHHQUHTXHVWHGWRHQVXUHTXDOLW\DVVXUDQFHRQDFRQVWUXFWLRQSURMHFW7KH VHUYLFHLQFOXGHVRQO\SHUIRUPLQJWKHPDWHULDOWHVWDQGSURYLGLQJPDWHULDOWHVWGDWD$OWKRXJKWKH VHUYLFHLVUHODWHGWRDFRQVWUXFWLRQSURMHFWWKHRYHUDOOVHUYLFHGLGQRWSURYLGHDQHYDOXDWLRQRUD GLVFLSOLQHUHSRUW,QWKLVH[DPSOHWKHORFDODJHQF\FDQGHWHUPLQHWKDWWKHVHUYLFHSURYLGHGLVPRUH RIDWHFKQLFDOQDWXUHDQGLVWKHUHIRUHDQRQ$ (VHUYLFH 7KHIROORZLQJLVDOLVWRIWKHPRUHFRPPRQQRQ$ (VHUYLFHV x5LJKWRI:D\$SSUDLVDO x5LJKWRI:D\DFTXLVLWLRQDFWLYLWLHV x&RQGXFWLQJSXEOLFRXWUHDFKGXULQJHQYLURQPHQWDOFOHDUDQFHRUFRQVWUXFWLRQ x$FWLYH7UDQVSRUWDWLRQ3URJUDPHGXFDWLRQDODQGRXWUHDFKDFWLYLWLHV x,QWHOOLJHQW7UDQVSRUWDWLRQ6\VWHP ,76  x1RQ,QIUDVWUXFWXUH WĂŐĞϲϳŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 110 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ ,17(//,*(1775$163257$7,216<67(0 ,76 352-(&76 ,QWHOOLJHQW 7UDQVSRUWDWLRQ 6\VWHP ,76  PHDQV HOHFWURQLF FRPPXQLFDWLRQV RU LQIRUPDWLRQ SURFHVVLQJ XVHG VLQJO\ RU LQ FRPELQDWLRQ WR LPSURYH WKH HIILFLHQF\RUVDIHW\RIDVXUIDFH WUDQVSRUWDWLRQV\VWHP,76SURMHFWVDUHWKRVHWKDWLQZKROHRULQSDUWIXQGVWKHDFTXLVLWLRQRI WHFKQRORJLHVRUV\VWHPVRIWHFKQRORJLHVWKDWSURYLGHVLJQLILFDQWFRQWULEXWLRQVWRWKHSURYLVLRQRI RQHRUPRUH,76XVHUVHUYLFHVDVGHILQHGLQWKH1DWLRQDO,76$UFKLWHFWXUH 7KHIHGHUDODLGSURFXUHPHQWUHJXODWLRQVLGHQWLI\WKUHHSRVVLEOHFRQWUDFWSURFXUHPHQWSURFHGXUHV IRU,76SURMHFWVLQFOXGLQJHQJLQHHULQJDQGGHVLJQUHODWHGVHUYLFHV $ ( FRQVWUXFWLRQDQGQRQ HQJLQHHULQJQRQDUFKLWHFWXUDO QRQ$ (  ,I,76SURMHFWVLQFOXGHSK\VLFDOLQVWDOODWLRQRIILHOGGHYLFHVDQGRUFRPPXQLFDWLRQVLQIUDVWUXFWXUH VXFK DV QHZ WUDIILF VLJQDOV QHZ FRQWUROOHU FDELQHWV FKDQJHDEOH PHVVDJH VLJQV UDGLR DQG FRPSXWHUVYHKLFOHGHWHFWRUVDQGFRQGXLWVIRUFDEOLQJLQWKHURDGZD\WKHQWKDWZRUNDQGUHTXLUHG HTXLSPHQWXVXDOO\PHHWVWKHGHILQLWLRQRIFRQVWUXFWLRQ7KHFRQVWUXFWLRQFRQWUDFWPXVWEHSURFXUHG EDVHG RQ FRPSHWLWLYH ELGGLQJ ,I WKH ,76 SURMHFW LQYROYHV VRIWZDUH GHYHORSPHQW V\VWHP LQWHJUDWLRQKLULQJHQJLQHHUVDQGVSHFLDOLVWVIRU,76GHVLJQDQGLQVWDOODWLRQVXSSRUWLQVSHFWLRQ GHVLJQGRFXPHQWDWLRQWUDLQLQJDQGGHSOR\PHQWLWPD\EHFRQVLGHUHGDQHQJLQHHULQJDQGGHVLJQ VHUYLFHVFRQWUDFWDQGWKHFRQWUDFWPXVWEHSURFXUHGDVDQ$ (FRQVXOWDQWFRQWUDFW,IWKHVFRSHRI ZRUNLVXQFOHDUDVWRZKHWKHULWLVDQ$ (W\SHRIZRUNFRQWDFWDHRYHUVLJKW#GRWFDJRYIRU DVVLVWDQFH +RZHYHULIDQ,76SURMHFWGRHVQRWPHHWHLWKHUWKHGHILQLWLRQRIFRQVWUXFWLRQRUHQJLQHHULQJDQG GHVLJQVHUYLFHVWKHQWKHFRQWUDFWPD\EHFRQVLGHUHGWREHDQRQ$ (FRQVXOWDQWFRQWUDFW ([DPSOHVRIQRQ$ (FRQVXOWDQWFRQWUDFWVDUH x7KHSURFXUHPHQWRIKDUGZDUHDQGVRIWZDUHDVVRFLDWHGZLWKLQFLGHQWPDQDJHPHQWV\VWHP x6RIWZDUHV\VWHPVIRUDUWHULDODQGIUHHZD\PDQDJHPHQWV\VWHPV x2SHUDWLQJWKHWUDYHOHULQIRUPDWLRQVHUYLFH x1RQSURIHVVLRQDOVHUYLFHVIRUV\VWHPVXSSRUWVXFKDVLQGHSHQGHQWYDOLGDWLRQDQGYHULILFDWLRQ WHVWLQJDQGVSHFLILFDWLRQGHYHORSPHQW )RUPRUHLQIRUPDWLRQUHJDUGLQJ,QWHOOLJHQW7UDQVSRUWDWLRQ6\VWHPV ,76 3URJUDPSURFXUHPHQW UHTXLUHPHQWVUHIHUWR/$3*&KDSWHU/$3*&KDSWHU,QWHOOLJHQW7UDQVSRUWDWLRQ6\VWHPV 121,1)5$6758&785(352-(&76 1RQLQIUDVWUXFWXUH 1, SURMHFWVDUHWKRVHWUDQVSRUWDWLRQUHODWHGSURMHFWVWKDWGRQRWLQYROYHHLWKHU HQJLQHHULQJGHVLJQ5LJKWRI:D\DFTXLVLWLRQ IRUDGGLWLRQDOJXLGDQFHUHIHUWR/$30&KDSWHU  RUWKHHYHQWXDOSK\VLFDOFRQVWUXFWLRQRIWUDQVSRUWDWLRQIDFLOLWLHV 3URFXUHPHQWRIQRQ$ (FRQVXOWDQWFRQWUDFWVDVVRFLDWHGZLWKQRQLQIUDVWUXFWXUHSURMHFWVPXVW IROORZ1RQ$ (SURFXUHPHQWSURFHGXUHVGHVFULEHGLQWKLVFKDSWHU)RUPRUHLQIRUPDWLRQRQ1, SURMHFWVUHIHUWR/$30&KDSWHU3URMHFW$XWKRUL]DWLRQ WĂŐĞϲϴŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 111 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ *29(51,1*5(*8/$7,216$1'&2'(6)25121$ ( :KHQSURFXULQJQRQ$ (VHUYLFHVZLWKIHGHUDODLGIXQGV/RFDODJHQFLHVPXVWFRPSO\ZLWK&)5 3DUW8QLIRUP$GPLQLVWUDWLYH5HTXLUHPHQWV&RVW3ULQFLSOHVDQG$XGLW5HTXLUHPHQWVIRU )HGHUDO$ZDUGVH[FOXGLQJVHFWLRQV†3URFXUHPHQW6WDQGDUGV UHIHUHQFH)HGHUDO +LJKZD\$GPLQLVWUDWLRQ'HFHPEHU0HPRUDQGXP$FWLRQ&)5,PSOHPHQWDWLRQ *XLGDQFH$WWDFKPHQW$ /RFDODJHQFLHVPXVWIROORZWKHVDPHSROLFLHVDQGSURFHGXUHVWKDWWKH 6WDWHXVHVIRUSURFXUHPHQWZLWKLWVQRQ)HGHUDOIXQGV:KHQSURFXULQJQRQ$ (VHUYLFHVZLWK IHGHUDODLGDQGVWDWHRQO\IXQGVWKHJRYHUQLQJSURFXUHPHQWFRGHLV3XEOLF&RQWUDFW&RGH  352&85(0(172)121$ (&2168/7$17&2175$&76 $OOQRQ$ (SURFXUHPHQWVFRQWUDFWVPXVWEHFRQGXFWHGLQDPDQQHUSURYLGLQJIXOODQGRSHQ FRPSHWLWLRQ FRQVLVWHQWZLWK IHGHUDO DQGVWDWH VWDQGDUGV/RFDODJHQF\PXVW PHHWWKHFRGHRI FRQGXFWJRYHUQLQJWKHSHUIRUPDQFHRILWVHPSOR\HHVHQJDJHGLQWKHDZDUGDQGDGPLQLVWUDWLRQRI IHGHUDODLGDQGVWDWHIXQGHGFRQWUDFWVLQFOXGLQJWKHSUHYHQWLRQVRIFRQIOLFWRILQWHUHVWLQ3&&  7KHIROORZLQJDUHWKHIXQGDPHQWDOUXOHVZKHQSURFXULQJDQRQ$ (FRQVXOWDQWFRQWUDFW  7KHUHTXHVWIRUSURSRVDO 5)3 VKDOOQRWOLPLWWKHFRPSHWLWLRQGLUHFWO\RULQGLUHFWO\WRDQ\RQH FRQVXOWDQW7KH5)3PXVWEHSXEOLFL]HGDQGDOOHYDOXDWLRQIDFWR UVDQGWKHLUUHODWLYHLPSRUWDQFH LGHQWLILHG 3&&   6SOLWWLQJDVLQJOHWUDQVDFWLRQLQWRDVHULHVRIWUDQVDFWLRQVIRUWKHSXUSRVHRIHYDGLQJWKH SURFXUHPHQWUHTXLUHPHQWVLVQRWDOORZHG 3&&   /RFDODJHQF\VKDOOVHFXUHDWOHDVWWKUHHFRPSHWLWLYHSURSRVDOVIRUHDFKFRQWUDFW 3&&  :KHQUHFHLYLQJOHVVWKDQWKUHHSURSRVDOVUHIHUWRWKH&RVW(IIHFWLYH3XEOLF,QWHUHVW)LQGLQJLQ WKLVVHFWLRQDVDQDOWHUQDWLYHWRUHDGYHUWLVHPHQW  1RSURSRVDOVVKDOOEHFRQVLGHUHGZKLFKKDYHQRWEHHQUHFHLYHGDWWKHSODFHDQGSULRUWRWKH FORVLQJWLPHDVVWDWHGLQWKH5)3 3&& D   /RFDODJHQF\PXVWKDYHDZULWWHQSURFHGXUHIRUHYDOXDWLQJSURSRVDOV 3&&  5)3%$6,&5(48,5(0(176 $ 7KHUHDUHWZRJHQHUDOW\SHVRIFRQVXOWLQJVHUYLFHFRQWUDFWVROLFLWDWLRQV % 5HTXHVWIRU3URSRVDOXVLQJ&RVWRQO\ & 5HTXHVWIRU3URSRVDOXVLQJ&RVWDQG4XDOLILFDWLRQV 7KHORFDODJHQF\PXVWLQFOXGHWKHIROORZLQJLQWKHUHTXHVWIRUSURSRVDO $ $FOHDUSUHFLVHGHVFULSWLRQRIWKHZRUNWREHSHUIRUPHGRUVHUYLFHVWREHSURYLGHG % 'HVFULSWLRQRIWKHIRUPDWWKDWSURSRVDOVVKDOOIROORZDQGWKHHOHPHQWVWKH\VKDOOFRQWDLQ & 7KHVWDQGDUGVWKHDJHQF\ZLOOXVHLQHYDOXDWLQJSURSRVDOV7KLVLQFOXGHVTXDOLILFDWLRQVDQG FHUWLILFDWLRQVLIDSSOLFDEOH ' 7KHGDWHWKHSURSRVDOVDUHGXH WĂŐĞϲϵŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 112 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ ( 7KHSURFXUHPHQWVFKHGXOHWKDWWKHORFDODJHQF\ZLOOIROORZLQUHYLHZLQJDQGHYDOXDWLQJWKH SURSRVDOV 3&&  $'',7,21$/5(48,5(0(176$1'(9$/8$7,21&5,7(5,$ $GGLWLRQDO5HTXLUHPHQWVIRU5HTXHVWIRU3URSRVDOXVLQJ&RVWRQO\ $ /RFDODJHQF\PXVWUHTXLUHFRQVXOWDQWVWRVXEPLWWKHLUSURSRVDOVDQGFRVWLQDVHSDUDWHVHDOHG HQYHORSH % /RFDO DJHQF\ VKDOO GHWHUPLQH WKRVH WKDW PHHW WKH IRUPDW UHTXLUHPHQWVDQGWKHVWDQGDUGV VSHFLILHGLQWKHUHTXHVWIRUSURSRVDO & 7KHVHDOHGHQYHORSHVFRQWDLQLQJWKHSULFHDQGFRVWLQIRUPDWLRQIRUWKRVHSURSRVDOVWKDWPHHW WKHIRUPDWUHTXLUHPHQWVDQGVWDQGDUGVVKDOOWKHQEHSXEOLFO\RSHQHGDQGUHDG ' &RQWUDFWPXVWEHDZDUGHGWRWKHORZHVWUHVSRQVLEOHFRQVXOWDQWPHHWLQJWKHVWDQGDUGV 3&& E  $GGLWLRQDO5HTXLUHPHQWVIRU5HTXHVWIRU3URSRVDOXVLQJ&RVWDQG4XDOLILFDWLRQV $/RFDODJHQF\PXVWLQFOXGHLQWKHSURSRVDOWKHGHVFULSWLRQRIWKHHYDOXDWLRQDQGVFRULQJ PHWKRG6XEVWDQWLDOZHLJKWLQUHODWLRQVKLSWRDOORWKHUFULWHULDXWLOL]HGVKDOOEHJLYHQWRWKHFRVW DPRXQWSURSRVHGE\WKHFRQVXOWDQW % /RFDODJHQF\VKDOOGHWHUPLQHWKRVHWKDWPHHWWKHIRUPDWUHTXLUHPHQWVVSHFLILHGLQWKH5)3 & /RFDODJHQF\HYDOXDWLRQFRPPLWWHHPXVWHYDOXDWHDQGVFRUHWKHSURSRVDOVXVLQJWKHPHWKRGV VSHFLILHGLQWKH5)3$OOHYDOXDWLRQDQGVFRULQJVKHHWVVKDOOEHDYDLODEOHIRUSXEOLFLQVSHFWLRQ DIWHUWKHFRPPLWWHHVFRULQJSURFHVV(YDOXDWLRQFRPPLWWHHVKRXOGFRPSO\WRWKHSUHYHQWLRQRI FRQIOLFWRILQWHUHVWLQ3&& ' 7KHQRQ$ (FRQWUDFWVKDOOEHDZDUGHGWRWKHFRQVXOWDQWZKRVHSURSRVDOLVJLYHQWKHKLJKHVW VFRUHE\WKHHYDOXDWLRQFRPPLWWHH 3&& F  :KHQXVLQJ5)3 &RVWDQG4XDOLILFDWLRQV WKHFULWHULDXVHGWRHYDOXDWHWKHFRQVXOWDQW·VSURSRVDOV PXVWKDYHDORJLFDOIRXQGDWLRQZLWKLQWKHVFRSHRIZRUNRUZLWKLQRWKHUWHFKQLFDOUHTXLUHPHQWV FRQWDLQHGLQWKH5)3(DFKFULWHULRQPXVWKDYHDZHLJKWRUOHYHORILPSRUWDQFHDQGLWLV UHFRPPHQGHGWKDWWRWDOSRVVLEOHVFRUHIRUWKHHYDOXDWLRQFULWHULDEHRQHKXQGUHG  SRLQWV7KH SURSRVHGFRVWVKRXOGEHDWOHDVWWKLUW\SHUFHQW  RIWRWDOSRLQWVLQHYDOXDWLRQFULWHULD $QH[DPSOH5)3IRUQRQ$ (LVSURYLGHGRQWKH/RFDO$VVLVWDQFHZHEVLWHDW KWWSZZZGRWFDJRYKT/RFDO3URJUDPV$(5)3([DPSOH1RQ$(GRF[DQGPD\EH PRGLILHG 6XEPLVVLRQRIExhibit 10-C Consultant Contract Reviewers Checklist WR&DOWUDQV+4IRUDFFHSWDQFHLV QRWUHTXLUHGIRUQRQ$ (FRQVXOWDQWFRQWUDFWV &2168/7$17·6352326$/ 7KHFRQVXOWDQW·VSURSRVDOVKRXOGLQFOXGHWKHIROORZLQJLQIRUPDWLRQ WĂŐĞϳϬŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 113 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ xConsultant Project Manager ²TXDOLILFDWLRQVUROHVDQGUHVSRQVLELOLWLHV xMethodology  GHVFULSWLRQRIZRUNDQGRYHUDOODSSURDFKVSHFLILFWHFKQLTXHVWKDWZLOOEHXVHGDQG VSHFLILFDGPLQLVWUDWLYHDQGRSHUDWLRQVH[SHUWLVHWREHXVHG xWorkplan and Work Schedule  WKHWHFKQLFDOSURSRVDOVKRXOGLQFOXGHDFWLYLWLHVDQGWDVNVDQGWKHLU GHOLYHU\VFKHGXOH xPersonnel  /LVWRISHUVRQQHOZKRZLOOEHZRUNLQJRQWKHSURMHFWDQGWKHLUUHVXPHV xFacilities and resources ,IDSSOLFDEOH  ([SODQDWLRQRIZKHUHWKHVHUYLFHVZLOOEHSURYLGHGDQG ZKDWW\SHRIHTXLSPHQWLVQHHGHGWRSHUIRUPVHUYLFHV xSub-contracts  ,GHQWLI\DOOVXEFRQWUDFWVWKDWDUHWREHXVHGGHVFULSWLRQRIHDFKDQGWKHZRUNE\ HDFKVXEFRQVXOWDQWVXEFRQWUDFWRU1RZRUNVKDOOEHVXEFRQWUDFWHGXQOHVVOLVWHGLQWKHWHFKQLFDO SURSRVDO6XEFRQVXOWDQWUHVXPHVVKRXOGEHSURYLGHG xReferences  7KHWHFKQLFDOSURSRVDOVKRXOGSURYLGHDWOHDVWWKUHH  FOLHQWVIRUZKRPWKHSURSRVHU KDVSHUIRUPHGZRUNRIVLPLODUQDWXUHWRWKHUHTXHVW &267352326$/:25.6+((7 7KH5)3VKRXOGSURYLGHDVWDQGDUGIRUPDWIRUFRVWSURSRVDOWKDWDOOSURSRVHUVPXVWLQFOXGHLQWKHLU SURSRVDO7KHFRVWSURSRVDOIRUPDWFDQEHEURNHQGRZQE\VSHFLILFWDVNVVKRZLQJKRXUO\ODERU UDWHVOHYHORIHIIRUWDQGPDWHULDODQGRUE\PLOHVWRQHVDQGGHOLYHUDEOHV /RFDODJHQF\LVQRWUHTXLUHGWRDZDUGDFRQWUDFWLILWLVGHWHUPLQHGWKDWWKHFRQWUDFWSULFHLVQRW UHDVRQDEOH 3&& F  '%(&216,'(5$7,21 '%(FRQVLGHUDWLRQLVUHTXLUHGRQDOOIHGHUDODLGIXQGHGFRQWUDFWVLQFOXGLQJQRQ$ ( $'0,1,675$7,9(5(48,5(0(176 $GYHUWLVHPHQWIRU5)3VPD\EHWKURXJKWKHORFDODJHQF\ZHEVLWHORFDOSXEOLFDWLRQVDQGQDWLRQDO SXEOLFDWLRQV 0LQLPXP VROLFLWDWLRQ WLPH LV  FDOHQGDU GD\V 7KH VROLFLWDWLRQ VKRXOG LQIRUP SRWHQWLDOTXDOLILHGFRQVXOWDQWVWKDWTXHVWLRQVPXVWEHVXEPLWWHGLQZULWLQJWRWKH$JHQF\&RQWUDFW 0DQDJHU$GPLQLVWUDWRUE\DVSHFLILHGGDWHDQGWLPH$OOSHUWLQHQWWHFKQLFDOLQIRUPDWLRQDQG DQVZHUVWRFRQVXOWDQW·VTXHVWLRQVVKDOOEHSURYLGHGWRDOOSRWHQWLDOFRQVXOWDQWV:ULWWHQUHVSRQVHV WRDOOTXHVWLRQVZLOOEHFROOHFWLYHO\FRPSLOHGDQGSURYLGHGDVDQDGGHQGXP $SURSRVDOPD\EHFRQVLGHUHGQRQUHVSRQVLYHDQGUHMHFWHGZLWKRXW HYDOXDWLRQLI DOO UHTXLUHG LQIRUPDWLRQLVQRWSURYLGHG3URSRVDOVZLWKRXWLQIRUPDWLRQUHJDUGLQJRUQRWPHHWLQJWKHUHTXLUHG '%(XWLOL]DWLRQJRDORUZLWKRXWD*RRG)DLWK(IIRUWGRFXPHQWDWLRQODWHVXEPLWWDOVVXEPLWWDOVWR WKHZURQJORFDWLRQRUVXEPLWWDOVZLWKLQDGHTXDWHFRSLHVDUHFRQVLGHUHGQRQUHVSRQVLYHDQGVKDOO EH UHMHFWHG 6XEPLWWDO RI DGGLWLRQDO LQIRUPDWLRQ DIWHU WKH GXHGDWH VKDOO QRW EH DOORZHG 'RFXPHQWDWLRQRIZKHQHDFKSURSRVDOZDVUHFHLYHGPXVWEHPDLQWDLQHGLQWKHSURMHFWILOHV&RSLHV RIGDWHVWDPSHGHQYHORSHFRYHUVRUER[WRSVDUHUHFRPPHQGHG 1RFRQVXOWDQWZKRKDVEHHQDZDUGHGDFRQVXOWLQJVHUYLFHFRQWUDFWPD\EHDZDUGHGDVXEVHTXHQW FRQWUDFWIRUWKHVHUYLFHVRUJRRGVZKLFKDUHUHTXLUHGDVDQHQGSURGXFWRIWKHFRQVXOWLQJVHUYLFH FRQWUDFWXQOHVVWKHVXEFRQWUDFWLVQRPRUHWKDQSHUFHQWRIWKHWRWDOPRQHWDU\YDOXHRIWKH FRQVXOWLQJVHUYLFHVFRQWUDFW([FOXGHV$ (FRQWUDFWV WĂŐĞϳϭŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 114 >ŽĐĂůƐƐŝƐƚĂŶĐĞWƌŽĐĞĚƵƌĞƐDĂŶƵĂůŚĂƉƚĞƌϭϬ ŽŶƐƵůƚĂŶƚ^ĞůĞĐƚŝŽŶ 3&&  &RQWUDFWVPD\EHPRGLILHGRUDPHQGHGRQO\LIWKHFRQWUDFWVVRSURYLGH$PHQGPHQWVPXVWEH UHTXHVWHGDQGH[HFXWHGSULRUWRWKHWHUPLQDWLRQGDWHRIWKHPRVWUHFHQWO\DSSURYHGRULJLQDORU DPHQGHGFRQWUDFW$OOUHFRUGVRIFRQWUDFWDFWLYLWLHVVKDOOEHNHSWIRUWKUHH\HDUVDIWHUIHGHUDOILQDO YRXFKHU ( RU VWDWH ILQDO YRXFKHU IRU 6WDWH2QO\ IXQGV &RVWV DUH UHLPEXUVDEOH DIWHU VWDWH DOORFDWLRQE\WKH&DOLIRUQLD7UDQVSRUWDWLRQ&RPPLVVLRQ &7& DQGRUWKHLVVXDQFHRIWKHIHGHUDO (7KHSHUGLHPUDWHVKDOOQRWH[FHHGWKHVWDWHUDWH&RQWUDFW0DQDJHUVDUHUHVSRQVLEOHIRU PRQLWRULQJH[SHQGLWXUHVRQDOOFRQWUDFWVDQGYHULI\LQJFDWHJRULHVRIZRUNWKDWUHTXLUHSUHYDLOLQJ ZDJH$SHUVRQLQ5HVSRQVLEOH&KDUJHRIFRQWUDFWPDQDJHPHQWLVUHTXLUHGIRUDOOIHGHUDOO\IXQGHG SURMHFWV 25$/35(6(17$7,216237,21$/ :KHQRUDOSUHVHQWDWLRQVDUHUHTXLUHGE\WKHORFDODJHQF\WKHHYDOXDWLRQFULWHULDPXVWLQFOXGH IDFWRUVVXEIDFWRUVDQGZHLJKWVXVHGWRVFRUHWKHSURSRVHUVSHUIRUPDQFHDWWKHRUDOSUHVHQWDWLRQ 7KHHYDOXDWLRQFRPPLWWHHZLOORQO\EHDEOHWRVFRUHHDFKSURSRVHUEDVHGXSRQWKHVHFULWHULD7KH &RQWUDFW0DQDJHU$GPLQLVWUDWRUVKRXOGGHYHORSDVHWRITXHVWLRQVUHODWHGWRWKHVFRSHRIZRUNRU WKHSURMHFWWREHDVNHGGXULQJWKHHYDOXDWLRQFRPPLWWHHTXHVWLRQDQGDQVZHU 4 $ VHFWLRQRI WKHRUDOSUHVHQWDWLRQV$OOSURSRVHUVDUHDVNHGWKHVDPHTXHVWLRQVIRUFRQVLVWHQF\ 7KHFRPPLWWHHPXVWDOVRHYDOXDWHUHIHUHQFHFKHFNVDQGRWKHULQIRUPDWLRQJDWKHUHGLQGHSHQGHQWO\ 5HIHUHQFHFKHFNVVKDOOEHFRPSOHWHGDQGRWKHULQIRUPDWLRQJDWKHUHGEHIRUHWKHLQWHUYLHZVDUH FRQGXFWHG,IQHFHVVDU\WKHUHVXOWVRIWKHUHIHUHQFHFKHFNVRURWKHULQIRUPDWLRQPD\EHGLVFXVVHG ZLWKWKHKLJKHVWUDQNHGTXDOLILHGFRQVXOWDQWVDWWKHLQWHUYLHZV &267())(&7,9(38%/,&,17(5(67),1',1* $PLQLPXPRIWKUHHSURSRVDOPXVWEHHYDOXDWHGWRHVWDEOLVKHIIHFWLYHFRPSHWLWLRQ$Q\DJHQF\ WKDWKDVUHFHLYHGOHVVWKDQWKUHHSURSRVDOVRQDFRQWUDFWVKDOOGRFXPHQWWKHQDPHVDQGDGGUHVVHV RIWKHILUPVRULQGLYLGXDOVLWVROLFLWHGIRUSURSRVDOV3UHSDUHDQH[SODQDWLRQDVWRZK\OHVVWKDQ WKUHHSURSRVDOVZHUHUHFHLYHG:KHQRQO\WZRSURSRVDOVDUHUHFHLYHGDMXVWLILFDWLRQPXVWEH GRFXPHQWHGWRSURFHHGZLWKWKHSURFXUHPHQW:KHQRQO\RQHSURSRVDOLVUHFHLYHGD1RQ &RPSHWLWLYHSURFHVVPXVWEHMXVWLILHGDQGD3XEOLF,QWHUHVW)LQGLQJ 3,)  /$30([KLELW)&RVW (IIHFWLYH3XEOLF,QWHUHVW)LQGLQJ PXVWEHGRFXPHQWHG,QHLWKHUFDVHWKHUHDGYHUWLVHPHQWRIWKH 5)3VKRXOGEHFRQVLGHUHGDVDQRSWLRQ5HWDLQGRFXPHQWDVVXSSRUWLQJGRFXPHQWDWLRQLQWKH FRQWUDFWILOH 3&& F  3527(67$33($/65(,167$7(0(17352&('85(6 %RWKVWDWHDQGIHGHUDOUHJXODWLRQVUHTXLUHZHOOGHILQHGSURWHVWUHLQVWDWHPHQWSURFHGXUHV,WLV HVVHQWLDOWKDWWKHSURFHGXUHVLQFOXGHDUHDVRQDEOHRSSRUWXQLW\IRUWKHSURVSHFWLYHFRQVXOWDQWWR SUHVHQWKLVKHUFDVH7KHDSSHDOVSURFHGXUHVVWUHQJWKHQWKHSURFHVVE\ZKLFKWKHFRQWUDFWLQJ DJHQF\UHDFKHVLWVXOWLPDWHJRDODQGKHOSVGHIHQGVLWVDFWLRQDJDLQVWDFODLPRIODFNRIGXHSURFHVV $WHUPLQDWLRQFODXVHDQGDSURYLVLRQIRUVHWWOHPHQWRIFRQWUDFWGLVSXWHVDUHUHTXLUHG3URWHVW SURFHGXUHVDQGGLVSXWHUHVROXWLRQSURFHVVHVVKRXOGEHLQDFFRUGDQFHZLWK3&& WĂŐĞϳϮŽĨϳϮ :ĂŶƵĂƌLJϮϬϭϵ 115 116 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: ADOPT RESOLUTION TO APPROVE TIME EXTENSION TO COMPLETE ON-SITE IMPROVEMENTS FOR THE CAPISTRANO RESIDENTIAL DEVELOPMENT (TRACT MAP NO. 31910) LOCATED ON THE WEST SIDE OF MONROE STREET APPROXIMATELY 1,300 FEET NORTH OF AVENUE 58 RECOMMENDATION Adopt a resolution to approve time extension to complete on-site improvements as specified in the Subdivision Improvement Agreement for Tract Map No. 31910, Capistrano, to June 30, 2020. EXECUTIVE SUMMARY •Capistrano is a residential development located on the west side of Monroe Street approximately 1,300 feet north of Avenue 58 (Attachment 1). •La Quinta 57 Estates, Inc. (Developer) has requested a time extension to the Subdivision Improvement Agreement to complete the on-site improvements. •Sufficient bonding exists to ensure completion of the remaining on-site improvements. FISCAL IMPACT There is no fiscal impact to the City. The Developer posted sufficient bonds to guarantee construction of the on-site improvements. BACKGROUND/ANALYSIS The remaining on-site improvements include street paving, dry utilities, and grading in the northern half of the tract where the lots are currently vacant. The Developer has constructed off-site and on-site improvements in the southern portion of the tract. In a letter dated May 9, 2019, the Developer requested a time extension to June 30, 2020 to complete remaining on-site improvements (Attachment 2). No requests have been received to complete remaining on-site improvements; therefore, staff recommends approval of the time extension. CONSENT CALENDAR ITEM NO. 8 117 ALTERNATIVES Council may elect not to approve this time extension. Prepared by: Bryan McKinney, P.E., City Engineer Approved by: Danny Castro, Design and Development Director Attachments: 1. Vicinity Map 2. Letter from John Pedalino dated May 9, 2019 118 RESOLUTION NO. 2019 - A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF LA QUINTA, CALIFORNIA, GRANTING EXTENSION OF TIME TO JUNE 30, 2020 FOR THE COMPLETION OF THE ON-SITE IMPROVEMENTS AS SPECIFIED IN THE SUBDIVISION IMPROVEMENT AGREEMENT FOR TRACT MAP NO. 31910, CAPISTRANO WHEREAS, the City Council approved the Subdivision Improvement Agreement (SIA) for Tract Map No. 31910, on December 6, 2006; and WHEREAS, Section 6. Completion of Improvements, of the approved SIA requires that the developer begin construction of the improvements within ninety days and complete the construction within twelve months after the approval of the Agreements; and WHEREAS, failure by the developer to complete construction of the on-site improvements by June 6, 2018 shall constitute cause for the City, in its sole discretion and when it deems necessary, to declare the Subdivider in default of the approved agreement; and WHEREAS, Section 8. Time Extension, of the approved SIA allows for, at the City Council’s sole and absolute discretion, an extension of time for completion of the improvements with additions or revisions to the terms and conditions of the Agreement. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of La Quinta, California, as follows: SECTION 1. The time for the completion of the on-site improvements as required by the approved SIA is extended to June 30, 2020. SECTION 2. The time extension for completing the on-site improvements shall expire when City offices close for regular business on June 30, 2020 if the installation of the on-site improvements has not been completed. SECTION 3. The provided security amount as required in the approved SIA is satisfactory. No additional securities are required. SECTION 4. All other terms, responsibilities and conditions as listed in the approved SIA shall remain in full force and effect. 119 Resolution No. 2019- Tract Map No. 31910 Adopted: September 17, 2019 Page 2 PASSED, APPROVED and ADOPTED at a regular meeting of the La Quinta City Council held on this 17th day of September 2019, by the following vote: AYES: NOES: ABSENT: ABSTAIN: ____________________________ LINDA EVANS, Mayor City of La Quinta, California ATTEST: ___________________________________ MONIKA RADEVA, City Clerk City of La Quinta, California (CITY SEAL) APPROVED AS TO FORM: _____________________________________ WILLIAM H. IHRKE, City Attorney City of La Quinta, California 120 V I C I N I T Y M A P NOT TO SCALE TM 31910 capistrano ATTACHMENT 1 121 122 123 124 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: ADOPT RESOLUTION TO APPROVE TIME EXTENSION TO COMPLETE ON-SITE IMPROVEMENTS FOR GRIFFIN RANCH RESIDENTIAL DEVELOPMENT (TRACT MAP NO. 32879) LOCATED AT THE SOUTHEAST CORNER OF AVENUE 54 AND MADISON STREET RECOMMENDATION Adopt a resolution to approve time extension to complete on-site improvements as specified in the Replacement Subdivision Improvement Agreements for Tract Map No. 32879, Griffin Ranch, to September 1, 2020. EXECUTIVE SUMMARY •Griffin Ranch is a residential development located at the southeast corner of Avenue 54 and Madison Street (Attachment 1). •Lennar Homes of California, Inc. (Developer) has requested a time extension to the Replacement Subdivision Improvement Agreements to complete the on-site improvements. •Sufficient bonding exists to ensure completion of the remaining on-site improvements. FISCAL IMPACT There is no fiscal impact to the City. The Developer posted sufficient bonds to guarantee construction of the on-site improvements. BACKGROUND/ANALYSIS On November 19, 2013, Council approved the Replacement Subdivision Improvement Agreements for the Griffin Ranch residential development. There are twenty vacant lots surrounding the Merv Griffin home (Estates Lots) that were rough graded, but no improvements have been constructed. The Estates Lots are not owned by the Developer but the Developer provided the bonds. Other remaining on-site improvements include the final lift of street paving in the northeast area, landscaping, and dry utilities. CONSENT CALENDAR ITEM NO. 9 NO. 125 In a letter dated August 12, 2019, Developer requested a time extension to September 1, 2020 to contact the owner of the Estates Lots to determine the most efficient way to satisfy the on-site improvements for the twenty lots and to complete the other remaining on-site improvements (Attachment 2). In a letter (Attachment 3) from the Griffin Ranch Streets Improvement Committee (Committee), they informed the City about their concerns regarding the condition of the private streets within Griffin Ranch. City staff has answered questions and provided documents as requested by the Committee. Since the Committee indicates they have been in construct ive dialogue with the Developer, staff recommends approval of the time extension to allow time for the Committee and the Developer to reach a resolution and complete the remaining on-site improvements. ALTERNATIVES Council may elect not to approve this time extension. Prepared by: Bryan McKinney, P.E., City Engineer Approved by: Danny Castro, Design and Development Director Attachments: 1. Vicinity Map 2. Letters from Lennar Homes dated August 12, 2019 3. Letter from Stuart Hellebrand dated September 3, 2019 126 RESOLUTION NO. 2018 - A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF LA QUINTA, CALIFORNIA, GRANTING EXTENSION OF TIME TO SEPTEMBER 1, 2020, FOR THE COMPLETION OF THE ON-SITE IMPROVEMENTS AS SPECIFIED IN THE REPLACEMENT SUBDIVISION IMPROVEMENT AGREEMENTS FOR TRACT MAP NO. 32879, GRIFFIN RANCH WHEREAS, the City Council approved the Replacement Subdivision Improvement Agreements (SIA) for Tract Map No. 32879, on November 19, 2013; and WHEREAS, Section 6. Completion of Improvements, of the approved SIA requires that the developer begin construction of the improvements within ninety days and complete the construction within twelve months after the approval of the Agreements; and WHEREAS, failure by the developer to complete construction of the on-site improvements by October 4, 2017 shall constitute cause for the City, in its sole discretion and when it deems necessary, to declare the Subdivider in default of the approved agreements; and WHEREAS, Section 8. Time Extension, of the approved SIA allows for, at the City Council’s sole and absolute discretion, an extension of time for completion of the improvements with additions or revisions to the terms and conditions of the Agreements. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of La Quinta, California, as follows: SECTION 1. The time for the completion of the on-site improvements as required by the approved SIA is extended to September 1, 2020. SECTION 2. The time extension for completing the on-site improvements shall expire when City offices close for regular business on September 1, 2020 if the installation of the on-site improvements has not been completed. SECTION 3. The provided security amount as required in the approved SIA is satisfactory. No additional securities are required. 127 Resolution No. 2019- Tract Map No. 32879 – Time Extension Adopted: September 17, 2019 Page 2 of 2 SECTION 4. All other terms, responsibilities and conditions as listed in the approved SIA shall remain in full force and effect. PASSED, APPROVED and ADOPTED at a regular meeting of the La Quinta City Council held on this 17th day of September 2019, by the following vote: AYES: NOES: ABSENT: ABSTAIN: _______________________ LINDA EVANS, Mayor City of La Quinta, California ATTEST: ________________________ MONIKA RADEVA, City Clerk City of La Quinta, California (CITY SEAL) APPROVED AS TO FORM: ___________________________ WILLIAM H. IHRKE, City Attorney City of La Quinta, California 128 V I C I N I T Y M A P NOT TO SCALE TM 32879 GRIFFIN RANCH ATTACHMENT 1 129 130 ATTACHMENT 2131 132 133 134 135 136 137 138 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: APPROPRIATE FUNDS, APPROVE PLANS, SPECIFICATIONS, ENGINEER’S ESTIMATE, AND ADVERTISE FOR BID THE FRITZ BURNS PARK SIDEWALK AND PARKING PROJECT LOCATED ON THE NORTH SIDE OF FRANCIS HACK LANE ALONG THE SKATE PARK (PROJECT NO. 2017-22) RECOMMENDATION Appropriate $77,000, approve plans, specifications, engineer’s estimate, and authorize Staff to bid the Fritz Burns Park Sidewalk and Parking Project. EXECUTIVE SUMMARY •This project is located on the north side of Francis Hack Lane along the skate park (Attachment 1). •The project includes the removal of the existing temporary island, construction of sidewalk to the park, and striping of diagonal parking in front of the skate park. FISCAL IMPACT Appropriate $77,000 from the Parks Equipment and Facility Fund Reserves (currently at $3.4 million) to Parks (503-0000-71060) in the 2019/20 budget. The following is the project budget: Total Budget Professional/Design: $ 6,000 Inspection/Testing/Survey: $ 5,000 Construction: $ 60,000 Contingency: $ 6,000 Total Budget: $ 77,000 BACKGROUND/ANALYSIS The skate park was constructed in 2018 within the smaller existing parking lot located on the southeast side of the park. This project will provide parking for the skate park. CONSENT CALENDAR ITEM NO. 10 139 Contingent upon approval to advertise the project for bid on September 17, 2019, the following is the project schedule: Council Bid Authorization September 17, 2019 Bid Period September 18 to October 17, 2019 Council Considers Project Award November 5, 2019 Execute Contract and Mobilize November 6 to November 25, 2019 Construction (15 Working Days) November to December 2019 Accept Improvements December 2019 ALTERNATIVES Staff does not recommend an alternative. Prepared by: Julie Mignogna, Management Analyst Approved by: Bryan McKinney, P.E., City Engineer Attachment: 1. Vicinity Map 140 *IMPORTANT* Maps and data are to be used for reference purposes only. Map features are approximate, and are not necessarily accurate to surveying or engineering standards. The County of Riverside makes no warranty or guarantee as to the content (the source is often third party), accuracy, timeliness, or completeness of any of the data provided, and assumes no legal responsibility for the information contained on this map. Any use of this product with respect to accuracy and precision shall be the sole responsibility of the user. © Riverside County GIS Legend Notes Located at Fritz Burns Park REPORT PRINTED ON...2/7/2019 11:38:16 AM Vicinity Map Fritz Burns Park Sidewalk and Parking (2017-22) 0 12,0376, 019 Feet Blueline Streams City Areas World Street Map ATTACHMENT 1 ATTACHMENT 1141 142 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: ACCEPT OFF-SITE AND ON-SITE IMPROVEMENTS ASSOCIATED WITH THE MONTERRA RESIDENTIAL DEVELOPMENT (TRACT MAP NO. 32742) LOCATED ON MONROE STREET BETWEEN AVENUE 54 AND AIRPORT BOULEVARD RECOMMENDATION Accept the off-site and on-site improvements associated with Tract Map No. 32742, Monterra; authorize staff to release the performance security; and direct staff to release the labor and materials security 90 days after City Council acceptance of the improvements. EXECUTIVE SUMMARY •Monterra is a residential project located on Monroe Street between Avenue 54 and Airport Boulevard (Attachment 1). •La Quinta Housing 1, LLC (Developer) has requested release of the performance, labor and materials securities. •Since all off-site and on-site improvements have been completed, staff recommends acceptance, and release of the performance, labor and materials securities. FISCAL IMPACT This action will require the City to maintain a storm drain catch basin on Monroe Street after the one-year warranty period. Catch basin maintenance is estimated to be $500 annually, which will be incorporated in the Facilities’ maintenance operating budget. BACKGROUND/ANALYSIS The Developer has completed all off-site and on-site improvements required by Tract Map No. 32742. The improvements include pavement, curb and gutter, curb ramps, signing and striping, storm drains, catch basins, water and sewer improvements, landscaping, and survey monumentation. Staff inspected the improvements and verified they meet City-approved plans and standards. CONSENT CALENDAR ITEM NO. 11 NO. 143 ALTERNATIVES Accepting improvements is a ministerial action necessary for the release of the improvement securities. Since the improvements have been inspected and meet City standards, staff does not recommend an alternative action. Prepared by: Bryan McKinney, P.E., City Engineer Approved by: Danny Castro, Design and Development Director Attachment: 1. Vicinity Map 144 TM 32742 monterra ATTACHMENT 1 V I C I N I T Y M A P NOT TO SCALE 145 146 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: APPROVE AGREEMENT FOR CONTRACT SERVICES WITH CASC ENGINEERING AND CONSULTING FOR ON-CALL STORMWATER COMPLIANCE INSPECTION SERVICES RECOMMENDATION Approve Agreement for Contract Services with CASC Engineering and Consulting in an amount not to exceed $30,000 per year for three years, to provide on-call stormwater compliance inspection services; and authorize the City Manager to execute the agreement. EXECUTIVE SUMMARY •Stormwater compliance inspections are a requirement of the State National Pollution Waste Elimination System (NPDES) permit and mandate the frequency of inspections for various facilities. •Staff solicited proposals for on-call stormwater compliance inspection services from qualified firms. •CASC Engineering and Consulting (CASC) was the best qualified firm and staff recommends approval of the Agreement for Contract Services (Attachment 1). FISCAL IMPACT The not to exceed annual agreement amount of $30,000 could cost up to $90,000 during the three-year term. Funds are available in Public Works Development Professional Services (101-7002-60103) for 2019/20. Funding will be budgeted in subsequent fiscal years. BACKGROUND/ANALYSIS In 2015, the County of Riverside Department of Health (DEH) passed the responsibility for conducting water quality compliance inspections on food preparation and hazardous waste/hazardous material facilities to the local cities in Riverside County. CONSENT CALENDAR ITEM NO. 12 147 The inspections are a requirement of the State NPDES permit and mandates the inspection frequency for various facilities. The inspection results are recorded in the database and submitted as part of the City’s annual report submitted to the Riverside County Flood Control District which is forwarded on to the Regional Water Quality Control Board (RWQCB). The City collects fees from the establishments to be inspected at the time business licenses are issued to cover the cost of inspections. In August 2019, the City received two proposals in response to the on-call stormwater compliance inspection services request for proposals. CASC previously performed these inspections for the City and was selected as the most qualified firm during the selection process. The City also received a proposal from MSA Consulting, Inc. ALTERNATIVES Council could elect not to approve the agreement. Prepared by: Julie Mignogna, Management Analyst Approved by: Bryan McKinney, City Engineer Attachment: 1. Agreement for Contract Services with CASC Engineering and Consulting 148 AGREEMENT FOR CONTRACT SERVICES THIS AGREEMENT FOR CONTRACT SERVICES (the “Agreement”) is made and entered into by and between the CITY OF LA QUINTA, (“City”), a California municipal corporation, and CASC Engineering and Consulting, Inc. (“Contracting Party”). The parties hereto agree as follows: 1.SERVICES OF CONTRACTING PARTY. 1.1 Scope of Services. In compliance with all terms and conditions of this Agreement, Contracting Party shall provide those services related to On- Call Stormwater Compliance Inspection Services, as specified in the “Scope of Services” attached hereto as “Exhibit A” and incorporated herein by this reference (the “Services”). Contracting Party represents and warrants that Contracting Party is a provider of first-class work and/or services and Contracting Party is experienced in performing the Services contemplated herein and, in light of such status and experience, Contracting Party covenants that it shall follow industry standards in performing the Services required hereunder, and that all materials, if any, will be of good quality, fit for the purpose intended. For purposes of this Agreement, the phrase “industry standards” shall mean those standards of practice recognized by one or more first-class firms performing similar services under similar circumstances. 1.2 Compliance with Law. All Services rendered hereunder shall be provided in accordance with all ordinances, resolutions, statutes, rules, regulations, and laws of the City and any Federal, State, or local governmental agency of competent jurisdiction. 1.3 Wage and Hour Compliance, Contracting Party shall comply with applicable Federal, State, and local wage and hour laws. 1.4 Licenses, Permits, Fees and Assessments. Except as otherwise specified herein, Contracting Party shall obtain at its sole cost and expense such licenses, permits, and approvals as may be required by law for the performance of the Services required by this Agreement, including a City of La Quinta business license. Contracting Party and its employees, agents, and subcontractors shall, at their sole cost and expense, keep in effect at all times during the term of this Agreement any licenses, permits, and approvals that are legally required for the performance of the Services required by this Agreement. Contracting Party shall have the sole obligation to pay for any fees, assessments, and taxes, plus applicable penalties and interest, which may be imposed by law and arise from or are necessary for the performance of the Services required by this Agreement, and shall indemnify, defend (with counsel selected by City), and hold City, its elected officials, officers, employees, and agents, free and harmless against any such fees, ATTACHMENT 1 149 -2- assessments, taxes, penalties, or interest levied, assessed, or imposed against City hereunder. Contracting Party shall be responsible for all subcontractors’ compliance with this Section. 1.5 Familiarity with Work. By executing this Agreement, Contracting Party warrants that (a) it has thoroughly investigated and considered the Services to be performed, (b) it has investigated the site where the Services are to be performed, if any, and fully acquainted itself with the conditions there existing, (c) it has carefully considered how the Services should be performed, and (d) it fully understands the facilities, difficulties, and restrictions attending performance of the Services under this Agreement. Should Contracting Party discover any latent or unknown conditions materially differing from those inherent in the Services or as represented by City, Contracting Party shall immediately inform City of such fact and shall not proceed except at Contracting Party’s risk until written instructions are received from the Contract Officer, or assigned designee (as defined in Section 4.2 hereof). 1.6 Standard of Care. Contracting Party acknowledges and understands that the Services contracted for under this Agreement require specialized skills and abilities and that, consistent with this understanding, Contracting Party’s work will be held to an industry standard of quality and workmanship. Consistent with Section 1.5 hereinabove, Contracting Party represents to City that it holds the necessary skills and abilities to satisfy the industry standard of quality as set forth in this Agreement. Contracting Party shall adopt reasonable methods during the life of this Agreement to furnish continuous protection to the Services performed by Contracting Party, and the equipment, materials, papers, and other components thereof to prevent losses or damages, and shall be responsible for all such damages, to persons or property, until acceptance of the Services by City, except such losses or damages as may be caused by City’s own negligence. The performance of Services by Contracting Party shall not relieve Contracting Party from any obligation to correct any incomplete, inaccurate, or defective work at no further cost to City, when such inaccuracies are due to the negligence of Contracting Party. 1.7 Additional Services. In accordance with the terms and conditions of this Agreement, Contracting Party shall perform services in addition to those specified in the Scope of Services (“Additional Services”) only when directed to do so by the Contract Officer, or assigned designee, provided that Contracting Party shall not be required to perform any Additional Services without compensation. Contracting Party shall not perform any Additional Services until receiving prior written authorization (in the form of a written change order if Contracting Party is a contractor performing the Services) from 150 -3- the Contract Officer, or assigned designee, incorporating therein any adjustment in (i) the Contract Sum, and/or (ii) the time to perform this Agreement, which said adjustments are subject to the written approval of Contracting Party. It is expressly understood by Contracting Party that the provisions of this Section shall not apply to the Services specifically set forth in the Scope of Services or reasonably contemplated therein. It is specifically understood and agreed that oral requests and/or approvals of Additional Services shall be barred and are unenforceable. Failure of Contracting Party to secure the Contract Officer’s, or assigned designee’s written authorization for Additional Services shall constitute a waiver of any and all right to adjustment of the Contract Sum or time to perform this Agreement, whether by way of compensation, restitution, quantum meruit, or the like, for Additional Services provided without the appropriate authorization from the Contract Officer, or assigned designee. Compensation for properly authorized Additional Services shall be made in accordance with Section 2.3 of this Agreement. 1.8 Special Requirements. Additional terms and conditions of this Agreement, if any, which are made a part hereof are set forth in “Exhibit D” (the “Special Requirements”), which is incorporated herein by this reference and expressly made a part hereof. In the event of a conflict between the provisions of the Special Requirements and any other provisions of this Agreement, the provisions of the Special Requirements shall govern. 2. COMPENSATION. 2.1 Contract Sum. For the Services rendered pursuant to this Agreement, Contracting Party shall be compensated in accordance with “Exhibit B” (the “Schedule of Compensation”) in a total amount not to exceed Thirty Thousand Dollars ($30,000.00) per year for the life of the Agreement, encompassing the initial and any extended terms. (the “Contract Sum”), except as provided in Section 1.7. The method of compensation set forth in the Schedule of Compensation may include a lump sum payment upon completion, payment in accordance with the percentage of completion of the Services, payment for time and materials based upon Contracting Party’s rate schedule, but not exceeding the Contract Sum, or such other reasonable methods as may be specified in the Schedule of Compensation. The Contract Sum shall include the attendance of Contracting Party at all project meetings reasonably deemed necessary by City; Contracting Party shall not be entitled to any additional compensation for attending said meetings. Compensation may include reimbursement for actual and necessary expenditures for reproduction costs, transportation expense, telephone expense, and similar costs and expenses when and if specified in the Schedule of Compensation. Regardless of the method of compensation set forth in the Schedule of 151 -4- Compensation, Contracting Party’s overall compensation shall not exceed the Contract Sum, except as provided in Section 1.7 of this Agreement. 2.2 Method of Billing & Payment. Any month in which Contracting Party wishes to receive payment, Contracting Party shall submit to City no later than the tenth (10th) working day of such month, in the form approved by City’s Finance Director, an invoice for Services rendered prior to the date of the invoice. Such invoice shall (1) describe in detail the Services provided, including time and materials, and (2) specify each staff member who has provided Services and the number of hours assigned to each such staff member. Such invoice shall contain a certification by a principal member of Contracting Party specifying that the payment requested is for Services performed in accordance with the terms of this Agreement. Upon approval in writing by the Contract Officer, or assigned designee, and subject to retention pursuant to Section 8.3, City will pay Contracting Party for all items stated thereon which are approved by City pursuant to this Agreement no later than thirty (30) days after invoices are received by the City’s Finance Department. 2.3 Compensation for Additional Services. Additional Services approved in advance by the Contract Officer, or assigned designee, pursuant to Section 1.7 of this Agreement shall be paid for in an amount agreed to in writing by both City and Contracting Party in advance of the Additional Services being rendered by Contracting Party. Any compensation for Additional Services amounting to five percent (5%) or less of the Contract Sum may be approved by the Contract Officer, or assigned designee. Any greater amount of compensation for Additional Services must be approved by the La Quinta City Council, the City Manager, or Department Director, depending upon City laws, regulations, rules and procedures concerning public contracting. Under no circumstances shall Contracting Party receive compensation for any Additional Services unless prior written approval for the Additional Services is obtained from the Contract Officer , or assigned designee, pursuant to Section 1.7 of this Agreement. 3. PERFORMANCE SCHEDULE. 3.1 Time of Essence. Time is of the essence in the performance of this Agreement. If the Services not completed in accordance with the Schedule of Performance, as set forth in Section 3.2 and “Exhibit C”, it is understood that the City will suffer damage. 3.2 Schedule of Performance. All Services rendered pursuant to this Agreement shall be performed diligently and within the time period established in “Exhibit C” (the “Schedule of Performance”). Extensions to the 152 -5- time period specified in the Schedule of Performance may be approved in writing by the Contract Officer, or assigned designee. 3.3 Force Majeure. The time period specified in the Schedule of Performance for performance of the Services rendered pursuant to this Agreement shall be extended because of any delays due to unforeseeable causes beyond the control and without the fault or negligence of Contracting Party, including, but not restricted to, acts of God or of the public enemy, fires, earthquakes, floods, epidemic, quarantine restrictions, riots, strikes, freight embargoes, acts of any governmental agency other than City, and unusually severe weather, if Contracting Party shall within ten (10) days of the commencement of such delay notify the Contract Officer, or assigned designee, in writing of the causes of the delay. The Contract Officer, or assigned designee, shall ascertain the facts and the extent of delay, and extend the time for performing the Services for the period of the forced delay when and if in the Contract Officer’s judgment such delay is justified, and the Contract Officer’s determination, or assigned designee, shall be final and conclusive upon the parties to this Agreement. Extensions to time period in the Schedule of Performance which are determined by the Contract Officer , or assigned designee, to be justified pursuant to this Section shall not entitle the Contracting Party to additional compensation in excess of the Contract Sum. 3.4 Term. Unless earlier terminated in accordance with the provisions in Article 8.0 of this Agreement, the term of this agreement shall commence on September 18, 2019, and terminate on June 30, 2022 (“Initial Term”). This Agreement may be extended for two (2) additional year(s) upon mutual agreement by both parties (“Extended Term”). 4. COORDINATION OF WORK. 4.1 Representative of Contracting Party. The following principals of Contracting Party (“Principals”) are hereby designated as being the principals and representatives of Contracting Party authorized to act in its behalf with respect to the Services specified herein and make all decisions in connection therewith: (a) Name: Melanie Sotelo Tel No. (760)259-0108 ext. 1600 E-mail: msotelo@cascinc.com (b) Name: Richard Sidor Tel No. (760)259-0108 Email: rsidor@cascinc.com 153 -6- It is expressly understood that the experience, knowledge, capability, and reputation of the foregoing Principals were a substantial inducement for City to enter into this Agreement. Therefore, the foregoing Principals shall be responsible during the term of this Agreement for directing all activities of Contracting Party and devoting sufficient time to personally supervise the Services hereunder. For purposes of this Agreement, the foregoing Principals may not be changed by Contracting Party and no other personnel may be assigned to perform the Services required hereunder without the express written approval of City. 4.2 Contract Officer. The “Contract Officer”, otherwise known as the Bryan McKinney, PE, City Engineer, or assigned designee may be designated in writing by the City Manager of the City. It shall be Contracting Party’s responsibility to assure that the Contract Officer , or assigned designee, is kept informed of the progress of the performance of the Services, and Contracting Party shall refer any decisions, that must be made by City to the Contract Officer, or assigned designee. Unless otherwise specified herein, any approval of City required hereunder shall mean the approval of the Contract Officer, or assigned designee. The Contract Officer, or assigned designee, shall have authority to sign all documents on behalf of City required hereunder to carry out the terms of this Agreement. 4.3 Prohibition Against Subcontracting or Assignment. The experience, knowledge, capability, and reputation of Contracting Party, its principals, and its employees were a substantial inducement for City to enter into this Agreement. Except as set forth in this Agreement, Contracting Party shall not contract or subcontract with any other entity to perform in whole or in part the Services required hereunder without the express written approval of City. In addition, neither this Agreement nor any interest herein may be transferred, assigned, conveyed, hypothecated, or encumbered, voluntarily or by operation of law, without the prior written approval of City. Transfers restricted hereunder shall include the transfer to any person or group of persons acting in concert of more than twenty five percent (25%) of the present ownership and/or control of Contracting Party, taking all transfers into account on a cumulative basis. Any attempted or purported assignment or contracting or subcontracting by Contracting Party witho ut City’s express written approval shall be null, void, and of no effect. No approved transfer shall release Contracting Party of any liability hereunder without the express consent of City. 4.4 Independent Contractor. Neither City nor any of its employees shall have any control over the manner, mode, or means by which Contracting Party, its agents, or its employees, perform the Services required herein, except as otherwise set forth herein. City shall have no voice in the selection, 154 -7- discharge, supervision, or control of Contracting Party’s employees, servants, representatives, or agents, or in fixing their number or hours of service. Contracting Party shall perform all Services required herein as an independent contractor of City and shall remain at all times as to City a wholly independent contractor with only such obligations as are consistent with that role. Contracting Party shall not at any time or in any manner represent that it or any of its agents or employees are agents or employees of City. City shall not in any way or for any purpose become or be deemed to be a partner of Contracting Party in its business or otherwise or a joint venture or a member of any joint enterprise with Contracting Party. Contracting Party shall have no power to incur any debt, obligation, or liability on behalf of City. Contracting Party shall not at any time or in any manner represent that it or any of its agents or employees are agents or employees of City. Except for the Contract Sum paid to Contracting Party as provided in this Agreement, City shall not pay salaries, wages, or other compensation to Contracting Party for performing the Services hereunder for City. City shall not be liable for compensation or indemnification to Contracting Party for injury or sickness arising out of performing the Services hereunder. Notwithstanding any other City, state, or federal policy, rule, regulation, law, or ordinance to the contrary, Contracting Party and any of its employees, agents, and subcontractors providing services under this Agreement shall not qualify for or become entitled to any compensation, benefit, or any incident of employment by City, including but not limited to eligibility to enroll in the California Public Employees Retirement System (“PERS”) as an employee of City and entitlement to any contribution to be paid by City for employer contributions and/or employee contributions for PERS benefits. Contracting Party agrees to pay all required taxes on amounts paid to Contracting Party under this Agreement, and to indemnify and hold City harmless from any and all taxes, assessments, penalties, and interest asserted against City by reason of the independent contractor relationship created by this Agreement. Contracting Party shall fully comply with the workers’ compensation laws regarding Contracting Party and Contracting Party’s employees. Contracting Party further agrees to indemnify and hold City harmless from any failure of Contracting Party to comply with applicable workers’ compensation laws. City shall have the right to offset against the amount of any payment due to Contracting Party under this Agreement any amount due to City from Contracting Party as a result of Contracting Party’s failure to promptly pay to City any reimbursement or indemnification arising under this Section. 4.5 Identity of Persons Performing Work. Contracting Party represents that it employs or will employ at its own expense all personnel required for the satisfactory performance of any and all of the Services set forth herein. Contracting Party represents that the Services required herein will be performed by Contracting Party or under its direct supervision, and 155 -8- that all personnel engaged in such work shall be fully qualified and shall be authorized and permitted under applicable State and local law to perform such tasks and services. 4.6 City Cooperation. City shall provide Contracting Party with any plans, publications, reports, statistics, records, or other data or information pertinent to the Services to be performed hereunder which are reasonably available to Contracting Party only from or through action by City. 5. INSURANCE. 5.1 Insurance. Prior to the beginning of any Services under this Agreement and throughout the duration of the term of this Agreement, Contracting Party shall procure and maintain, at its sole cost and expense, and submit concurrently with its execution of this Agreement, policies of insurance as set forth in “Exhibit E” (the “Insurance Requirements”) which is incorporated herein by this reference and expressly made a part hereof. 5.2 Proof of Insurance. Contracting Party shall provide Certificate of Insurance to Agency along with all required endorsements. Certificate of Insurance and endorsements must be approved by Agency’s Risk Manager prior to commencement of performance. 6. INDEMNIFICATION. 6.1 Indemnification. To the fullest extent permitted by law, Contracting Party shall indemnify, protect, defend (with counsel selected by City), and hold harmless City and any and all of its officers, employees, agents, and volunteers as set forth in “Exhibit F” (“Indemnification”) which is incorporated herein by this reference and expressly made a part hereof. 7. RECORDS AND REPORTS. 7.1 Reports. Contracting Party shall periodically prepare and submit to the Contract Officer, or assigned designee, such reports concerning Contracting Party’s performance of the Services required by this Agreement as the Contract Officer, or assigned designee, shall require. Contracting Party hereby acknowledges that City is greatly concerned about the cost of the Services to be performed pursuant to this Agreement. For this reason, Contracting Party agrees that if Contracting Party becomes aware of any facts, circumstances, techniques, or events that may or will materially increase or decrease the cost of the Services contemplated herein or, if Contracting Party is providing design services, the cost of the project being designed, Contracting Party shall promptly notify the Contract Officer , or assigned designee, of said fact, circumstance, technique, or event and the estimated 156 -9- increased or decreased cost related thereto and, if Contracting Party is providing design services, the estimated increased or decreased cost estimate for the project being designed. 7.2 Records. Contracting Party shall keep, and require any subcontractors to keep, such ledgers, books of accounts, invoices, vouchers, canceled checks, reports (including but not limited to payroll reports), studies, or other documents relating to the disbursements charged to City and the Services performed hereunder (the “Books and Records”), as shall be necessary to perform the Services required by this Agreement and enable the Contract Officer, or assigned designee, to evaluate the performance of such Services. Any and all such Books and Records shall be maintained in accordance with generally accepted accounting principles and shall be complete and detailed. The Contract Officer, or assigned designee, shall have full and free access to such Books and Records at all times during normal business hours of City, including the right to inspect, copy, audit, and make records and transcripts from such Books and Records. Such Books and Records shall be maintained for a period of three (3) years following completion of the Services hereunder, and City shall have access to such Books and Records in the event any audit is required. In the event of dissolution of Contracting Party’s business, custody of the Books and Records may be given to City, and access shall be provided by Contracting Party’s successor in interest. Under California Government Code Section 8546.7, if the amount of public funds expended under this Agreement exceeds Ten Thousand Dollars ($10,000.00), this Agreement shall be subject to the examination and audit of the State Auditor, at the request of City or as part of any audit of City, for a period of three (3) years after final payment under this Agreement. 7.3 Ownership of Documents. All drawings, specifications, maps, designs, photographs, studies, surveys, data, notes, computer files, reports, records, documents, and other materials plans, drawings, estimates, test data, survey results, models, renderings, and other documents or works of authorship fixed in any tangible medium of expression, including but not limited to, physical drawings, digital renderings, or data stored digitally, magnetically, or in any other medium prepared or caused to be prepared by Contracting Party, its employees, subcontractors, and agents in the performance of this Agreement (the “Documents and Materials”) shall be the property of City and shall be delivered to City upon request of the Contract Officer, or assigned designee, or upon the expiration or termination of this Agreement, and Contracting Party shall have no claim for further employment or additional compensation as a result of the exercise by City of its full rights of ownership use, reuse, or assignment of the Documents and Materials hereunder. Any use, reuse or assignment of such completed Documents and 157 -10- Materials for other projects and/or use of uncompleted documents without specific written authorization by Contracting Party will be at City’s sole risk and without liability to Contracting Party, and Contracting Party’s guarantee and warranties shall not extend to such use, revise, or assignment. Contracting Party may retain copies of such Documents and Materials for its own use. Contracting Party shall have an unrestricted right to use the concepts embodied therein. All subcontractors shall provide for assignment to City of any Documents and Materials prepared by them, and in the event Contracting Party fails to secure such assignment, Contracting Party shall indemnify City for all damages resulting therefrom. 7.4 In the event City or any person, firm, or corporation authorized by City reuses said Documents and Materials without written verification or adaptation by Contracting Party for the specific purpose intended and causes to be made or makes any changes or alterations in said Documents and Materials, City hereby releases, discharges, and exonerates Contracting Party from liability resulting from said change. The provisions of this clause shall survive the termination or expiration of this Agreement and shall thereafter remain in full force and effect. 7.5 Licensing of Intellectual Property. This Agreement creates a non- exclusive and perpetual license for City to copy, use, modify, reuse, or sublicense any and all copyrights, designs, rights of reproduction, and other intellectual property embodied in the Documents and Materials. Contracting Party shall require all subcontractors, if any, to agree in writing that City is granted a non-exclusive and perpetual license for the Documents and Materials the subcontractor prepares under this Agreement. Contracting Party represents and warrants that Contracting Party has the legal right to license any and all of the Documents and Materials. Contracting Party makes no such representation and warranty in regard to the Documents and Materials which were prepared by design professionals other than Contracting Party or provided to Contracting Party by City. City shall not be limited in any way in its use of the Documents and Materials at any time, provided that any such use not within the purposes intended by this Agreement shall be at City’s sole risk. 7.6 Release of Documents. The Documents and Materials shall not be released publicly without the prior written approval of the Contract Officer, or assigned designee, or as required by law. Contracting Party shall not disclose to any other entity or person any information regarding the activities of City, except as required by law or as authorized by City. 7.7 Confidential or Personal Identifying Information. Contracting Party covenants that all City data, data lists, trade secrets, documents with personal identifying information, documents that are not public records, draft 158 -11- documents, discussion notes, or other information, if any, de veloped or received by Contracting Party or provided for performance of this Agreement are deemed confidential and shall not be disclosed by Contracting Party to any person or entity without prior written authorization by City or unless required by law. City shall grant authorization for disclosure if required by any lawful administrative or legal proceeding, court order, or similar directive with the force of law. All City data, data lists, trade secrets, documents with personal identifying information, documents that are not public records, draft documents, discussions, or other information shall be returned to City upon the termination or expiration of this Agreement. Contracting Party’s covenant under this section shall survive the termination or expiration of this Agreement. 8. ENFORCEMENT OF AGREEMENT. 8.1 California Law. This Agreement shall be interpreted, construed, and governed both as to validity and to performance of the parties in accordance with the laws of the State of California. Legal actions concerning any dispute, claim, or matter arising out of or in relation to this Agreement shall be instituted in the Superior Court of the County of Riverside, State of California, or any other appropriate court in such county, and Contracting Party covenants and agrees to submit to the personal jurisdiction of such court in the event of such action. 8.2 Disputes. In the event of any dispute arising under this Agreement, the injured party shall notify the injuring party in writing of its contentions by submitting a claim therefore. The injured party shall continue performing its obligations hereunder so long as the injuring party commences to cure such default within ten (10) days of service of such notice and completes the cure of such default within forty-five (45) days after service of the notice, or such longer period as may be permitted by the Contract Officer, or assigned designee; provided that if the default is an immediate danger to the health, safety, or general welfare, City may take such immediate action as City deems warranted. Compliance with the provisions of this Section shall be a condition precedent to termination of this Agreement for cause and to any legal action, and such compliance shall not be a waiver of any party’s right to take legal action in the event that the dispute is not cured, provided that nothing herein shall limit City’s right to terminate this Agreement without cause pursuant to this Article 8.0. During the period of time that Contracting Party is in default, City shall hold all invoices and shall, when the default is cured, proceed with payment on the invoices. In the alternative, City may, in its sole discretion, elect to pay some or all of the outstanding invoices during any period of default. 159 -12- 8.3 Retention of Funds. City may withhold from any monies payable to Contracting Party sufficient funds to compensate City for any losses, costs, liabilities, or damages it reasonably believes were suffered by City due to the default of Contracting Party in the performance of the Services required by this Agreement. 8.4 Waiver. No delay or omission in the exercise of any right or remedy of a non-defaulting party on any default shall impair such right or remedy or be construed as a waiver. City’s consent or approval of any act by Contracting Party requiring City’s consent or approval shall not be deemed to waive or render unnecessary City’s consent to or approval of any subsequent act of Contracting Party. Any waiver by either party of any default must be in writing and shall not be a waiver of any other default concerning the same or any other provision of this Agreement. 8.5 Rights and Remedies are Cumulative. Except with respect to rights and remedies expressly declared to be exclusive in this Agreement, the rights and remedies of the parties are cumulative and the exercise by either party of one or more of such rights or remedies shall not preclude the exercise by it, at the same or different times, of any other rights or remedies for the same default or any other default by the other party. 8.6 Legal Action. In addition to any other rights or remedies, either party may take legal action, at law or at equity, to cure, correct, or remedy any default, to recover damages for any default, to compel specific performance of this Agreement, to obtain declaratory or injunctive relief, or to obtain any other remedy consistent with the purposes of this Agreement. 8.7 Termination Prior To Expiration of Term. This Section shall govern any termination of this Agreement, except as specifically provided in the following Section for termination for cause. City reserves the right to terminate this Agreement at any time, with or without cause, upon thirty (30) days’ written notice to Contracting Party. Upon receipt of any notice of termination, Contracting Party shall immediately cease all Services hereunder except such as may be specifically approved by the Contract Officer, or assigned designee. Contracting Party shall be entitled to compensation for all Services rendered prior to receipt of the notice of termination and for any Services authorized by the Contract Officer, or assigned designee, thereafter in accordance with the Schedule of Compensation or such as may be approved by the Contract Officer, or assigned designee, except amounts held as a retention pursuant to this Agreement. 8.8 Termination for Default of Contracting Party. If termination is due to the failure of Contracting Party to fulfill its obligations under this Agreement, Contracting Party shall vacate any City-owned property which Contracting 160 -13- Party is permitted to occupy hereunder and City may, after compliance with the provisions of Section 8.2, take over the Services and prosecute the same to completion by contract or otherwise, and Contracting Party shall be liable to the extent that the total cost for completion of the Services required hereunder exceeds the compensation herein stipulated (provided that City shall use reasonable efforts to mitigate such damages), and City may withhold any payments to Contracting Party for the purpose of setoff or partial payment of the amounts owed City. 8.9 Attorneys’ Fees. If either party to this Agreement is required to initiate or defend or made a party to any action or proceeding in any way connected with this Agreement, the prevailing party in such action or proceeding, in addition to any other relief which may be granted, whether legal or equitable, shall be entitled to reasonable attorneys’ fees; provided, however, that the attorneys’ fees awarded pursuant to this Section shall not exceed the hourly rate paid by City for legal services multiplied by the reasonable number of hours spent by the prevailing party in the conduct of the litigation. Attorneys’ fees shall include attorneys’ fees on any appeal, and in addition a party entitled to attorneys’ fees shall be entitled to all other reasonable costs for investigating such action, taking depositions and discovery, and all other necessary costs the court allows which are incurred in such litigation. All such fees shall be deemed to have accrued on commencement of such action and shall be enforceable whether or not such action is prosecuted to judgment. The court may set such fees in the same action or in a separate action brought for that purpose. 9. CITY OFFICERS AND EMPLOYEES; NONDISCRIMINATION. 9.1 Non-liability of City Officers and Employees. No officer, official, employee, agent, representative, or volunteer of City shall be personally liable to Contracting Party, or any successor in interest, in the event or any default or breach by City or for any amount which may become due to Contracting Party or to its successor, or for breach of any obligation of the terms of this Agreement. 9.2 Conflict of Interest. Contracting Party covenants that neither it, nor any officer or principal of it, has or shall acquire any interest, directly or indirectly, which would conflict in any manner with the interests of City or which would in any way hinder Contracting Party’s performance of the Services under this Agreement. Contracting Party further covenants that in the performance of this Agreement, no person having any such interest shall be employed by it as an officer, employee, agent, or subcontractor without the express written consent of the Contract Officer , or assigned designee. Contracting Party agrees to at all times avoid conflicts of interest or the 161 -14- appearance of any conflicts of interest with the interests of City in the performance of this Agreement. No officer or employee of City shall have any financial interest, direct or indirect, in this Agreement nor shall any such officer or employee participate in any decision relating to this Agreement which effects his financial interest or the financial interest of any corporation, partnership or association in which he is, directly or indirectly, interested, in violation of any State statute or regulation. Contracting Party warrants that it has not paid or given and will not pay or give any third party any money or other consideration for obtaining this Agreement. 9.3 Covenant against Discrimination. Contracting Party covenants that, by and for itself, its heirs, executors, assigns, and all persons claiming under or through them, that there shall be no discrimination against or segregation of, any person or group of persons on account of any impermissible classification including, but not limited to, race, color, creed, religion, sex, marital status, sexual orientation, national origin, or ancestry in the performance of this Agreement. Contracting Party shall take affirmative action to ensure that applicants are employed and that employees are treated during employment without regard to their race, color, creed, religion, sex, marital status, sexual orientation, national origin, or ancestry. 10. MISCELLANEOUS PROVISIONS. 10.1 Notice. Any notice, demand, request, consent, approval, or communication either party desires or is required to give the other party or any other person shall be in writing and either served personally or sent by prepaid, first-class mail to the address set forth below. Either party may change its address by notifying the other party of the change of address in writing. Notice shall be deemed communicated forty-eight (48) hours from the time of mailing if mailed as provided in this Section. To City: CITY OF LA QUINTA Attention: Bryan McKinney, PE 78495 Calle Tampico La Quinta, California 92253 To Contracting Party: CASC Engineering and Consulting, Inc. Melanie Sotelo 77564 Country Club Drive, Ste. 211 Palm Desert, CA 92211 162 -15- 10.2 Interpretation. The terms of this Agreement shall be construed in accordance with the meaning of the language used and shall not be construed for or against either party by reason of the authorship of this Agreement or any other rule of construction which might otherwise apply. 10.3 Section Headings and Subheadings. The section headings and subheadings contained in this Agreement are included for convenience only and shall not limit or otherwise affect the terms of this Agreement. 10.4 Counterparts. This Agreement may be executed in counterparts, each of which shall be deemed to be an original, and such counterparts shall constitute one and the same instrument 10.5 Integrated Agreement. This Agreement including the exhibits hereto is the entire, complete, and exclusive expression of the understanding of the parties. It is understood that there are no oral agreements between the parties hereto affecting this Agreement and this Agreement supersedes and cancels any and all previous negotiations, arrangements, agreements, and understandings, if any, between the parties, and none shall be used to interpret this Agreement. 10.6 Amendment. No amendment to or modification of this Agreement shall be valid unless made in writing and approved by Contracting Party and by the City Council of City. The parties agree that this requirement for written modifications cannot be waived and that any attempted waiver shall be void. 10.7 Severability. In the event that any one or more of the articles, phrases, sentences, clauses, paragraphs, or sections contained in this Agreement shall be declared invalid or unenforceable, such invalidity or unenforceability shall not affect any of the remaining articles, phrases, sentences, clauses, paragraphs, or sections of this Agreement which are hereby declared as severable and shall be interpre ted to carry out the intent of the parties hereunder unless the invalid provision is so material that its invalidity deprives either party of the basic benefit of their bargain or renders this Agreement meaningless. 10.8 Unfair Business Practices Claims. In entering into this Agreement, Contracting Party offers and agrees to assign to City all rights, title, and interest in and to all causes of action it may have under Section 4 of the Clayton Act (15 U.S.C. § 15) or under the Cartwright Act (Chapter 2, (commencing with Section 16700) of Part 2 of Division 7 of the Business and Professions Code), arising from purchases of goods, services, or materials related to this Agreement. This assignment shall be made and become effective at the time City renders final payment to Contracting Party without further acknowledgment of the parties. 163 -16- 10.9 No Third-Party Beneficiaries. With the exception of the specific provisions set forth in this Agreement, there are no intended third -party beneficiaries under this Agreement and no such other third parties shall have any rights or obligations hereunder. 10.10 Authority. The persons executing this Agreement on behalf of each of the parties hereto represent and warrant that (i) such party is duly organized and existing, (ii) they are duly authorized to execute and deliver this Agreement on behalf of said party, (iii) by so executing this Agreement, such party is formally bound to the provisions of this Agreement, and (iv) that entering into this Agreement does not violate any provision of an y other Agreement to which said party is bound. This Agreement shall be binding upon the heirs, executors, administrators, successors, and assigns of the parties. [SIGNATURES ON FOLLOWING PAGE] 164 -17- IN WITNESS WHEREOF, the parties have executed this Agreement as of the dates stated below. CITY OF LA QUINTA, a California Municipal Corporation JON MCMILLEN, City Manager City of La Quinta, California Dated: CONTRACTING PARTY: By: Name: Title: ATTEST: MONIKA RADEVA, City Clerk La Quinta, California By: Name: Title: APPROVED AS TO FORM: WILLIAM H. IHRKE, City Attorney City of La Quinta, California 165 Exhibit A Page 1 of 5 Last revised summer 2017 Exhibit A Scope of Services 1. Services to be Provided: Tasks include, but are not limited to, the following: • Set up a schedule of inspections complying with the requirements of the Whitewater River Region NPDES MS4 Permit for all the food facilities and hazardous materials / underground storage tanks facilities in La Quinta that are permitted by the Riverside County Department of Environmental Health (DEH). Update the City’s current schedule with new facilities and removing closed facilities. • Perform inspections as required by the Whitewater River Region NPDES MS4 Permit using the City’s Stormwater Compliance Survey forms and provide the inspection forms to the City. • Coordinate with the City’s Code Enforcement Division when violations occur to ensure they have been corrected. • Keep an active database, of all the food facilities and hazardous materials facilities in La Quinta requiring inspections, to include inspection dates and results of inspections. Update the database by coordinating with the City’s Permit Center on new business licenses issued to food facilities and/or coordinate with DEH on new permitted food and hazardous materials facilities. 166 Exhibit A Page 2 of 5 ADDENDUM TO AGREEMENT Re: Scope of Services If the Scope of Services include construction, alteration, demolition, installation, repair, or maintenance affecting real property or structures or improvements of any kind appurtenant to real property, the following apply: 1. Prevailing Wage Compliance. If Contracting Party is a contractor performing public works and maintenance projects, as described in this Section 1.3, Contracting Party shall comply with applicable Federal, State, and local laws. Contracting Party is aware of the requirements of California Labor Code Sections 1720, et seq., and 1770, et seq., as well as California Code of Regulations, Title 8, Sections 16000, et seq., (collectively, the “Prevailing Wage Laws”), and La Quinta Municipal Code Section 3.12.040, which require the payment of prevailing wage rates and the performance of other requirements on “Public works” and “Maintenance” projects. If the Services are being performed as part of an applicable “Public works” or “Maintenance” project, as defined by the Prevailing Wage Laws, and if construction work over twenty-five thousand dollars ($25,000.00) and/or alterations, demolition, repair or maintenance work over fifteen thousand dollars ($15,000.00) is entered into or extended on or after January 1, 2015 by this Agreement, Contracting Party agrees to fully comply with such Prevailing Wage Laws including, but not limited to, requirements related to the maintenance of payroll records and the employment of apprentices. Pursuant to California Labor Code Section 1725.5, no contractor or subcontractor may be awarded a contract for public work on a “Public works” project unless registered with the California Department of Industrial Relations (“DIR”) at the time the contract is awarded. If the Services are being performed as part of an applicable “Public works” or “Maintenance” project, as defined by the Prevailing Wage Laws, this project is subject to compliance monitoring and enforcement by the DIR. Contracting Party will maintain and will require all subcontractors to maintain valid and current DIR Public Works contractor registration during the term of this Agreement. Contracting Party shall notify City in writing immediately, and in no case more than twenty-four (24) hours, after receiving any information that Contracting Party’s o r any of its subcontractor’s DIR registration status has been suspended, revoked, expired, or otherwise changed. It is understood that it is the responsibility of Contracting Party to determine the correct salary scale. Contracting Party shall make copies of the prevailing rates of per diem wages for each craft, classification, or type of worker needed to execute the Services available to interested parties upon request, and shall post copies at Contracting Party’s principal place of business and at the project site, if any. The statutory penalties for failure to pay prevailing wage or to comply with State wage and hour laws will be enforced. Contracting Party must forfeit to City TWENTY - 167 Exhibit A Page 3 of 5 FIVE DOLLARS ($25.00) per day for each worker who works in excess of the minimum working hours when Contracting Party does not pay overtime. In accordance with the provisions of Labor Code Sections 1810 et seq., eight (8) hours is the legal working day. Contracting Party also shall comply with State law requirements to maintain payroll records and shall provide for certified records and inspection of records as required by California Labor Code Section 1770 et seq., including Section 1776. In addition to the other indemnities provided under this Agreement, Contracting Party shall defend (with counsel selected by City), indemnify, and hold City, its elected officials, officers, employees, and agents free and harmless from any claim or liability arising out of any failure or alleged failure to comply with the Prevailing Wage Laws. It is agreed by the parties that, in connection with performance of the Services, including, without limitation, any and all “Public works” (as defined by the Prevailing Wage Laws), Contracting Party shall bear all risks of payment or non-payment of prevailing wages under California law and/or the implementation of Labor Code Section 1781, as the same may be amended from time to time, and/or any other similar law. Contracting Party acknowledges and agrees that it shall be independently responsibl e for reviewing the applicable laws and regulations and effectuating compliance with such laws. Contracting Party shall require the same of all subcontractors. 2. Retention. Payments shall be made in accordance with the provisions of Article 2.0 of the Agreement. In accordance with said Sections, City shall pay Contracting Party a sum based upon ninety-five percent (95%) of the Contract Sum apportionment of the labor and materials incorporated into the Services under this Agreement during the month covered by said invoice. The remaining five percent (5%) thereof shall be retained as performance security to be paid to Contracting Party within sixty (60) days after final acceptance of the Services by the City Council of City, after Contracting Party has furnished City with a full release of all undisputed payments under this Agreement, if required by City. In the event there are any claims specifically excluded by Contracting Party from the operation of the release, City may retain proceeds (per Public Contract Code § 7107) of up to one hundred fifty percent (150%) of the amount in dispute. City’s failure to deduct or withhold shall not affect Contracting Party’s obligations under the Agreement. 3. Utility Relocation. City is responsible for removal, relocation, or protection of existing main or trunk-line utilities to the extent such utilities were not identified in the invitation for bids or specifications. City shall reimburse Contracting Party for any costs incurred in locating, repairing damage not caused by Contracting Party, and removing or relocating such unidentified utility facilities. Contracting Party shall not be assessed liquidated 168 Exhibit A Page 4 of 5 damages for delay arising from the removal or relocation of such unidentified utility facilities. 4. Trenches or Excavations. Pursuant to California Public Contract Code Section 7104, in the event the work included in this Agreement requires excavations more than four (4) feet in depth, the following shall apply: (a) Contracting Party shall promptly, and before the following conditions are disturbed, notify City, in writing, of any: (1) material that Contracting Party believes may be material that is hazardous waste, as defined in Section 25117 of the Health and Safety Code, that is required to be removed to a Class I, Class II, or Class III disposal site in accordance with provisions of existing law; (2) subsurface or latent physical conditions at the site different from those indicated by information about the site made available to bidders prior to the deadline for submittin g bids; or (3) unknown physical conditions at the site of any unusual nature, different materially from those ordinarily encountered and generally recognized as inherent in work of the character provided for in the Agreement. (b) City shall promptly investigate the conditions, and if it finds that the conditions do materially so differ, or do involve hazardous waste, and cause a decrease or increase in Contracting Party’s cost of, or the time required for, performance of any part of the work shall issue a change order per Section 1.8 of the Agreement. (c) in the event that a dispute arises between City and Contracting Party whether the conditions materially differ, or involve hazardous waste, or cause a decrease or increase in Contracting Party’s cost of, or time required for, performance of any part of the work, Contracting Party shall not be excused from any scheduled completion date provided for by this Agreement, but shall proceed with all work to be performed under this Agreement. Contracting Party shall retain any and all rights provided either by contract or by law which pertain to the resolution of disputes and protests between the contracting Parties. 5. Safety. Contracting Party shall execute and maintain its work so as to avoid injury or damage to any person or property. In carrying out the Services, Contracting Party shall at all times be in compliance with all applicable local, state, and federal laws, rules and regulations, and shall exercise all necessary precautions for the safety of employees appropriate to the nature of the work and the conditions under which the work is to be performed. Safety precautions as applicable shall include, but shall not be limited to: (A) adequate life protection and lifesaving equipment and procedures; (B) instructions in accident prevention for all employees and subcontractors, such as safe walkways, scaffolds, fall protection ladders, 169 Exhibit A Page 5 of 5 bridges, gang planks, confined space procedures, trenching and shoring, equipment and other safety devices, equipment and wearing apparel as are necessary or lawfully required to prevent accidents or injuries; and (C) adequate facilities for the proper inspection and maintenance of all safety measures. 6. Liquidated Damages. Since the determination of actual damages for any delay in performance of the Agreement would be extremely difficult or impractical to determine in the event of a breach of this Agreement, Contracting Party shall be liable for and shall pay to City the sum of One Thousand dollars ($1,000.00) as liquidated damages for each working day of delay in the performance of any of the Services required hereunder, as specified in the Schedule of Performance. In addition, liquidated damages may be assessed for failure to comply with the emergency call out requirements, if any, described in the Scope of Services. City may withhold from any moneys payable on account of the Services performed by Contracting Party any accrued liquidated damages. 170 Exhibit B Page 1 of 2 Exhibit B Schedule of Compensation With the exception of compensation for Additional Services, provided for in Section 2.3 of this Agreement, the maximum total compensation to be paid to Contracting Party under this Agreement is not to exceed Thirty Thousand Dollars ($30,000.00) per year for the life of the Agreement, encompassing the initial and any extended terms (“Contract Sum”). The Contract Sum shall be paid to Contracting Party in payments made on a monthly basis and in an amount identified in Contracting Party’s schedule of compensation attached hereto for the work tasks performed and properly invoiced by Contracting Party in conformance with Section 2.2 of this Agreement. Initial Term: “Not to exceed” Year 1: $30,000.00 “Not to exceed” Year 2: $30,000.00 “Not to exceed” Year 3: $30,000.00 $90,000.000 Possible Extended Term: “Not to exceed” Year 4: $30,000.00 “Not to exceed” Year 5: $30,000.00 171 I I I I I I I I ' I 1470 E. Cooley Drive Colton, CA 92324 Office: 909.783.0101 Fax: 909.783.0108 CASC ENGINEERING AND CONSULTING RATE SCHEDULE Civll and Environmental Encrneerlng/Con$ultlng President/Principal Engineer Sr. Director Director Program Manager/ Technical Specialist Senior Project Manager/ Senior Engineer IV/Senior Scientist IV Project Manager Ill/Senior Engineer Ill/ Senior Scientist Ill Project Manager II/Senior Engineer II/Senior Scientist II Project Manager I/Senior Engineer I/ Senior Scientist I Assistant Project Manager/ Senior Environmental Analyst Project Engineer/ Environmental Analyst Ill/ Scientist Ill Senior Designer II/ Environmental Analyst II/ Scientist II Senior Designer I /Environmental Analyst I/ Scientist I Design Engineer II Design Engineer I Designer II/ Staff Analyst II Designer I/ Staff Analyst I CADD Drafter/Project Analyst Ill Staff Assistant II/Project Analyst II Staff Assistant I/Project Analyst I Planning and Environmental Planning Director Senior Project Manager Senior Biologist Project Manager II Project Manager I Senior Planner II/Biologist II Senior Planner I/Biologist I Associate Planner 11/GIS Specialist II Associate Planner 1/GIS Specialist I Construction Monitor Oerlcal Project Coordinator/Clerical Ill Project Coordinator/Clerical II Project Coordinator/Clerical I REIMBURSABLE EXPENSES: The following expenses will be billed at cost plus 15% unless otherwise noted: $250 $220 $205 $195 $180 $170 $160 $155 $150 $145 $140 $135 $125 $118 $113 $108 $95 $90 $85 $195 $170 $165 $160 $155 $130 $118 $108 $98 $87-108 • $88 $83 $78 Landscape Architecture� Ucensed Landscape Architect Senior Landscape Designer Associate landscape Designer Assistant Landscape Designer Construction Man�gement Resident Engineer Field Inspector Ill Field Inspector II Field Inspector I Sul'veylng and Mapping Licensed Surveyor/ Director Senior Survey Project Manager Senior Survey Analyst Senior Calculator Calculator II Calculator I Survey Analyst II Survey Analyst I Technical Aide Field Survey Crews Three Person Survey/GP5 Crew Two Person Survey/GPS Crew One Person Survey/GPS Crew Outside Servfccs: Includes fees paid to sub-consultants, consultants, analytical laboratories, and other providers of services required for execution of the project. $165 $140 $118 $98 $155 $130 $115 $105 $195 $165 $140 $130 $118 $108 $98 $88 $83 $245 $210 $199 Permits, Appllratlons. and Fees: Includes fees for Notices of Intent (NOi), Notices of Termination (NOT), application fees, submittal fees, permit fees, and other fees required as part of the project and not paid directly by Client. Reproduction Services: Includes blueprinting, copying, printing and plotting. In-house plots will be billed at $6.00 per sheet for each client set and for a final in-house review set. B&W / Color copies: $0.08 / $0.90 for 8.5 X 11 and $0.20 / $1.20 for 11 X 17. Rental Fees: Includes rental fees paid by the firm, including required vehicles, equipment, and tools required to complete the work. Commercial Delivery Services: Including Express Mail, Federal Express, UPS and independent courier services. Jo-House Pick-Up ancl Dellvcry Services: When provided by the firm, these services will be billed at $48,00 per hour plus $0.66 per mile round trip, with no additional markup. Travel Expenses: Includes travel expenses incidental to performance of the work, including airfare, parking, tolls, taxi, lodging, and etc. Vehicle mileage will be billed at a rate of $0.66 per mile with no additional markup. Travel time for professional and administrative staff wlll be billed per the hourly fee rate schedule with no additional markup and survey crews will be billed at $SO per hour. per 2-man aew. Per Diem: Per diem for meals for overnight stays will be billed at Caltrans current state rates. Prevalllng wage: Projects and/or portions thereof designated by Client to be subject to Prevailing Wage shall be billed at the regular staff rate or the Prevailing Wage rate, whichever Is higher plus a multiplier of approximately 2.3 to 2.8 for overhead and profit. The Prevailing Wage rate shall be based upon the Wage Rate Determination Issued by California's Director of Industrial Relations for the locality and employee classification at the time the work is performed. Please contact CASC for specific project prevailing wage rates. Waiver 9f·Subr9g:atloo: When a Waiver of Subrogation for Workman's Compensation Insurance ls required by the Client, the Client will be required to pay the additional insurance premium. The approximate amount for the waiver Is $250 per year. UUgotlon Support and Expert Witness shall be at 2.0 times the above noted hourly rates. Annual 1ns:1ease In [;lte: CASC will increase their rates annually, usually at the beginning of a calendar year, A new fee rate schedule will be provided. Revised 12/04/18 Exhibit B Page 2 of 2 172 Exhibit C Page 1 of 1 Exhibit C Schedule of Performance Contracting Party shall complete services identified in the Scope of Services, Exhibit A of this Agreement, as requested by City within the time allowed by the total contract sum. 173 Exhibit D Page 1 of 1 Exhibit D Special Requirements None 174 Exhibit E Page 1 of 6 Exhibit E Insurance Requirements E.1 Insurance. Prior to the beginning of and throughout the duration of this Agreement, the following policies shall be maintained and kept in full force and effect providing insurance with minimum limits as indicated below and issued by insurers with A.M. Best ratings of no less than A-VI: Commercial General Liability (at least as broad as ISO CG 0001) $1,000,000 (per occurrence) $2,000,000 (general aggregate) Must include the following endorsements: General Liability Additional Insured General Liability Primary and Non-contributory Commercial Auto Liability (at least as broad as ISO CA 0001) $1,000,000 (per accident) Personal Auto Declaration Page if applicable Errors and Omissions Liability $1,000,000 (per claim and aggregate) Workers’ Compensation (per statutory requirements) Must include the following endorsements: Workers Compensation with Waiver of Subrogation Workers Compensation Declaration of Sole Proprietor if applicable Contracting Party shall procure and maintain, at its cost, and submit concurrently with its execution of this Agreement, Commercial General Liability insurance against all claims for injuries against persons or damages to property resulting from Contracting Party’s acts or omissions rising out of or related to Contracting Party’s performance under this Agreement. The insurance policy shall contain a severability of interest clause providing that the coverage shall be primary for losses arising out of Contracting Party’s performance hereunder and neither City nor its insurers shall be required to contribute to any such loss. An endorsement evidencing the foregoing and naming the City and its officers and employees as additional insured (on the Commercial General Liability policy only) must be submitted concurrently with the execution of this Agreement and approved by City prior to commencement of the services hereunder. Contracting Party shall carry automobile liability insurance of $5,000,000 per accident against all claims for injuries against persons or 175 Exhibit E Page 2 of 6 damages to property arising out of the use of any automobile by Contracting Party, its officers, any person directly or indirectly employed by Contracting Party, any subcontractor or agent, or anyone for whose acts any of them may be liable, arising directly or indirectly out of or related to Contracting Party’s performance under this Agreement. If Contracting Party or Contracting Party’s employees will use personal autos in any way on this project, Contracting Party shall provide evidence of personal auto liability coverage for each such person. The term “automobile” includes, but is not limited to, a land motor vehicle, trailer or semi-trailer designed for travel on public roads. The automobile insurance policy shall contain a severability of interest clause providing that coverage shall be primary for losses arising out of Contracting Party’s performance hereunder and neither City nor its insurers shall be required to contribute to such loss. Professional Liability or Errors and Omissions Insurance as appropriate shall be written on a policy form coverage specifically designed to protect against acts, errors or omissions of the Contracting Party and “Covered Professional Services” as designated in the policy must specifically include work performed under this agreement. The policy limit shall be no less than $1,000,000 per claim and in the aggregate. The policy must “pay on behalf of” the insured and must include a provision establishing the insurer’s duty to defend. The policy retroactive date shall be on or before the effective date of this agreement. Contracting Party shall carry Workers’ Compensation Insurance in accordance with State Worker’s Compensation laws with employer’s liability limits no less than $1,000,000 per accident or disease. If coverage is maintained on a claims-made basis, Contracting Party shall maintain such coverage for an additional period of three (3) years following termination of the contract. Contracting Party shall provide written notice to City within ten (10) working days if: (1) any of the required insurance policies is terminated; (2) the limits of any of the required polices are reduced; or (3) the deductible or self-insured retention is increased. In the event any of said policies of insurance are cancelled, Contracting Party shall, prior to the cancellation date, submit new evidence of insurance in conformance with this Exhibit to the Contract Officer. The procuring of such insurance or the delivery of policies or certificates evidencing the same shall not be construed as a limitation of Contracting Party’s obligation to indemnify City, its officers, employees, contractors, subcontractors, or agents. E.2 Remedies. In addition to any other remedies City may have if Contracting Party fails to provide or maintain any insurance policies or policy 176 Exhibit E Page 3 of 6 endorsements to the extent and within the time herein required, City may, at its sole option: a. Obtain such insurance and deduct and retain the amount of the premiums for such insurance from any sums due under this Agreement. b. Order Contracting Party to stop work under this Agreement and/or withhold any payment(s) which become due to Contracting Party hereunder until Contracting Party demonstrates compliance with the requirements hereof. c. Terminate this Agreement. Exercise of any of the above remedies, however, is an alternative to any other remedies City may have. The above remedies are not the exclusive remedies for Contracting Party’s failure to maintain or secure appropriate policies or endorsements. Nothing herein contained shall be construe d as limiting in any way the extent to which Contracting Party may be held responsible for payments of damages to persons or property resulting from Contracting Party’s or its subcontractors’ performance of work under this Agreement. E.3 General Conditions Pertaining to Provisions of Insurance Coverage by Contracting Party. Contracting Party and City agree to the following with respect to insurance provided by Contracting Party: 1. Contracting Party agrees to have its insurer endorse the third party general liability coverage required herein to include as additional insureds City, its officials, employees, and agents, using standard ISO endorsement No. CG 2010 with an edition prior to 1992. Contracting Party also agrees to require all contractors, and subcontractors to do likewise. 2. No liability insurance coverage provided to comply with this Agreement shall prohibit Contracting Party, or Contracting Party’s employees, or agents, from waiving the right of subrogation prior to a loss. Contracting Party agrees to waive subrogation rights against City regardless of the applicability of any insurance proceeds, and to require all contractors and subcontractors to do likewise. 3. All insurance coverage and limits provided by Contracting Party and available or applicable to this Agreement are intended to apply to the full extent of the policies. Nothing contained in this Agreement or any other agreement relating to City or its operations limits the application of such insurance coverage. 177 Exhibit E Page 4 of 6 4. None of the coverages required herein will be in compliance with these requirements if they include any limiting endorsement of any kind that has not been first submitted to City and approved of in writing. 5. No liability policy shall contain any provision or definition that would serve to eliminate so-called “third party action over” claims, including any exclusion for bodily injury to an employee of the insured or of any contractor or subcontractor. 6. All coverage types and limits required are subject to approval, modification and additional requirements by the City, as the need arises. Contracting Party shall not make any reductions in scope of coverage (e.g. elimination of contractual liability or reduction of discovery period) that may affect City’s protection without City’s prior written consent. 7. Proof of compliance with these insurance requirements, consisting of certificates of insurance evidencing all the coverages required and an additional insured endorsement to Contracting Party’s general liability policy, shall be delivered to City at or prior to the execution of this Agreement. In the event such proof of any insurance is not delivered as required, or in the event such insurance is canceled at any time and no replacement coverage is provided, City has the right, but not the duty, to obtain any insurance it deems necessary to protect its interests under this or any other agreement and to pay the premium. Any premium so paid by City shall be charged to and promptly paid by Contracting Party or deducted from sums due Contracting Party, at City option. 8. It is acknowledged by the parties of this agreement that all insurance coverage required to be provided by Contracting Party or any subcontractor, is intended to apply first and on a primary, non -contributing basis in relation to any other insurance or self-insurance available to City. 9. Contracting Party agrees to ensure that subcontractors, and any other party involved with the project that is brought onto or involved in the project by Contracting Party, provide the same minimum insurance coverage required of Contracting Party. Contracting Party agrees to monitor and review all such coverage and assumes all responsibility for ensuring that such coverage is provided in conformity with the requirements of this section. Contracting Party agrees that upon request, all agreements with subcontractors and others engaged in the project will be submitted to City for review. 10. Contracting Party agrees not to self-insure or to use any self- insured retentions or deductibles on any portion o f the insurance required herein (with the exception of professional liability coverage, if required) and 178 Exhibit E Page 5 of 6 further agrees that it will not allow any contractor, subcontractor, Architect, Engineer or other entity or person in any way involved in the performan ce of work on the project contemplated by this agreement to self-insure its obligations to City. If Contracting Party’s existing coverage includes a deductible or self-insured retention, the deductible or self -insured retention must be declared to the City. At that time the City shall review options with the Contracting Party, which may include reduction or elimination of the deductible or self-insured retention, substitution of other coverage, or other solutions. 11. The City reserves the right at any time during the term of this Agreement to change the amounts and types of insurance required by giving the Contracting Party ninety (90) days advance written notice of such change. If such change results in substantial additional cost to the Contracting Party, the City will negotiate additional compensation proportional to the increased benefit to City. 12. For purposes of applying insurance coverage only, this Agreement will be deemed to have been executed immediately upon any party hereto taking any steps that can be deemed to be in furtherance of or towards performance of this Agreement. 13. Contracting Party acknowledges and agrees that any actual or alleged failure on the part of City to inform Contracting Party of non - compliance with any insurance requirement in no way imposes any additional obligations on City nor does it waive any rights hereunder in this or any other regard. 14. Contracting Party will renew the required coverage annually as long as City, or its employees or agents face an exposure from operations of any type pursuant to this agreement. This obligation applies whether the agreement is canceled or terminated for any reason. Termination of this obligation is not effective until City executes a written statement to that effect. 15. Contracting Party shall provide proof that policies of insurance required herein expiring during the term of this Agreement have been renewed or replaced with other policies providing at least the same coverage. Proof that such coverage has been ordered shall be submitted prior to expiration. A coverage binder or letter from Contracting Party’s insurance agent to this effect is acceptable. A certificate of insurance and an additional insured endorsement is required in these specifications applicable to the renewing or new coverage must be provided to City within five (5) days of the expiration of coverages. 179 Exhibit E Page 6 of 6 16. The provisions of any workers’ compensation or similar act will not limit the obligations of Contracting Party under this agreement. Contracting Party expressly agrees not to use any statutory immunity defenses under such laws with respect to City, its employees, officials, and agents. 17. Requirements of specific coverage features, or limits contained in this section are not intended as limitations on coverage, limits or other requirements nor as a waiver of any coverage normally provided by any given policy. Specific reference to a given coverage feature is for purposes of clarification only as it pertains to a given issue and is not intended by any party or insured to be limiting or all-inclusive. 18. These insurance requirements are intended to be separate and distinct from any other provision in this Agreement and are intended by the parties here to be interpreted as such. 19. The requirements in this Exhibit supersede all other secti ons and provisions of this Agreement to the extent that any other section or provision conflicts with or impairs the provisions of this Exhibit. 20. Contracting Party agrees to be responsible for ensuring that no contract used by any party involved in any way with the project reserves the right to charge City or Contracting Party for the cost of additional insurance coverage required by this agreement. Any such provisions are to be deleted with reference to City. It is not the intent of City to reimburse any third party for the cost of complying with these requirements. There shall be no recourse against City for payment of premiums or other amounts with respect thereto. 21. Contracting Party agrees to provide immediate notice to City of any claim or loss against Contracting Party arising out of the work performed under this agreement. City assumes no obligation or liability by such notice, but has the right (but not the duty) to monitor the handling of any such claim or claims if they are likely to involve City. 180 Exhibit F Page 1 of 3 Exhibit F Indemnification F.1 Indemnity for the Benefit of City. a. Indemnification for Professional Liability. When the law establishes a professional standard of care for Contracting Party’s Services, to the fullest extent permitted by law, Contracting Party shall indemnify, protect, defend (with counsel selected by City), and hold harmless City and any and all of its officials, employees, and agents (“Indemnified Parties”) from and against any and all claims, losses, liabilities of every kind, nature, and description, damages, injury (including, without limitation, injury to or death of an employee of Contracting Party or of any subcontractor), costs and expenses of any kind, whether actual, alleged or threatened, including, without limitation, incidental and consequential damages, court costs, attorneys’ fees, litigation expenses, and fees of expert consultants or expert witnesses incurred in connection therewith and costs of investigation, to the extent same are caused in whole or in part by any negligent or wrongful act, error or omission of Contracting Party, its officers, agents, employees or subcontractors (or any entity or individual that Contracting Party shall bear the legal liability thereof) in the performance of professional services under this agreement. With respect to the design of public improvements, the Contracting Party shall not be liable for any injuries or property damage resulting from the reuse of the design at a location other than that specified in Exhibit A without the written consent of the Contracting Party. b. Indemnification for Other Than Professional Liability. Other than in the performance of professional services and to the full extent permitted by law, Contracting Party shall indemnify, defend (with counsel selected by City), and hold harmless the Indemnified Parties from and against any liability (including liability for claims, suits, actions, arbitration proceedings, administrative proceedings, regulatory proceedings, losses, expenses or costs of any kind, whether actual, alleged or threatened, including, without limitation, incidental and consequential damages, court costs, attorneys’ fees, litigation expenses, and fees of expert consultants or expert witnesses) incurred in connection therewith and costs of investigation, where the same arise out of, are a consequence of, or are in any way attributable to, in whole or in part, the performance of this Agreement by Contracting Party or by any individual or entity for which Contracting Party is legally liable, including but not limited to officers, agents, employees, or subcontractors of Contracting Party. c. Indemnity Provisions for Contracts Related to Construction (Limitation on Indemnity). Without affecting the rights of City under any 181 Exhibit F Page 2 of 3 provision of this agreement, Contracting Party shall not be required to indemnify and hold harmless City for liability attributable to the active negligence of City, provided such active negligence is determined by agreement between the parties or by the findings of a court of competent jurisdiction. In instances where City is shown to have been actively negligent and where City’s active negligence accounts for only a percentage of the liability involved, the obligation of Contracting Party will be for that entire portion or percentage of liability not attributable to the active negligence of City. d. Indemnification Provision for Design Professionals. 1. Applicability of this Section F.1(d). Notwithstanding Section F.1(a) hereinabove, the following indemnification provision shall apply to a Contracting Party who constitutes a “design professional” as the term is defined in paragraph 3 below. 2. Scope of Indemnification. When the law establishes a professional standard of care for Contracting Party’s Services, to the fullest extent permitted by law, Contracting Party shall indemnify and hold harmless City and any and all of its officials, employees, and agents (“Indemnified Parties”) from and against any and all losses, liabilities of every kind, nature, and description, damages, injury (including, without limitation, injury to or death of an employee of Contracting Party or of any subcontractor), costs and expenses, including, without limitation, incidental and consequential damages, court costs, reimbursement of attorneys’ fees, litigation expenses, and fees of expert consultants or expert witnesses incurred in connection therewith and costs of investigation, to the extent same are caused by any negligent or wrongful act, error or omission of Contracting Party, its officers, agents, employees or subcontractors (or any entity or individual that Contracting Party shall bear the legal liability thereof) in the performance of professional services under this agreement. With respect to the design of public improvements, the Contracting Party shall not be liable for any injuries or property damage resulting from the reuse of the design at a location other than that specified in Exhibit A without the written consent of the Contracting Party. 3. Design Professional Defined. As used in this Section F.1(d), the term “design professional” shall be limited to licensed architects, registered professional engineers, licensed professional land surveyors and landscape architects, all as defined under current law, and as may be amended from time to time by Civil Code § 2782.8. F.2 Obligation to Secure Indemnification Provisions. Contracting Party agrees to obtain executed indemnity agreements with provisions 182 Exhibit F Page 3 of 3 identical to those set forth herein this Exhibit F, as applicable to the Contracting Party, from each and every subcontractor or any other person or entity involved by, for, with or on behalf of Contracting Party in the performance of this Agreement. In the event Contracting Party fails to obtain such indemnity obligations from others as required herein, Contracting Party agrees to be fully responsible according to the terms of this Exhibit. Failure of City to monitor compliance with these requirements imposes no additional obligations on City and will in no way act as a waiver of any rights hereunder. This obligation to indemnify and defend City as set forth in this Agreement are binding on the successors, assigns or heirs of Contracting Party and shall survive the termination of this Agreement. 183 184 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: APPROVE AGREEMENT FOR CONTRACT SERVICES WITH ST. FRANCIS ELECTRIC FOR ON-CALL TRAFFIC SIGNAL REPAIR SERVICES RECOMMENDATION Approve Agreement for Contract Services with St. Francis Electric in an amount not to exceed $75,000 per year for three years, to provide on call traffic signal repair services; and authorize the City Manager to execute the agreement. EXECUTIVE SUMMARY •Repairs to the City’s traffic signals can require specialized equipment and certain expertise that staff does not possess or needed service at times when staff is not available. •Staff solicited proposals for on-call traffic signal repair services from qualified firms. •St Francis Electric was selected as the best qualified firm and staff recommends approval of the Agreement for Contract Services (Attachment 1). FISCAL IMPACT The not to exceed annual agreement amount of $75,000 could cost up to $225,000 during the three-year term. Funds are available in Traffic Signal Maintenance 1920TMI (401-0000-60188) for 2019/20. Funding will be budgeted in subsequent fiscal years. BACKGROUND/ANALYSIS In August 2019, the City received three proposals in response to the on-call traffic signal repair services request for proposals. Staff reviewed the proposals and St. Francis Electric was selected as the top ranked firm; St. Francis Electric was the most cost effective and qualified firm. Siemens and Bear Electrical Solutions also submitted proposals. CONSENT CALENDAR ITEM NO. 13 185 Council could elect not to approve the agreement. Prepared by: Julie Mignogna, Management Analyst Approved by: Bryan McKinney, City Engineer Attachment: 1.Agreement for Contract Services with St. Francis Electric ALTERNATIVES 186 AGREEMENT FOR CONTRACT SERVICES THIS AGREEMENT FOR CONTRACT SERVICES (the “Agreement”) is made and entered into by and between the CITY OF LA QUINTA, (“City”), a California municipal corporation, and St. Francis Electric (“Contracting Party”). The parties hereto agree as follows: 1.SERVICES OF CONTRACTING PARTY. 1.1 Scope of Services. In compliance with all terms and conditions of this Agreement, Contracting Party shall provide those services related to On- Call Traffic Signal Repair Services, as specified in the “Scope of Services” attached hereto as “Exhibit A” and incorporated herein by this reference (the “Services”). Contracting Party represents and warrants that Contracting Party is a provider of first-class work and/or services and Contracting Party is experienced in performing the Services contemplated herein and, in light of such status and experience, Contracting Party covenants that it shall follow industry standards in performing the Services required hereunder, and that all materials, if any, will be of good quality, fit for the purpose intended. For purposes of this Agreement, the phrase “industry standards” shall mean those standards of practice recognized by one or more first-class firms performing similar services under similar circumstances. 1.2 Compliance with Law. All Services rendered hereunder shall be provided in accordance with all ordinances, resolutions, statutes, rules, regulations, and laws of the City and any Federal, State, or local governmental agency of competent jurisdiction. 1.3 Wage and Hour Compliance, Contracting Party shall comply with applicable Federal, State, and local wage and hour laws. 1.4 Licenses, Permits, Fees and Assessments. Except as otherwise specified herein, Contracting Party shall obtain at its sole cost and expense such licenses, permits, and approvals as may be required by law for the performance of the Services required by this Agreement, including a City of La Quinta business license. Contracting Party and its employees, agents, and subcontractors shall, at their sole cost and expense, keep in effect at all times during the term of this Agreement any licenses, permits, and approvals that are legally required for the performance of the Services required by this Agreement. Contracting Party shall have the sole obligation to pay for any fees, assessments, and taxes, plus applicable penalties and interest, which may be imposed by law and arise from or are necessary for the performance of the Services required by this Agreement, and shall indemnify, defend (with counsel selected by City), and hold City, its elected officials, officers, employees, and agents, free and harmless against any such fees, ATTACHMENT 1 187 -2- assessments, taxes, penalties, or interest levied, assessed, or imposed against City hereunder. Contracting Party shall be responsible for all subcontractors’ compliance with this Section. 1.5 Familiarity with Work. By executing this Agreement, Contracting Party warrants that (a) it has thoroughly investigated and considered the Services to be performed, (b) it has investigated the site where the Services are to be performed, if any, and fully acquainted itself with the conditions there existing, (c) it has carefully considered how the Services should be performed, and (d) it fully understands the facilities, difficulties, and restrictions attending performance of the Services under this Agreement. Should Contracting Party discover any latent or unknown conditions materially differing from those inherent in the Services or as represented by City, Contracting Party shall immediately inform City of such fact and shall not proceed except at Contracting Party’s risk until written instructions are received from the Contract Officer, or assigned designee (as defined in Section 4.2 hereof). 1.6 Standard of Care. Contracting Party acknowledges and understands that the Services contracted for under this Agreement require specialized skills and abilities and that, consistent with this understanding, Contracting Party’s work will be held to an industry standard of quality and workmanship. Consistent with Section 1.5 hereinabove, Contracting Party represents to City that it holds the necessary skills and abilities to satisfy the industry standard of quality as set forth in this Agreement. Contracting Party shall adopt reasonable methods during the life of this Agreement to furnish continuous protection to the Services performed by Contracting Party, and the equipment, materials, papers, and other components thereof to prevent losses or damages, and shall be responsible for all such damages, to persons or property, until acceptance of the Services by City, except such losses or damages as may be caused by City’s own negligence. The performance of Services by Contracting Party shall not relieve Contracting Party from any obligation to correct any incomplete, inaccurate, or defective work at no further cost to City, when such inaccuracies are due to the negligence of Contracting Party. 1.7 Additional Services. In accordance with the terms and conditions of this Agreement, Contracting Party shall perform services in addition to those specified in the Scope of Services (“Additional Services”) only when directed to do so by the Contract Officer, or assigned designee, provided that Contracting Party shall not be required to perform any Additional Services without compensation. Contracting Party shall not perform any Additional Services until receiving prior written authorization (in the form of a written change order if Contracting Party is a contractor performing the Services) from 188 -3- the Contract Officer, or assigned designee, incorporating therein any adjustment in (i) the Contract Sum, and/or (ii) the time to perform this Agreement, which said adjustments are subject to the written approval of Contracting Party. It is expressly understood by Contracting Party that the provisions of this Section shall not apply to the Services specifically set forth in the Scope of Services or reasonably contemplated therein. It is specifically understood and agreed that oral requests and/or approvals of Additional Services shall be barred and are unenforceable. Failure of Contracting Party to secure the Contract Officer’s, or assigned designee’s written authorization for Additional Services shall constitute a waiver of any and all right to adjustment of the Contract Sum or time to perform this Agreement, whether by way of compensation, restitution, quantum meruit, or the like, for Additional Services provided without the appropriate authorization from the Contract Officer, or assigned designee. Compensation for properly authorized Additional Services shall be made in accordance with Section 2.3 of this Agreement. 1.8 Special Requirements. Additional terms and conditions of this Agreement, if any, which are made a part hereof are set forth in “Exhibit D” (the “Special Requirements”), which is incorporated herein by this reference and expressly made a part hereof. In the event of a conflict between the provisions of the Special Requirements and any other provisions of this Agreement, the provisions of the Special Requirements shall govern. 2. COMPENSATION. 2.1 Contract Sum. For the Services rendered pursuant to this Agreement, Contracting Party shall be compensated in accordance with “Exhibit B” (the “Schedule of Compensation”) in a total amount not to exceed Seventy Five Thousand Dollars ($75,000.00) per year for the life of the Agreement, encompassing the initial and any extended terms. (the “Contract Sum”), except as provided in Section 1.7. The method of compensation set forth in the Schedule of Compensation may include a lump sum payment upon completion, payment in accordance with the percentage of completion of the Services, payment for time and materials based upon Contracting Party’s rate schedule, but not exceeding the Contract Sum, or such other reasonable methods as may be specified in the Schedule of Compensation. The Contract Sum shall include the attendance of Contracting Party at all project meetings reasonably deemed necessary by City; Contracting Party shall not be entitled to any additional compensation for attending said meetings. Compensation may include reimbursement for actual and necessary expenditures for reproduction costs, transportation expense, telephone expense, and similar costs and expenses when and if specified in the Schedule of Compensation. Regardless of the method of compensation set forth in the Schedule of 189 -4- Compensation, Contracting Party’s overall compensation shall not exceed the Contract Sum, except as provided in Section 1.7 of this Agreement. 2.2 Method of Billing & Payment. Any month in which Contracting Party wishes to receive payment, Contracting Party shall submit to City no later than the tenth (10th) working day of such month, in the form approved by City’s Finance Director, an invoice for Services rendered prior to the date of the invoice. Such invoice shall (1) describe in detail the Services provided, including time and materials, and (2) specify each staff member who has provided Services and the number of hours assigned to each such staff member. Such invoice shall contain a certification by a principal member of Contracting Party specifying that the payment requested is for Services performed in accordance with the terms of this Agreement. Upon approval in writing by the Contract Officer, or assigned designee, and subject to retention pursuant to Section 8.3, City will pay Contracting Party for all items stated thereon which are approved by City pursuant to this Agreement no later than thirty (30) days after invoices are received by the City’s Finance Department. 2.3 Compensation for Additional Services. Additional Services approved in advance by the Contract Officer, or assigned designee, pursuant to Section 1.7 of this Agreement shall be paid for in an amount agreed to in writing by both City and Contracting Party in advance of the Additional Services being rendered by Contracting Party. Any compensation for Additional Services amounting to five percent (5%) or less of the Contract Sum may be approved by the Contract Officer, or assigned designee. Any greater amount of compensation for Additional Services must be approved by the La Quinta City Council, the City Manager, or Department Director, depending upon City laws, regulations, rules and procedures concerning public contracting. Under no circumstances shall Contracting Party receive compensation for any Additional Services unless prior written approval for the Additional Services is obtained from the Contract Officer, or assigned designee, pursuant to Section 1.7 of this Agreement. 3. PERFORMANCE SCHEDULE. 3.1 Time of Essence. Time is of the essence in the performance of this Agreement. If the Services not completed in accordance with the Schedule of Performance, as set forth in Section 3.2 and “Exhibit C”, it is understood that the City will suffer damage. 3.2 Schedule of Performance. All Services rendered pursuant to this Agreement shall be performed diligently and within the time period established in “Exhibit C” (the “Schedule of Performance”). Extensions to the 190 -5- time period specified in the Schedule of Performance may be approved in writing by the Contract Officer, or assigned designee. 3.3 Force Majeure. The time period specified in the Schedule of Performance for performance of the Services rendered pursuant to this Agreement shall be extended because of any delays due to unforeseeable causes beyond the control and without the fault or negligence of Contracting Party, including, but not restricted to, acts of God or of the public enemy, fires, earthquakes, floods, epidemic, quarantine restrictions, riots, strikes, freight embargoes, acts of any governmental agency other than City, and unusually severe weather, if Contracting Party shall within ten (10) days of the commencement of such delay notify the Contract Officer, or assigned designee, in writing of the causes of the delay. The Contract Officer, or assigned designee, shall ascertain the facts and the extent of delay, and extend the time for performing the Services for the period of the forced delay when and if in the Contract Officer’s judgment such delay is justified, and the Contract Officer’s determination, or assigned designee, shall be final and conclusive upon the parties to this Agreement. Extensions to time period in the Schedule of Performance which are determined by the Contract Officer, or assigned designee, to be justified pursuant to this Section shall not entitle the Contracting Party to additional compensation in excess of the Contract Sum. 3.4 Term. Unless earlier terminated in accordance with the provisions in Article 8.0 of this Agreement, the term of this agreement shall commence on September 18, 2019, and terminate on June 30, 2022 (“Initial Term”). This Agreement may be extended for two (2) additional year(s) upon mutual agreement by both parties (“Extended Term”). 4. COORDINATION OF WORK. 4.1 Representative of Contracting Party. The following principals of Contracting Party (“Principals”) are hereby designated as being the principals and representatives of Contracting Party authorized to act in its behalf with respect to the Services specified herein and make all decisions in connection therewith: (a) Name: Jill Petrie, Southern CA Area Mgr. Tel No. (951)304-4903 E-mail: jpetrie@sfe-inc.com (b) Name: Guy Smith, Vice President Tel No. 510-6390-0639 Email: guy@sfe-inc.com 191 -6- It is expressly understood that the experience, knowledge, capability, and reputation of the foregoing Principals were a substantial inducement for City to enter into this Agreement. Therefore, the foregoing Principals shall be responsible during the term of this Agreement for directing all activities of Contracting Party and devoting sufficient time to personally supervise the Services hereunder. For purposes of this Agreement, the foregoing Principals may not be changed by Contracting Party and no other personnel may be assigned to perform the Services required hereunder without the express written approval of City. 4.2 Contract Officer. The “Contract Officer”, otherwise known as the Bryan McKinney, PE, City Engineer, or assigned designee may be designated in writing by the City Manager of the City. It shall be Contracting Party’s responsibility to assure that the Contract Officer, or assigned designee, is kept informed of the progress of the performance of the Services, and Contracting Party shall refer any decisions, that must be made by City to the Contract Officer, or assigned designee. Unless otherwise specified herein, any approval of City required hereunder shall mean the approval of the Contract Officer, or assigned designee. The Contract Officer, or assigned designee, shall have authority to sign all documents on behalf of City required hereunder to carry out the terms of this Agreement. 4.3 Prohibition Against Subcontracting or Assignment. The experience, knowledge, capability, and reputation of Contracting Party, its principals, and its employees were a substantial inducement for City to enter into this Agreement. Except as set forth in this Agreement, Contracting Party shall not contract or subcontract with any other entity to perform in whole or in part the Services required hereunder without the express written approval of City. In addition, neither this Agreement nor any interest herein may be transferred, assigned, conveyed, hypothecated, or encumbered, voluntarily or by operation of law, without the prior written approval of City. Transfers restricted hereunder shall include the transfer to any person or group of persons acting in concert of more than twenty five percent (25%) of the present ownership and/or control of Contracting Party, taking all transfers into account on a cumulative basis. Any attempted or purported assignment or contracting or subcontracting by Contracting Party without City’s express written approval shall be null, void, and of no effect. No approved transfer shall release Contracting Party of any liability hereunder without the express consent of City. 4.4 Independent Contractor. Neither City nor any of its employees shall have any control over the manner, mode, or means by which Contracting Party, its agents, or its employees, perform the Services required herein, except as otherwise set forth herein. City shall have no voice in the selection, 192 -7- discharge, supervision, or control of Contracting Party’s employees, servants, representatives, or agents, or in fixing their number or hours of service. Contracting Party shall perform all Services required herein as an independent contractor of City and shall remain at all times as to City a wholly independent contractor with only such obligations as are consistent with that role. Contracting Party shall not at any time or in any manner represent that it or any of its agents or employees are agents or employees of City. City shall not in any way or for any purpose become or be deemed to be a partner of Contracting Party in its business or otherwise or a joint venture or a member of any joint enterprise with Contracting Party. Contracting Party shall have no power to incur any debt, obligation, or liability on behalf of City. Contracting Party shall not at any time or in any manner represent that it or any of its agents or employees are agents or employees of City. Except for the Contract Sum paid to Contracting Party as provided in this Agreement, City shall not pay salaries, wages, or other compensation to Contracting Party for performing the Services hereunder for City. City shall not be liable for compensation or indemnification to Contracting Party for injury or sickness arising out of performing the Services hereunder. Notwithstanding any other City, state, or federal policy, rule, regulation, law, or ordinance to the contrary, Contracting Party and any of its employees, agents, and subcontractors providing services under this Agreement shall not qualify for or become entitled to any compensation, benefit, or any incident of employment by City, including but not limited to eligibility to enroll in the California Public Employees Retirement System (“PERS”) as an employee of City and entitlement to any contribution to be paid by City for employer contributions and/or employee contributions for PERS benefits. Contracting Party agrees to pay all required taxes on amounts paid to Contracting Party under this Agreement, and to indemnify and hold City harmless from any and all taxes, assessments, penalties, and interest asserted against City by reason of the independent contractor relationship created by this Agreement. Contracting Party shall fully comply with the workers’ compensation laws regarding Contracting Party and Contracting Party’s employees. Contracting Party further agrees to indemnify and hold City harmless from any failure of Contracting Party to comply with applicable workers’ compensation laws. City shall have the right to offset against the amount of any payment due to Contracting Party under this Agreement any amount due to City from Contracting Party as a result of Contracting Party’s failure to promptly pay to City any reimbursement or indemnification arising under this Section. 4.5 Identity of Persons Performing Work. Contracting Party represents that it employs or will employ at its own expense all personnel required for the satisfactory performance of any and all of the Services set forth herein. Contracting Party represents that the Services required herein will be performed by Contracting Party or under its direct supervision, and 193 -8- that all personnel engaged in such work shall be fully qualified and shall be authorized and permitted under applicable State and local law to perform such tasks and services. 4.6 City Cooperation. City shall provide Contracting Party with any plans, publications, reports, statistics, records, or other data or information pertinent to the Services to be performed hereunder which are reasonably available to Contracting Party only from or through action by City. 5. INSURANCE. 5.1 Insurance. Prior to the beginning of any Services under this Agreement and throughout the duration of the term of this Agreement, Contracting Party shall procure and maintain, at its sole cost and expense, and submit concurrently with its execution of this Agreement, policies of insurance as set forth in “Exhibit E” (the “Insurance Requirements”) which is incorporated herein by this reference and expressly made a part hereof. 5.2 Proof of Insurance. Contracting Party shall provide Certificate of Insurance to Agency along with all required endorsements. Certificate of Insurance and endorsements must be approved by Agency’s Risk Manager prior to commencement of performance. 6. INDEMNIFICATION. 6.1 Indemnification. To the fullest extent permitted by law, Contracting Party shall indemnify, protect, defend (with counsel selected by City), and hold harmless City and any and all of its officers, employees, agents, and volunteers as set forth in “Exhibit F” (“Indemnification”) which is incorporated herein by this reference and expressly made a part hereof. 7. RECORDS AND REPORTS. 7.1 Reports. Contracting Party shall periodically prepare and submit to the Contract Officer, or assigned designee, such reports concerning Contracting Party’s performance of the Services required by this Agreement as the Contract Officer, or assigned designee, shall require. Contracting Party hereby acknowledges that City is greatly concerned about the cost of the Services to be performed pursuant to this Agreement. For this reason, Contracting Party agrees that if Contracting Party becomes aware of any facts, circumstances, techniques, or events that may or will materially increase or decrease the cost of the Services contemplated herein or, if Contracting Party is providing design services, the cost of the project being designed, Contracting Party shall promptly notify the Contract Officer, or assigned designee, of said fact, circumstance, technique, or event and the estimated 194 -9- increased or decreased cost related thereto and, if Contracting Party is providing design services, the estimated increased or decreased cost estimate for the project being designed. 7.2 Records. Contracting Party shall keep, and require any subcontractors to keep, such ledgers, books of accounts, invoices, vouchers, canceled checks, reports (including but not limited to payroll reports), studies, or other documents relating to the disbursements charged to City and the Services performed hereunder (the “Books and Records”), as shall be necessary to perform the Services required by this Agreement and enable the Contract Officer, or assigned designee, to evaluate the performance of such Services. Any and all such Books and Records shall be maintained in accordance with generally accepted accounting principles and shall be complete and detailed. The Contract Officer, or assigned designee, shall have full and free access to such Books and Records at all times during normal business hours of City, including the right to inspect, copy, audit, and make records and transcripts from such Books and Records. Such Books and Records shall be maintained for a period of three (3) years following completion of the Services hereunder, and City shall have access to such Books and Records in the event any audit is required. In the event of dissolution of Contracting Party’s business, custody of the Books and Records may be given to City, and access shall be provided by Contracting Party’s successor in interest. Under California Government Code Section 8546.7, if the amount of public funds expended under this Agreement exceeds Ten Thousand Dollars ($10,000.00), this Agreement shall be subject to the examination and audit of the State Auditor, at the request of City or as part of any audit of City, for a period of three (3) years after final payment under this Agreement. 7.3 Ownership of Documents. All drawings, specifications, maps, designs, photographs, studies, surveys, data, notes, computer files, reports, records, documents, and other materials plans, drawings, estimates, test data, survey results, models, renderings, and other documents or works of authorship fixed in any tangible medium of expression, including but not limited to, physical drawings, digital renderings, or data stored digitally, magnetically, or in any other medium prepared or caused to be prepared by Contracting Party, its employees, subcontractors, and agents in the performance of this Agreement (the “Documents and Materials”) shall be the property of City and shall be delivered to City upon request of the Contract Officer, or assigned designee, or upon the expiration or termination of this Agreement, and Contracting Party shall have no claim for further employment or additional compensation as a result of the exercise by City of its full rights of ownership use, reuse, or assignment of the Documents and Materials hereunder. Any use, reuse or assignment of such completed Documents and 195 -10- Materials for other projects and/or use of uncompleted documents without specific written authorization by Contracting Party will be at City’s sole risk and without liability to Contracting Party, and Contracting Party’s guarantee and warranties shall not extend to such use, revise, or assignment. Contracting Party may retain copies of such Documents and Materials for its own use. Contracting Party shall have an unrestricted right to use the concepts embodied therein. All subcontractors shall provide for assignment to City of any Documents and Materials prepared by them, and in the event Contracting Party fails to secure such assignment, Contracting Party shall indemnify City for all damages resulting therefrom. 7.4 In the event City or any person, firm, or corporation authorized by City reuses said Documents and Materials without written verification or adaptation by Contracting Party for the specific purpose intended and causes to be made or makes any changes or alterations in said Documents and Materials, City hereby releases, discharges, and exonerates Contracting Party from liability resulting from said change. The provisions of this clause shall survive the termination or expiration of this Agreement and shall thereafter remain in full force and effect. 7.5 Licensing of Intellectual Property. This Agreement creates a non- exclusive and perpetual license for City to copy, use, modify, reuse, or sublicense any and all copyrights, designs, rights of reproduction, and other intellectual property embodied in the Documents and Materials. Contracting Party shall require all subcontractors, if any, to agree in writing that City is granted a non-exclusive and perpetual license for the Documents and Materials the subcontractor prepares under this Agreement. Contracting Party represents and warrants that Contracting Party has the legal right to license any and all of the Documents and Materials. Contracting Party makes no such representation and warranty in regard to the Documents and Materials which were prepared by design professionals other than Contracting Party or provided to Contracting Party by City. City shall not be limited in any way in its use of the Documents and Materials at any time, provided that any such use not within the purposes intended by this Agreement shall be at City’s sole risk. 7.6 Release of Documents. The Documents and Materials shall not be released publicly without the prior written approval of the Contract Officer, or assigned designee, or as required by law. Contracting Party shall not disclose to any other entity or person any information regarding the activities of City, except as required by law or as authorized by City. 7.7 Confidential or Personal Identifying Information. Contracting Party covenants that all City data, data lists, trade secrets, documents with personal identifying information, documents that are not public records, draft 196 -11- documents, discussion notes, or other information, if any, developed or received by Contracting Party or provided for performance of this Agreement are deemed confidential and shall not be disclosed by Contracting Party to any person or entity without prior written authorization by City or unless required by law. City shall grant authorization for disclosure if required by any lawful administrative or legal proceeding, court order, or similar directive with the force of law. All City data, data lists, trade secrets, documents with personal identifying information, documents that are not public records, draft documents, discussions, or other information shall be returned to City upon the termination or expiration of this Agreement. Contracting Party’s covenant under this section shall survive the termination or expiration of this Agreement. 8. ENFORCEMENT OF AGREEMENT. 8.1 California Law. This Agreement shall be interpreted, construed, and governed both as to validity and to performance of the parties in accordance with the laws of the State of California. Legal actions concerning any dispute, claim, or matter arising out of or in relation to this Agreement shall be instituted in the Superior Court of the County of Riverside, State of California, or any other appropriate court in such county, and Contracting Party covenants and agrees to submit to the personal jurisdiction of such court in the event of such action. 8.2 Disputes. In the event of any dispute arising under this Agreement, the injured party shall notify the injuring party in writing of its contentions by submitting a claim therefore. The injured party shall continue performing its obligations hereunder so long as the injuring party commences to cure such default within ten (10) days of service of such notice and completes the cure of such default within forty-five (45) days after service of the notice, or such longer period as may be permitted by the Contract Officer, or assigned designee; provided that if the default is an immediate danger to the health, safety, or general welfare, City may take such immediate action as City deems warranted. Compliance with the provisions of this Section shall be a condition precedent to termination of this Agreement for cause and to any legal action, and such compliance shall not be a waiver of any party’s right to take legal action in the event that the dispute is not cured, provided that nothing herein shall limit City’s right to terminate this Agreement without cause pursuant to this Article 8.0. During the period of time that Contracting Party is in default, City shall hold all invoices and shall, when the default is cured, proceed with payment on the invoices. In the alternative, City may, in its sole discretion, elect to pay some or all of the outstanding invoices during any period of default. 197 -12- 8.3 Retention of Funds. City may withhold from any monies payable to Contracting Party sufficient funds to compensate City for any losses, costs, liabilities, or damages it reasonably believes were suffered by City due to the default of Contracting Party in the performance of the Services required by this Agreement. 8.4 Waiver. No delay or omission in the exercise of any right or remedy of a non-defaulting party on any default shall impair such right or remedy or be construed as a waiver. City’s consent or approval of any act by Contracting Party requiring City’s consent or approval shall not be deemed to waive or render unnecessary City’s consent to or approval of any subsequent act of Contracting Party. Any waiver by either party of any default must be in writing and shall not be a waiver of any other default concerning the same or any other provision of this Agreement. 8.5 Rights and Remedies are Cumulative. Except with respect to rights and remedies expressly declared to be exclusive in this Agreement, the rights and remedies of the parties are cumulative and the exercise by either party of one or more of such rights or remedies shall not preclude the exercise by it, at the same or different times, of any other rights or remedies for the same default or any other default by the other party. 8.6 Legal Action. In addition to any other rights or remedies, either party may take legal action, at law or at equity, to cure, correct, or remedy any default, to recover damages for any default, to compel specific performance of this Agreement, to obtain declaratory or injunctive relief, or to obtain any other remedy consistent with the purposes of this Agreement. 8.7 Termination Prior To Expiration of Term. This Section shall govern any termination of this Agreement, except as specifically provided in the following Section for termination for cause. City reserves the right to terminate this Agreement at any time, with or without cause, upon thirty (30) days’ written notice to Contracting Party. Upon receipt of any notice of termination, Contracting Party shall immediately cease all Services hereunder except such as may be specifically approved by the Contract Officer, or assigned designee. Contracting Party shall be entitled to compensation for all Services rendered prior to receipt of the notice of termination and for any Services authorized by the Contract Officer, or assigned designee, thereafter in accordance with the Schedule of Compensation or such as may be approved by the Contract Officer, or assigned designee, except amounts held as a retention pursuant to this Agreement. 8.8 Termination for Default of Contracting Party. If termination is due to the failure of Contracting Party to fulfill its obligations under this Agreement, Contracting Party shall vacate any City-owned property which Contracting 198 -13- Party is permitted to occupy hereunder and City may, after compliance with the provisions of Section 8.2, take over the Services and prosecute the same to completion by contract or otherwise, and Contracting Party shall be liable to the extent that the total cost for completion of the Services required hereunder exceeds the compensation herein stipulated (provided that City shall use reasonable efforts to mitigate such damages), and City may withhold any payments to Contracting Party for the purpose of setoff or partial payment of the amounts owed City. 8.9 Attorneys’ Fees. If either party to this Agreement is required to initiate or defend or made a party to any action or proceeding in any way connected with this Agreement, the prevailing party in such action or proceeding, in addition to any other relief which may be granted, whether legal or equitable, shall be entitled to reasonable attorneys’ fees; provided, however, that the attorneys’ fees awarded pursuant to this Section shall not exceed the hourly rate paid by City for legal services multiplied by the reasonable number of hours spent by the prevailing party in the conduct of the litigation. Attorneys’ fees shall include attorneys’ fees on any appeal, and in addition a party entitled to attorneys’ fees shall be entitled to all other reasonable costs for investigating such action, taking depositions and discovery, and all other necessary costs the court allows which are incurred in such litigation. All such fees shall be deemed to have accrued on commencement of such action and shall be enforceable whether or not such action is prosecuted to judgment. The court may set such fees in the same action or in a separate action brought for that purpose. 9. CITY OFFICERS AND EMPLOYEES; NONDISCRIMINATION. 9.1 Non-liability of City Officers and Employees. No officer, official, employee, agent, representative, or volunteer of City shall be personally liable to Contracting Party, or any successor in interest, in the event or any default or breach by City or for any amount which may become due to Contracting Party or to its successor, or for breach of any obligation of the terms of this Agreement. 9.2 Conflict of Interest. Contracting Party covenants that neither it, nor any officer or principal of it, has or shall acquire any interest, directly or indirectly, which would conflict in any manner with the interests of City or which would in any way hinder Contracting Party’s performance of the Services under this Agreement. Contracting Party further covenants that in the performance of this Agreement, no person having any such interest shall be employed by it as an officer, employee, agent, or subcontractor without the express written consent of the Contract Officer, or assigned designee. Contracting Party agrees to at all times avoid conflicts of interest or the 199 -14- appearance of any conflicts of interest with the interests of City in the performance of this Agreement. No officer or employee of City shall have any financial interest, direct or indirect, in this Agreement nor shall any such officer or employee participate in any decision relating to this Agreement which effects his financial interest or the financial interest of any corporation, partnership or association in which he is, directly or indirectly, interested, in violation of any State statute or regulation. Contracting Party warrants that it has not paid or given and will not pay or give any third party any money or other consideration for obtaining this Agreement. 9.3 Covenant against Discrimination. Contracting Party covenants that, by and for itself, its heirs, executors, assigns, and all persons claiming under or through them, that there shall be no discrimination against or segregation of, any person or group of persons on account of any impermissible classification including, but not limited to, race, color, creed, religion, sex, marital status, sexual orientation, national origin, or ancestry in the performance of this Agreement. Contracting Party shall take affirmative action to ensure that applicants are employed and that employees are treated during employment without regard to their race, color, creed, religion, sex, marital status, sexual orientation, national origin, or ancestry. 10. MISCELLANEOUS PROVISIONS. 10.1 Notice. Any notice, demand, request, consent, approval, or communication either party desires or is required to give the other party or any other person shall be in writing and either served personally or sent by prepaid, first-class mail to the address set forth below. Either party may change its address by notifying the other party of the change of address in writing. Notice shall be deemed communicated forty-eight (48) hours from the time of mailing if mailed as provided in this Section. To City: CITY OF LA QUINTA Attention: Bryan McKinney, PE 78495 Calle Tampico La Quinta, California 92253 To Contracting Party: St. Francis Electric Jill Petrie, Southern CA Area Mgr. 1420 Citrus St. Riverside, CA 92507 200 -15- 10.2 Interpretation. The terms of this Agreement shall be construed in accordance with the meaning of the language used and shall not be construed for or against either party by reason of the authorship of this Agreement or any other rule of construction which might otherwise apply. 10.3 Section Headings and Subheadings. The section headings and subheadings contained in this Agreement are included for convenience only and shall not limit or otherwise affect the terms of this Agreement. 10.4 Counterparts. This Agreement may be executed in counterparts, each of which shall be deemed to be an original, and such counterparts shall constitute one and the same instrument 10.5 Integrated Agreement. This Agreement including the exhibits hereto is the entire, complete, and exclusive expression of the understanding of the parties. It is understood that there are no oral agreements between the parties hereto affecting this Agreement and this Agreement supersedes and cancels any and all previous negotiations, arrangements, agreements, and understandings, if any, between the parties, and none shall be used to interpret this Agreement. 10.6 Amendment. No amendment to or modification of this Agreement shall be valid unless made in writing and approved by Contracting Party and by the City Council of City. The parties agree that this requirement for written modifications cannot be waived and that any attempted waiver shall be void. 10.7 Severability. In the event that any one or more of the articles, phrases, sentences, clauses, paragraphs, or sections contained in this Agreement shall be declared invalid or unenforceable, such invalidity or unenforceability shall not affect any of the remaining articles, phrases, sentences, clauses, paragraphs, or sections of this Agreement which are hereby declared as severable and shall be interpreted to carry out the intent of the parties hereunder unless the invalid provision is so material that its invalidity deprives either party of the basic benefit of their bargain or renders this Agreement meaningless. 10.8 Unfair Business Practices Claims. In entering into this Agreement, Contracting Party offers and agrees to assign to City all rights, title, and interest in and to all causes of action it may have under Section 4 of the Clayton Act (15 U.S.C. § 15) or under the Cartwright Act (Chapter 2, (commencing with Section 16700) of Part 2 of Division 7 of the Business and Professions Code), arising from purchases of goods, services, or materials related to this Agreement. This assignment shall be made and become effective at the time City renders final payment to Contracting Party without further acknowledgment of the parties. 201 -16- 10.9 No Third-Party Beneficiaries. With the exception of the specific provisions set forth in this Agreement, there are no intended third-party beneficiaries under this Agreement and no such other third parties shall have any rights or obligations hereunder. 10.10 Authority. The persons executing this Agreement on behalf of each of the parties hereto represent and warrant that (i) such party is duly organized and existing, (ii) they are duly authorized to execute and deliver this Agreement on behalf of said party, (iii) by so executing this Agreement, such party is formally bound to the provisions of this Agreement, and (iv) that entering into this Agreement does not violate any provision of any other Agreement to which said party is bound. This Agreement shall be binding upon the heirs, executors, administrators, successors, and assigns of the parties. [SIGNATURES ON FOLLOWING PAGE] 202 -17- IN WITNESS WHEREOF, the parties have executed this Agreement as of the dates stated below. CITY OF LA QUINTA, a California Municipal Corporation JON MCMILLEN, City Manager City of La Quinta, California Dated: CONTRACTING PARTY: By: Name: Guy Smith Title: Vice President ATTEST: MONIKA RADEVA, City Clerk La Quinta, California By: Name: Title: APPROVED AS TO FORM: WILLIAM H. IHRKE, City Attorney City of La Quinta, California 203 Exhibit A Page 1 of 5 Last revised summer 2017 Exhibit A Scope of Services 1. Services to be Provided: Tasks include, but are not limited to, the following: • Provide all necessary materials, equipment, and incidentals required to perform city wide on-call traffic signal repair. • Provide and maintain emergency service response to the City’s traffic signals, safety street lights, and flashing beacons on a twenty-four (24) hour a day, seven (7) days per week basis, including all holidays. • Provide vehicle(s) with permanently mounted arrow board; warning beacon/strobe lights; traffic cones; construction warning sign; a hydraulic bucket capable of reaching a height of at least twenty-eight feet from the roadway surface; necessary computer laptop for programming, maintenance, and testing of traffic signal controllers and various equipment; and communications equipment for dispatch. • Possess all required tools, equipment, apparatus, facilities, and materials needed to perform all work necessary to maintain and repair the traffic signals, safety street lights, and flashing beacons in the City in compliance with current City standards and specifications. 204 Exhibit A Page 2 of 5 ADDENDUM TO AGREEMENT Re: Scope of Services If the Scope of Services include construction, alteration, demolition, installation, repair, or maintenance affecting real property or structures or improvements of any kind appurtenant to real property, the following apply: 1. Prevailing Wage Compliance. If Contracting Party is a contractor performing public works and maintenance projects, as described in this Section 1.3, Contracting Party shall comply with applicable Federal, State, and local laws. Contracting Party is aware of the requirements of California Labor Code Sections 1720, et seq., and 1770, et seq., as well as California Code of Regulations, Title 8, Sections 16000, et seq., (collectively, the “Prevailing Wage Laws”), and La Quinta Municipal Code Section 3.12.040, which require the payment of prevailing wage rates and the performance of other requirements on “Public works” and “Maintenance” projects. If the Services are being performed as part of an applicable “Public works” or “Maintenance” project, as defined by the Prevailing Wage Laws, and if construction work over twenty-five thousand dollars ($25,000.00) and/or alterations, demolition, repair or maintenance work over fifteen thousand dollars ($15,000.00) is entered into or extended on or after January 1, 2015 by this Agreement, Contracting Party agrees to fully comply with such Prevailing Wage Laws including, but not limited to, requirements related to the maintenance of payroll records and the employment of apprentices. Pursuant to California Labor Code Section 1725.5, no contractor or subcontractor may be awarded a contract for public work on a “Public works” project unless registered with the California Department of Industrial Relations (“DIR”) at the time the contract is awarded. If the Services are being performed as part of an applicable “Public works” or “Maintenance” project, as defined by the 205 Exhibit A Page 3 of 5 Prevailing Wage Laws, this project is subject to compliance monitoring and enforcement by the DIR. Contracting Party will maintain and will require all subcontractors to maintain valid and current DIR Public Works contractor registration during the term of this Agreement. Contracting Party shall notify City in writing immediately, and in no case more than twenty-four (24) hours, after receiving any information that Contracting Party’s or any of its subcontractor’s DIR registration status has been suspended, revoked, expired, or otherwise changed. It is understood that it is the responsibility of Contracting Party to determine the correct salary scale. Contracting Party shall make copies of the prevailing rates of per diem wages for each craft, classification, or type of worker needed to execute the Services available to interested parties upon request, and shall post copies at Contracting Party’s principal place of business and at the project site, if any. The statutory penalties for failure to pay prevailing wage or to comply with State wage and hour laws will be enforced. Contracting Party must forfeit to City TWENTY- FIVE DOLLARS ($25.00) per day for each worker who works in excess of the minimum working hours when Contracting Party does not pay overtime. In accordance with the provisions of Labor Code Sections 1810 et seq., eight (8) hours is the legal working day. Contracting Party also shall comply with State law requirements to maintain payroll records and shall provide for certified records and inspection of records as required by California Labor Code Section 1770 et seq., including Section 1776. In addition to the other indemnities provided under this Agreement, Contracting Party shall defend (with counsel selected by City), indemnify, and hold City, its elected officials, officers, employees, and agents free and harmless from any claim or liability arising out of any failure or alleged failure to comply with the Prevailing Wage Laws. It is agreed by the parties that, in connection with performance of the Services, including, without limitation, any and all “Public works” (as defined by the Prevailing Wage Laws), Contracting Party shall bear all risks of payment or non-payment of prevailing wages under California law and/or the implementation of Labor Code Section 1781, as the same may be amended from time to time, and/or any other similar law. Contracting Party acknowledges and agrees that it shall be independently responsible for reviewing the applicable laws and regulations and effectuating compliance with such laws. Contracting Party shall require the same of all subcontractors. 2. Retention. Payments shall be made in accordance with the provisions of Article 2.0 of the Agreement. In accordance with said Sections, City shall pay Contracting Party a sum based upon ninety-five percent (95%) of the Contract Sum apportionment of the labor and materials incorporated into the Services under this Agreement during the month covered by said invoice. The remaining five percent (5%) thereof shall be retained as performance security to be paid to Contracting Party within sixty (60) days after final acceptance of the Services by the City Council of City, after 206 Exhibit A Page 4 of 5 Contracting Party has furnished City with a full release of all undisputed payments under this Agreement, if required by City. In the event there are any claims specifically excluded by Contracting Party from the operation of the release, City may retain proceeds (per Public Contract Code § 7107) of up to one hundred fifty percent (150%) of the amount in dispute. City’s failure to deduct or withhold shall not affect Contracting Party’s obligations under the Agreement. 3. Utility Relocation. City is responsible for removal, relocation, or protection of existing main or trunk-line utilities to the extent such utilities were not identified in the invitation for bids or specifications. City shall reimburse Contracting Party for any costs incurred in locating, repairing damage not caused by Contracting Party, and removing or relocating such unidentified utility facilities. Contracting Party shall not be assessed liquidated damages for delay arising from the removal or relocation of such unidentified utility facilities. 4. Trenches or Excavations. Pursuant to California Public Contract Code Section 7104, in the event the work included in this Agreement requires excavations more than four (4) feet in depth, the following shall apply: (a) Contracting Party shall promptly, and before the following conditions are disturbed, notify City, in writing, of any: (1) material that Contracting Party believes may be material that is hazardous waste, as defined in Section 25117 of the Health and Safety Code, that is required to be removed to a Class I, Class II, or Class III disposal site in accordance with provisions of existing law; (2) subsurface or latent physical conditions at the site different from those indicated by information about the site made available to bidders prior to the deadline for submitting bids; or (3) unknown physical conditions at the site of any unusual nature, different materially from those ordinarily encountered and generally recognized as inherent in work of the character provided for in the Agreement. (b) City shall promptly investigate the conditions, and if it finds that the conditions do materially so differ, or do involve hazardous waste, and cause a decrease or increase in Contracting Party’s cost of, or the time required for, performance of any part of the work shall issue a change order per Section 1.8 of the Agreement. (c) in the event that a dispute arises between City and Contracting Party whether the conditions materially differ, or involve hazardous waste, or cause a decrease or increase in Contracting Party’s cost of, or time required for, performance of any part of the work, Contracting Party shall not be excused from any scheduled completion date provided for by this Agreement, but shall proceed with all work to be performed under this 207 Exhibit A Page 5 of 5 Agreement. Contracting Party shall retain any and all rights provided either by contract or by law which pertain to the resolution of disputes and protests between the contracting Parties. 5. Safety. Contracting Party shall execute and maintain its work so as to avoid injury or damage to any person or property. In carrying out the Services, Contracting Party shall at all times be in compliance with all applicable local, state, and federal laws, rules and regulations, and shall exercise all necessary precautions for the safety of employees appropriate to the nature of the work and the conditions under which the work is to be performed. Safety precautions as applicable shall include, but shall not be limited to: (A) adequate life protection and lifesaving equipment and procedures; (B) instructions in accident prevention for all employees and subcontractors, such as safe walkways, scaffolds, fall protection ladders, bridges, gang planks, confined space procedures, trenching and shoring, equipment and other safety devices, equipment and wearing apparel as are necessary or lawfully required to prevent accidents or injuries; and (C) adequate facilities for the proper inspection and maintenance of all safety measures. 6. Liquidated Damages. Since the determination of actual damages for any delay in performance of the Agreement would be extremely difficult or impractical to determine in the event of a breach of this Agreement, Contracting Party shall be liable for and shall pay to City the sum of One Thousand dollars ($1,000.00) as liquidated damages for each working day of delay in the performance of any of the Services required hereunder, as specified in the Schedule of Performance. In addition, liquidated damages may be assessed for failure to comply with the emergency call out requirements, if any, described in the Scope of Services. City may withhold from any moneys payable on account of the Services performed by Contracting Party any accrued liquidated damages. 208 Exhibit B Page 1 of 2 Exhibit B Schedule of Compensation With the exception of compensation for Additional Services, provided for in Section 2.3 of this Agreement, the maximum total compensation to be paid to Contracting Party under this Agreement is not to exceed Seventy Five Thousand Dollars ($75,000.00) per year for the life of the Agreement, encompassing the initial and any extended terms (“Contract Sum”). The Contract Sum shall be paid to Contracting Party in payments made on a monthly basis and in an amount identified in Contracting Party’s schedule of compensation attached hereto for the work tasks performed and properly invoiced by Contracting Party in conformance with Section 2.2 of this Agreement. Initial Term: “Not to exceed” Year 1: $75,000.00 “Not to exceed” Year 2: $75,000.00 “Not to exceed” Year 3: $75,000.00 $225,000.000 Possible Extended Term: “Not to exceed” Year 4: $75,000.00 “Not to exceed” Year 5: $75,000.00 209 -CAIJFORNIA -··-· · CITY OF LA QUINTA, CA RFP FOR ON CALL TRAFFIC SIGNAL REPAIR SERVICES COST PROPOSAL SHEET The following is a summary of costs to provide the services outlined in the Request for Proposals for On Call Traffic Signal Repair Services and will be used as the basis for negotiating an Agreement for Contract Services: Technician Staff Hourly Rate Overtime Superintendent $ 95.00 $138.00 Maintenance Technician -Lead $ 95.00 $138.00 Maintenance Technician $ 88.00 $120.00 Service Laborer $ 78.00 $115.00 Premium $164.00 $164.00 $150.00 $145.00 Safety Light Technician $88.00 $120.00 $150.00 Equipment Service Bucket Truck Crane Truck Jack Hammer / Compressor Reimbursables All materials will be cost+ 15% Mark-Up See Above See Above See Above See Above See Above Hourly Rate $32.00 $ 68.00 $10.00 Cost per Unit $ ___ _ $ __ _ $ __ _ $ __ _ $ ___ _ $ __ _ The above represents a detailed hourly and cost per unit breakdown related to the tasks defined in our proposal. Pri��d== Exhibit B Page 2 of 2 210 Exhibit C Page 1 of 1 Exhibit C Schedule of Performance Contracting Party shall complete services identified in the Scope of Services, Exhibit A of this Agreement, as requested by City within the time allowed by the total contract sum. 211 Exhibit D Page 1 of 1 Exhibit D Special Requirements None 212 Exhibit E Page 1 of 6 Exhibit E Insurance Requirements E.1 Insurance. Prior to the beginning of and throughout the duration of this Agreement, the following policies shall be maintained and kept in full force and effect providing insurance with minimum limits as indicated below and issued by insurers with A.M. Best ratings of no less than A-VI: Commercial General Liability (at least as broad as ISO CG 0001) $5,000,000 (per occurrence) $5,000,000 (general aggregate) Must include the following endorsements: General Liability Additional Insured General Liability Primary and Non-contributory Commercial Auto Liability (at least as broad as ISO CA 0001) $1,000,000 (per accident) Personal Auto Declaration Page if applicable Errors and Omissions Liability $1,000,000 (per claim and aggregate) Workers’ Compensation (per statutory requirements) Must include the following endorsements: Workers Compensation with Waiver of Subrogation Workers Compensation Declaration of Sole Proprietor if applicable Contracting Party shall procure and maintain, at its cost, and submit concurrently with its execution of this Agreement, Commercial General Liability insurance against all claims for injuries against persons or damages to property resulting from Contracting Party’s acts or omissions rising out of or related to Contracting Party’s performance under this Agreement. The insurance policy shall contain a severability of interest clause providing that the coverage shall be primary for losses arising out of Contracting Party’s performance hereunder and neither City nor its insurers shall be required to contribute to any such loss. An endorsement evidencing the foregoing and naming the City and its officers and employees as additional insured (on the Commercial General Liability policy only) must be submitted concurrently with the execution of this Agreement and approved by City prior to commencement of the services hereunder. Contracting Party shall carry automobile liability insurance of $5,000,000 per accident against all claims for injuries against persons or 213 Exhibit E Page 2 of 6 damages to property arising out of the use of any automobile by Contracting Party, its officers, any person directly or indirectly employed by Contracting Party, any subcontractor or agent, or anyone for whose acts any of them may be liable, arising directly or indirectly out of or related to Contracting Party’s performance under this Agreement. If Contracting Party or Contracting Party’s employees will use personal autos in any way on this project, Contracting Party shall provide evidence of personal auto liability coverage for each such person. The term “automobile” includes, but is not limited to, a land motor vehicle, trailer or semi-trailer designed for travel on public roads. The automobile insurance policy shall contain a severability of interest clause providing that coverage shall be primary for losses arising out of Contracting Party’s performance hereunder and neither City nor its insurers shall be required to contribute to such loss. Professional Liability or Errors and Omissions Insurance as appropriate shall be written on a policy form coverage specifically designed to protect against acts, errors or omissions of the Contracting Party and “Covered Professional Services” as designated in the policy must specifically include work performed under this agreement. The policy limit shall be no less than $1,000,000 per claim and in the aggregate. The policy must “pay on behalf of” the insured and must include a provision establishing the insurer’s duty to defend. The policy retroactive date shall be on or before the effective date of this agreement. Contracting Party shall carry Workers’ Compensation Insurance in accordance with State Worker’s Compensation laws with employer’s liability limits no less than $1,000,000 per accident or disease. If coverage is maintained on a claims-made basis, Contracting Party shall maintain such coverage for an additional period of three (3) years following termination of the contract. Contracting Party shall provide written notice to City within ten (10) working days if: (1) any of the required insurance policies is terminated; (2) the limits of any of the required polices are reduced; or (3) the deductible or self-insured retention is increased. In the event any of said policies of insurance are cancelled, Contracting Party shall, prior to the cancellation date, submit new evidence of insurance in conformance with this Exhibit to the Contract Officer. The procuring of such insurance or the delivery of policies or certificates evidencing the same shall not be construed as a limitation of Contracting Party’s obligation to indemnify City, its officers, employees, contractors, subcontractors, or agents. E.2 Remedies. In addition to any other remedies City may have if Contracting Party fails to provide or maintain any insurance policies or policy 214 Exhibit E Page 3 of 6 endorsements to the extent and within the time herein required, City may, at its sole option: a. Obtain such insurance and deduct and retain the amount of the premiums for such insurance from any sums due under this Agreement. b. Order Contracting Party to stop work under this Agreement and/or withhold any payment(s) which become due to Contracting Party hereunder until Contracting Party demonstrates compliance with the requirements hereof. c. Terminate this Agreement. Exercise of any of the above remedies, however, is an alternative to any other remedies City may have. The above remedies are not the exclusive remedies for Contracting Party’s failure to maintain or secure appropriate policies or endorsements. Nothing herein contained shall be construed as limiting in any way the extent to which Contracting Party may be held responsible for payments of damages to persons or property resulting from Contracting Party’s or its subcontractors’ performance of work under this Agreement. E.3 General Conditions Pertaining to Provisions of Insurance Coverage by Contracting Party. Contracting Party and City agree to the following with respect to insurance provided by Contracting Party: 1. Contracting Party agrees to have its insurer endorse the third party general liability coverage required herein to include as additional insureds City, its officials, employees, and agents, using standard ISO endorsement No. CG 2010 with an edition prior to 1992. Contracting Party also agrees to require all contractors, and subcontractors to do likewise. 2. No liability insurance coverage provided to comply with this Agreement shall prohibit Contracting Party, or Contracting Party’s employees, or agents, from waiving the right of subrogation prior to a loss. Contracting Party agrees to waive subrogation rights against City regardless of the applicability of any insurance proceeds, and to require all contractors and subcontractors to do likewise. 3. All insurance coverage and limits provided by Contracting Party and available or applicable to this Agreement are intended to apply to the full extent of the policies. Nothing contained in this Agreement or any other agreement relating to City or its operations limits the application of such insurance coverage. 215 Exhibit E Page 4 of 6 4. None of the coverages required herein will be in compliance with these requirements if they include any limiting endorsement of any kind that has not been first submitted to City and approved of in writing. 5. No liability policy shall contain any provision or definition that would serve to eliminate so-called “third party action over” claims, including any exclusion for bodily injury to an employee of the insured or of any contractor or subcontractor. 6. All coverage types and limits required are subject to approval, modification and additional requirements by the City, as the need arises. Contracting Party shall not make any reductions in scope of coverage (e.g. elimination of contractual liability or reduction of discovery period) that may affect City’s protection without City’s prior written consent. 7. Proof of compliance with these insurance requirements, consisting of certificates of insurance evidencing all the coverages required and an additional insured endorsement to Contracting Party’s general liability policy, shall be delivered to City at or prior to the execution of this Agreement. In the event such proof of any insurance is not delivered as required, or in the event such insurance is canceled at any time and no replacement coverage is provided, City has the right, but not the duty, to obtain any insurance it deems necessary to protect its interests under this or any other agreement and to pay the premium. Any premium so paid by City shall be charged to and promptly paid by Contracting Party or deducted from sums due Contracting Party, at City option. 8. It is acknowledged by the parties of this agreement that all insurance coverage required to be provided by Contracting Party or any subcontractor, is intended to apply first and on a primary, non-contributing basis in relation to any other insurance or self-insurance available to City. 9. Contracting Party agrees to ensure that subcontractors, and any other party involved with the project that is brought onto or involved in the project by Contracting Party, provide the same minimum insurance coverage required of Contracting Party. Contracting Party agrees to monitor and review all such coverage and assumes all responsibility for ensuring that such coverage is provided in conformity with the requirements of this section. Contracting Party agrees that upon request, all agreements with subcontractors and others engaged in the project will be submitted to City for review. 10. Contracting Party agrees not to self-insure or to use any self- insured retentions or deductibles on any portion of the insurance required herein (with the exception of professional liability coverage, if required) and 216 Exhibit E Page 5 of 6 further agrees that it will not allow any contractor, subcontractor, Architect, Engineer or other entity or person in any way involved in the performance of work on the project contemplated by this agreement to self-insure its obligations to City. If Contracting Party’s existing coverage includes a deductible or self-insured retention, the deductible or self-insured retention must be declared to the City. At that time the City shall review options with the Contracting Party, which may include reduction or elimination of the deductible or self-insured retention, substitution of other coverage, or other solutions. 11. The City reserves the right at any time during the term of this Agreement to change the amounts and types of insurance required by giving the Contracting Party ninety (90) days advance written notice of such change. If such change results in substantial additional cost to the Contracting Party, the City will negotiate additional compensation proportional to the increased benefit to City. 12. For purposes of applying insurance coverage only, this Agreement will be deemed to have been executed immediately upon any party hereto taking any steps that can be deemed to be in furtherance of or towards performance of this Agreement. 13. Contracting Party acknowledges and agrees that any actual or alleged failure on the part of City to inform Contracting Party of non- compliance with any insurance requirement in no way imposes any additional obligations on City nor does it waive any rights hereunder in this or any other regard. 14. Contracting Party will renew the required coverage annually as long as City, or its employees or agents face an exposure from operations of any type pursuant to this agreement. This obligation applies whether the agreement is canceled or terminated for any reason. Termination of this obligation is not effective until City executes a written statement to that effect. 15. Contracting Party shall provide proof that policies of insurance required herein expiring during the term of this Agreement have been renewed or replaced with other policies providing at least the same coverage. Proof that such coverage has been ordered shall be submitted prior to expiration. A coverage binder or letter from Contracting Party’s insurance agent to this effect is acceptable. A certificate of insurance and an additional insured endorsement is required in these specifications applicable to the renewing or new coverage must be provided to City within five (5) days of the expiration of coverages. 217 Exhibit E Page 6 of 6 16. The provisions of any workers’ compensation or similar act will not limit the obligations of Contracting Party under this agreement. Contracting Party expressly agrees not to use any statutory immunity defenses under such laws with respect to City, its employees, officials, and agents. 17. Requirements of specific coverage features, or limits contained in this section are not intended as limitations on coverage, limits or other requirements nor as a waiver of any coverage normally provided by any given policy. Specific reference to a given coverage feature is for purposes of clarification only as it pertains to a given issue and is not intended by any party or insured to be limiting or all-inclusive. 18. These insurance requirements are intended to be separate and distinct from any other provision in this Agreement and are intended by the parties here to be interpreted as such. 19. The requirements in this Exhibit supersede all other sections and provisions of this Agreement to the extent that any other section or provision conflicts with or impairs the provisions of this Exhibit. 20. Contracting Party agrees to be responsible for ensuring that no contract used by any party involved in any way with the project reserves the right to charge City or Contracting Party for the cost of additional insurance coverage required by this agreement. Any such provisions are to be deleted with reference to City. It is not the intent of City to reimburse any third party for the cost of complying with these requirements. There shall be no recourse against City for payment of premiums or other amounts with respect thereto. 21. Contracting Party agrees to provide immediate notice to City of any claim or loss against Contracting Party arising out of the work performed under this agreement. City assumes no obligation or liability by such notice, but has the right (but not the duty) to monitor the handling of any such claim or claims if they are likely to involve City. 218 Exhibit F Page 1 of 3 Exhibit F Indemnification F.1 Indemnity for the Benefit of City. a. Indemnification for Professional Liability. When the law establishes a professional standard of care for Contracting Party’s Services, to the fullest extent permitted by law, Contracting Party shall indemnify, protect, defend (with counsel selected by City), and hold harmless City and any and all of its officials, employees, and agents (“Indemnified Parties”) from and against any and all claims, losses, liabilities of every kind, nature, and description, damages, injury (including, without limitation, injury to or death of an employee of Contracting Party or of any subcontractor), costs and expenses of any kind, whether actual, alleged or threatened, including, without limitation, incidental and consequential damages, court costs, attorneys’ fees, litigation expenses, and fees of expert consultants or expert witnesses incurred in connection therewith and costs of investigation, to the extent same are caused in whole or in part by any negligent or wrongful act, error or omission of Contracting Party, its officers, agents, employees or subcontractors (or any entity or individual that Contracting Party shall bear the legal liability thereof) in the performance of professional services under this agreement. With respect to the design of public improvements, the Contracting Party shall not be liable for any injuries or property damage resulting from the reuse of the design at a location other than that specified in Exhibit A without the written consent of the Contracting Party. b. Indemnification for Other Than Professional Liability. Other than in the performance of professional services and to the full extent permitted by law, Contracting Party shall indemnify, defend (with counsel selected by City), and hold harmless the Indemnified Parties from and against any liability (including liability for claims, suits, actions, arbitration proceedings, administrative proceedings, regulatory proceedings, losses, expenses or costs of any kind, whether actual, alleged or threatened, including, without limitation, incidental and consequential damages, court costs, attorneys’ fees, litigation expenses, and fees of expert consultants or expert witnesses) incurred in connection therewith and costs of investigation, where the same arise out of, are a consequence of, or are in any way attributable to, in whole or in part, the performance of this Agreement by Contracting Party or by any individual or entity for which Contracting Party is legally liable, including but not limited to officers, agents, employees, or subcontractors of Contracting Party. c. Indemnity Provisions for Contracts Related to Construction (Limitation on Indemnity). Without affecting the rights of City under any 219 Exhibit F Page 2 of 3 provision of this agreement, Contracting Party shall not be required to indemnify and hold harmless City for liability attributable to the active negligence of City, provided such active negligence is determined by agreement between the parties or by the findings of a court of competent jurisdiction. In instances where City is shown to have been actively negligent and where City’s active negligence accounts for only a percentage of the liability involved, the obligation of Contracting Party will be for that entire portion or percentage of liability not attributable to the active negligence of City. d. Indemnification Provision for Design Professionals. 1. Applicability of this Section F.1(d). Notwithstanding Section F.1(a) hereinabove, the following indemnification provision shall apply to a Contracting Party who constitutes a “design professional” as the term is defined in paragraph 3 below. 2. Scope of Indemnification. When the law establishes a professional standard of care for Contracting Party’s Services, to the fullest extent permitted by law, Contracting Party shall indemnify and hold harmless City and any and all of its officials, employees, and agents (“Indemnified Parties”) from and against any and all losses, liabilities of every kind, nature, and description, damages, injury (including, without limitation, injury to or death of an employee of Contracting Party or of any subcontractor), costs and expenses, including, without limitation, incidental and consequential damages, court costs, reimbursement of attorneys’ fees, litigation expenses, and fees of expert consultants or expert witnesses incurred in connection therewith and costs of investigation, to the extent same are caused by any negligent or wrongful act, error or omission of Contracting Party, its officers, agents, employees or subcontractors (or any entity or individual that Contracting Party shall bear the legal liability thereof) in the performance of professional services under this agreement. With respect to the design of public improvements, the Contracting Party shall not be liable for any injuries or property damage resulting from the reuse of the design at a location other than that specified in Exhibit A without the written consent of the Contracting Party. 3. Design Professional Defined. As used in this Section F.1(d), the term “design professional” shall be limited to licensed architects, registered professional engineers, licensed professional land surveyors and landscape architects, all as defined under current law, and as may be amended from time to time by Civil Code § 2782.8. F.2 Obligation to Secure Indemnification Provisions. Contracting Party agrees to obtain executed indemnity agreements with provisions 220 Exhibit F Page 3 of 3 identical to those set forth herein this Exhibit F, as applicable to the Contracting Party, from each and every subcontractor or any other person or entity involved by, for, with or on behalf of Contracting Party in the performance of this Agreement. In the event Contracting Party fails to obtain such indemnity obligations from others as required herein, Contracting Party agrees to be fully responsible according to the terms of this Exhibit. Failure of City to monitor compliance with these requirements imposes no additional obligations on City and will in no way act as a waiver of any rights hereunder. This obligation to indemnify and defend City as set forth in this Agreement are binding on the successors, assigns or heirs of Contracting Party and shall survive the termination of this Agreement. 221 222 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: APPROVE DEMAND REGISTERS DATED AUGUST 2, 9, 16, 23, AND 30, 2019 RECOMMENDATION Approve demand registers dated August 2, 9, 16, 23, and 30, 2019. EXECUTIVE SUMMARY – None FISCAL IMPACT Demand of Cash: City 13,791,125.64$ Successor Agency of RDA 13,119,161.93$ Housing Authority 21,406.95$ 26,931,694.52$ BACKGROUND/ANALYSIS Routine bills and payroll must be paid between Council meetings. Attachment 1 details the weekly demand registers for August 2, 9, 16, 23, and 30, 2019. Warrants Issued: 123292-123455 2,101,590.12$ 123456-123458 799.36$ 123459-123597 773,450.89$ 123598-123653 542,448.45$ 123654-123766 546,806.85$ Wire Transfers 22,412,712.76$ AP Voids (5,382.91)$ Payroll Tax Transfers 103,268.10$ Payroll Direct Dep & Chks #37437-37446 456,000.90$ 26,931,694.52$ In the amounts listed above, ten checks were voided. Three checks were voided and reissued due to non receipt by vendors. One check was voided and reissued due to incorrect vendor. Six checks were voided due to stale date. CONSENT CALENDAR ITEM NO. 14 223 The most significant expenditures on the demand register are: Account Name Amount Ri verside County Sheriff 1,612,049.51$ May - June 2019 Police Sheriff Dept Services, 19/20 Member Assessment Jacobsson Construction 256,665.78$ July 2019 Dune Palms Engineering Road Widening East of Madison,Developer 155,250.00$ Raised Median and LLC Reimbursements Street Improvements Econolite Control D&D Software 120,995.00$ July 2019 Centracs Products, Inc ATMS Software ND La Quinta Developer 107,197.00$ Raised Landscape Median Partners, LLC Reimbursements and Street Improvements PurposeVendor Investment Transactions: Full details of investment transactions as well as total holdings are reported quarterly in the Treasurer’s Report. Trans Issuer Type Par Value Settle Date Coupon Rate Call Federal Home Loan Mort Corp Agency 1,000,000$ 7/30/19 2.550% Purchase Lakeside Bank CD 248,000$ 7/30/19 2.000% Purchase First Security Bank of WA CD 248,000$ 7/30/19 2.000% Purchase Infinity Federal Credit Union CD 248,000$ 7/31/19 2.100% Purchase Peoples Bank CD 248,000$ 7/31/19 2.000% Maturity Federal National Mort Assoc Agency 500,000$ 8/2/19 0.875% Purchase Federal Farm Credit Bank Agency 500,000$ 8/2/19 1.850% Purchase Preferred Bank CD 249,000$ 8/16/19 2.000% Purchase United Credit Union CD 248,000$ 8/22/19 2.000% Purchase Washington Federal CD 248,000$ 8/23/19 2.000% Purchase First Tier Bank CD 249,000$ 8/23/19 1.950% Purchase Celtic Bank CD 248,000$ 8/30/19 1.850% Call Federal Home Loan Mort Corp Agency 750,000$ 8/23/19 2.750% Purchase US Treasury Treasury 500,000$ 8/21/19 1.375% Purchase Raymond James Bank CD 244,000$ 8/23/19 1.950% Purchase CIT Bank CD 245,000$ 8/23/19 1.900% Purchase First State Bank of DeQueen CD 248,000$ 8/30/19 1.800% Purchase First National Bank of Syracuse CD 249,000$ 8/30/19 1.850% 224 Wire Transfers: Twenty-six transfers totaled $22,412,713. Of this amount, $13,118,685 was for US Bank (Debt Service), $6,540,000 for PARS (Pension Trust), $1,979,986 for Stifel (Investments), $367,814 for Landmark, and $238,240 for PERS. (See Attachment 2 for a full listing). ALTERNATIVES Council may approve, partially approve, or reject the demand registers. Prepared by: Bernice Choo, Account Technician Approved by: Rosemary Hallick, Financial Services Analyst Attachments:1. Demand Registers 2. Wire Transfers 225 8/2/2019 6:44:19 PM Page 1 of 9 Demand Register City of La Quinta Packet: APPKT02083 - BC 08/02/19 AmountVendor Name Payable Number Description (Item)Account Name Account Number Fund: 101 - GENERAL FUND 500.00Administrative Citations06/28/19 - LQ162079 REFUND CITATION D…062819GRANT, GLENN 101-0000-42700 2,418.75Training & Education/MOU06/28/19 - TUITION REIMB GL BUS SPREA…062819CHAUDHRY, ELIZABETH 101-1004-60322 806.25Training & Education/MOU06/28/19 - TUITION REIMB BUS STRATEGY062819ACHAUDHRY, ELIZABETH 101-1004-60322 295.40Instructors07/25/19-FRIDAY NIGHT DANCE/BALLRO…072519SHIRY, TERESA 101-3002-60107 40.00Instructors07/25/19 - PERSONAL TRAINER072519ROSE-FARKAS, LORETTA ANN 101-3002-60107 77.00Instructors07/25/19 - CARDIO & SUN STYLE TAI CHI072519COHEN, ANN MARIE 101-3002-60107 33.60Instructors07/25/19 - TAI CHI CHUAN072519MEDEIROS, JOYCELEEN 101-3002-60107 120.00Membership Dues09/2019 - MEMBERSHIP RENEWAL073119COSTCO WHOLESALE MEMBE…101-1007-60351 657.50Employee Recognition Events08/01/19 - EMPLOYEE RECOG DINNER DE…080119LA QUINTA RESORT & CLUB 101-1004-60340 3,100.00Travel & Training09/10-09/13/19 - TTC TRAINING ROMANE…080119MAUREEN KANE & ASSOCIATE…101-1005-60320 363.26Travel & Training07/21-07/26/19 - TRAVEL REIMB FEMA080119JOHNSTON, ALEXANDER 101-2002-60320 417.00Administrative Citation Services06/2019 - CODE CITATION PROCESSING102863DATA TICKET, INC.101-6004-60111 1,274.50Maintenance/Services06/20/19 - WC MAINT SVCS115193DOOR TECH, LLC 101-3008-60691 11,000.98Fritz Burns Pool06/15-06/30/19 FRITZ BURNS POOL OPER…127DESERT RECREATION DISTRICT 101-3005-60184 242.41Operating Supplies07/10/19-DRINKING WATER12852924071219SPARKLETTS 101-7003-60420 203.73Operating Supplies07/04-07/18/19 - WC JANITORIAL SUPPLIES1402148184AMERIPRIDE SERVICES INC 101-3002-60420 60.49Printing07/08/19 - FIN STAFF 3 FAC NAMES PLATES144297POWERS AWARDS INC 101-1006-60410 125.01Special Enforcement/Humana07/19/19 - COP GOLF CART COVER1461GOLF CARS OF THE DESERT 101-2001-60165 3,952.00Marketing & Tourism Promoti…03/2020 ALASKA AIRLINES BEYOND MAGA…149326PARADIGM COMMUNICATION…101-3007-60461 3,952.00Marketing & Tourism Promoti…10/2019 ALASKA AIRLINES BEYOND MAGA…149327PARADIGM COMMUNICATION…101-3007-60461 182.88Materials/Supplies07/15/19-GRANITE150256SOUTHWEST BOULDER & STO…101-3005-60431 1,560.00Marketing & Tourism Promoti…08/2019 LOCAL PRINT PUBLICATION1509TRAVELHOST PALM SPRINGS 101-3007-60461 2,640.00Materials/Supplies07/17/19-RESTOCKING FEE FOR PIONEER …1600SOUTH VALLEY ELECTRIC 101-3005-60431 4,000.00Marketing & Tourism Promoti…07/2019 GRAPHIC DESIGN1669ARK CONNECTS LLC 101-3007-60461 29,839.00Professional ServicesMAY 2019 HWY 111 AREA PLANNING1804RANGWALA ASSOCIATES 101-6002-60103 27,752.00Professional ServicesJUNE 2019 HWY 111 AREA PLANNING1805RANGWALA ASSOCIATES 101-6002-60103 80.88Postage07/19/19 - OVERNIGHT MAIL1-837-57235FEDEX 101-1007-60470 137.48PM 10 - Dust Control07/08-08/04/19 - PM10 ANSWERING SERV…190702190101ANSAFONE CONTACT CENTERS 101-7006-60146 170.91Printing07/24/19-SRR FAQ CARDS19-32629XPRESS GRAPHICS 101-3007-60410 400.78Operating Supplies07/26/19 - DOOR HANGERS/FORMS BLDG …19-32655XPRESS GRAPHICS 101-6003-60420 10,200.00Marketing & Tourism Promoti…10/2019 12/2019 02/2020-03/2020 REGI…19882SAN DIEGO MAGAZINE LLC 101-3007-60461 41.05Operating Supplies07/23/19 - STAMPS HUB & BLDG DEPTS19-99931RIVERSIDE RUBBER STAMP & …101-6003-60420 168.96Operating Supplies07/23/19 - STAMPS HUB & BLDG DEPTS19-99931RIVERSIDE RUBBER STAMP & …101-7002-60420 13,600.00Marketing & Tourism Promoti…11/2019 01/2020-04/2020 REGIONAL PRI…2019CI-2657PORTLAND MONTHLY 101-3007-60461 13,600.00Marketing & Tourism Promoti…10/2019 12/2019 01/2020-03/2020 REGI…2019CI-3170SEATTLE MET 101-3007-60461 80.09Cable - Utilities07/17/19 - FS #32 CABLE (8152)218152071719TIME WARNER CABLE 101-2002-61400 -19.90Sales Taxes Payable07/15/19 - WC GYM WIPES SALES TAX2541482XL CORPORATION 101-0000-20304 328.84Operating Supplies07/15/19 - WC GYM WIPES2541482XL CORPORATION 101-3002-60420 69.98Materials/Supplies07/03/19-MITCHELL PAIGE3023-7THE SHERWIN-WILLIAMS CO.101-3008-60431 41.69Cable - Utilities07/16-08/15/19 - FS #70 CABLE (1860)31860071719TIME WARNER CABLE 101-2002-61400 275.00Maintenance/Services07/23/19-FB POOL MAINLINE BACK UP330982423ROTO ROOTER PLUMBERS INC 101-3008-60691 96.96Office Supplies07/09/19-OFFICE SUPPLIES339090215001OFFICE DEPOT 101-1005-60400 24.69Office Supplies07/09/19-OFFICE SUPPLIES339091058001OFFICE DEPOT 101-1005-60400 9.02Office Supplies07/09/19-OFFICE SUPPLIES339189405001OFFICE DEPOT 101-1005-60400 7.60Office Supplies07/10/19-OFFICE SUPPLIES340198190001OFFICE DEPOT 101-1006-60400 3.90Office Supplies07/10/19-OFFICE SUPPLIES340198279001OFFICE DEPOT 101-1006-60400 346.59Forms, Copier Paper07/11/19-CITYWIDE COPY PAPER340940753001OFFICE DEPOT 101-1007-60402 45.66Office Supplies05/16/19 - CODE FLASH DRIVES3414054259STAPLES ADVANTAGE 101-6004-60400 17.72Operating Supplies07/03/19-OFFICE SUPPLIES3419172078STAPLES ADVANTAGE 101-3002-60420 181.57Citywide Conf Room Supplies07/13/19 - CITY WIDE SUPPLIES COFFEE3419370492STAPLES ADVANTAGE 101-1007-60403 3.80Operating Supplies07/09/19-OFFICE SUPPLIES3419633555STAPLES ADVANTAGE 101-6001-60420 238.11Office Supplies07/16/19-OFFICE SUPPLIES3419633556STAPLES ADVANTAGE 101-1004-60400 25.98Office Supplies07/16/19-OFFICE SUPPLIES3419703197STAPLES ADVANTAGE 101-1004-60400 Attachment 1 226 Demand Register Packet: APPKT02083 - BC 08/02/19 8/2/2019 6:44:19 PM Page 2 of 9 AmountVendor Name Payable Number Description (Item)Account Name Account Number 45.00Operating Supplies07/20/19 - B2 SCHOOL PROGRAM3419909738STAPLES ADVANTAGE 101-3002-60420 5.43Operating Supplies07/20/19 - B2 SCHOOL PROGRAM3419909739STAPLES ADVANTAGE 101-3002-60420 16.30Office Supplies07/16/19-OFFICE SUPPLIES3420061424STAPLES ADVANTAGE 101-1004-60400 171.34Office Supplies07/22/19-OFFICE SUPPLIES3420061425STAPLES ADVANTAGE 101-1004-60400 52.19Office Supplies07/27/19 - KEYBOARD S LAUREANO3420458183STAPLES ADVANTAGE 101-1006-60400 95.88Office Supplies07/16/19 - FIRE FOLDERS342690119001OFFICE DEPOT 101-2002-60400 49.04Office Supplies07/17/19 - W/C FOLDERS343258933001OFFICE DEPOT 101-1004-60400 245.82Operating Supplies07/16/19-OPERATING SUPPLIES343333737001OFFICE DEPOT 101-1005-60420 -49.04Office Supplies07/22/19 - W/C FOLDERS RETURN343983860001OFFICE DEPOT 101-1004-60400 32.68Office Supplies07/18/19-OFFICE SUPPLIES344509050001OFFICE DEPOT 101-1005-60400 135.97Materials/Supplies07/12/19-LQ PARK MATERIALS3466244SMITH PIPE & SUPPLY CO 101-3008-60431 34.79Office Supplies07/26/19 - AP FILE LABELS348999446001OFFICE DEPOT 101-1006-60400 39.99Office Supplies07/26/19 - OFFICE SUPPLIES348999573001OFFICE DEPOT 101-1006-60400 120.30Operating Supplies07/24/19 - OPER SUPP LUNCHEON 7/253583410059695SMART & FINAL 101-3002-60420 394.00Blood/Alcohol Testing06/14-06/28/19 - BLOOD ALCOHOL TESTI…38331BIO-TOX LABORATORIES 101-2001-60174 7,137.74Building Improvements05/20/19 - FS #70 CABINETS INSTALLED4430-2ABSOLUTE CABINETS, INC 101-2002-72110 1,583.00Building Improvements05/20/19 - FS #70 CABINET INSTALL FINAL…4432ABSOLUTE CABINETS, INC 101-2002-72110 11,091.38Janitorial07/2019 JANITORIAL SERVICES CH WC PA…534976MERCHANTS BUILDING MAINT…101-3008-60115 899.21Temporary Agency Services06/14/19 - CODE TEMP SVCS C HARGENS53691393OFFICE TEAM 101-6004-60125 1,173.63Temporary Agency Services07/12/19 - HUB TEMP SVCS M GONZALEZ53877919ROBERT HALF TECHNOLOGY 101-6006-60125 416.85Temporary Agency Services07/19/19-CODE TEMP SVC53894937OFFICE TEAM 101-6004-60125 1,174.03Temporary Agency Services07/19/19-HUB TEMP SVC53911285ROBERT HALF TECHNOLOGY 101-6006-60125 1,193.87Temporary Agency Services07/26/19 - HUB TEMP SVCS M GONZALEZ53939465ROBERT HALF TECHNOLOGY 101-6006-60125 900.00Tree Maintenance07/09/19 - FB PARK PALM TREE REMOVAL5458KIRKPATRICK LANDSCAPING S…101-3005-60557 92.17Citywide Conf Room Supplies07/31/19 - CITY WIDE COFFEE654115DAIOHS FIRST CHOICE SERVICES 101-1007-60403 100.00Pest Control07/08/19-SPORTS COMPLEX PEST CONTR…660209610TRULY NOLEN INC 101-3008-60116 78.00Pest Control07/05/19-CITY HALL PEST CONTROL660209824TRULY NOLEN INC 101-3008-60116 47.00Pest Control07/05/19-CITY YARD PEST CONTROL660209896TRULY NOLEN INC 101-3008-60116 38.87Marketing & Tourism Promoti…07/29/19 - EMPLOYEE NAME BADGES711CLQNB9-FAPALMS TO PINES PRINTING 101-3007-60461 280.00Blood/Alcohol Testing06/30/19 - BLOOD/ALCOHOL ANALYSIS72317AMERICAN FORENSIC NURSES …101-2001-60174 125.00Maintenance/Services04/26/19 - FS #93 RE CODE REMOTES72777PATTON DOOR & GATE 101-2002-60691 2,100.00Professional Services06/2019 SVCS FOR STVR PROGRAM752VACATION RENTAL COMPLIAN…101-6004-60103 900.00Professional Services06/2019 - EXTRA HOURS COMPLIANCE SV…753VACATION RENTAL COMPLIAN…101-6004-60103 660.00Security & Alarm07/01-09/30/19 BURG FACILITIES ALARM…77348ALARM MONITORING SERVICE…101-3008-60123 95.00Maintenance/Services07/25/19 - FS #32 AFTER HRS SVC77976ALARM MONITORING SERVICE…101-2002-60691 299.00Travel & Training07/22/19- STAR12 ALL ACCESS M.MENDO…8063262SKILL PATH SEMINARS 101-6006-60320 262.26Postage07/2019 Overnight mail8955750ONTRAC 101-1007-60470 3,552.76Materials/Supplies06/17/19 - WC REFRIGERATOR9207621872GRAINGER 101-3008-60431 80.19Materials/Supplies06/19/19 - LQ PARK TISSUE DISPENSER (2)9210293479GRAINGER 101-3008-60431 91.38Materials/Supplies07/26/19 - SPORTS COMPLEX SIGN9245127122GRAINGER 101-3008-60431 44.92Telephone - Utilities06/11-07/10/19 - LQ TICKET WRITERS (59…9833822554VERIZON WIRELESS 101-2001-61300 17.82Mobile/Cell Phones/Satellites06/14-07/13/19 - EOC CELL PHONES (7813)9834086878VERIZON WIRELESS 101-2002-61304 13,722.43Animal Shelter Contract Service06/2019 - ANIMAL SERVICESAN0000001710DEPARTMENT OF ANIMAL SER…101-6004-60197 79.81Cable - Utilities07/22-08/21/19 - EOC CABLEAUG'195631DISH NETWORK 101-2002-61400 29,824.42VehiclesLQPD MOTORCYCLE PROCUREMENTC18794BMW MOTORCYCLES OF RIVE…101-2001-71031 1,361.09Electricity - Utilities07/25/19 - ELECTRICITY SERVICECSE160IMPERIAL IRRIGATION DIST 101-2002-61101 13.38Electric - Velasco Park - Utilities07/25/19 - ELECTRICITY SERVICECSE160IMPERIAL IRRIGATION DIST 101-3005-61111 21.55Electric - Eisenhower Park - Util…07/25/19 - ELECTRICITY SERVICECSE160IMPERIAL IRRIGATION DIST 101-3005-61113 12.34Electric - Monticello Park - Utili…07/29/19 - ELECTRICITY SERVICECSE161IMPERIAL IRRIGATION DIST 101-3005-61102 35.36Electric - Colonel Paige - Utiliti…07/29/19 - ELECTRICITY SERVICECSE161IMPERIAL IRRIGATION DIST 101-3005-61108 1,612.79Electric - Community Park - Util…07/29/19 - ELECTRICITY SERVICECSE161IMPERIAL IRRIGATION DIST 101-3005-61109 35.36Electric - Adams Park - Utilities07/29/19 - ELECTRICITY SERVICECSE161IMPERIAL IRRIGATION DIST 101-3005-61110 13.26Electric - Desert Pride - Utilities07/29/19 - ELECTRICITY SERVICECSE161IMPERIAL IRRIGATION DIST 101-3005-61114 4,038.84Water - Civic Center Park - Utili…07/25/19 - WATER SERVICECSW218COACHELLA VALLEY WATER DI…101-3005-61202 7,482.16Water -Community Park - Utilit…07/25/19 - WATER SERVICECSW218COACHELLA VALLEY WATER DI…101-3005-61209 1,043.00HVAC04/26/19 - WC HVAC SVCI30536PACIFIC WEST AIR CONDITION…101-3008-60667 857.00HVAC06/25/19 - CITY HALL HVAC SVCI30962PACIFIC WEST AIR CONDITION…101-3008-60667 4,520.00HVAC07/05/19 - CITY HALL TRANE CHILLERI31021PACIFIC WEST AIR CONDITION…101-3008-60667 787.96Operating Supplies06/2019 - RADIO MAINTIT0000003144RIVERSIDE COUNTY INFORMAT…101-2001-60420 5,597.00Special Enforcement Funds05/27/19 INDIAN WELLS REGIONAL POLIC…IW1MATRIX CONSULTING GROUP 101-2001-60175 227 Demand Register Packet: APPKT02083 - BC 08/02/19 8/2/2019 6:44:19 PM Page 3 of 9 AmountVendor Name Payable Number Description (Item)Account Name Account Number 3,237.25Postage07/2019 FY19/20 CITYWIDE POSTAGE MA…JUL'193107NEOFUNDS BY NEOPOST 101-1007-60470 798.00Pest Control08/2019-07/2020 - FS #32 ANNUAL PEST …JUL'1966002301TRULY NOLEN INC 101-2002-60116 763.80Pest Control07/2019-06/2020 - FS #70 ANNUAL PEST …JUL'1966005726TRULY NOLEN INC 101-2002-60116 706.80Pest Control07/2019-06/2020 - FS #93 ANNUAL PEST …JUL'1966005728TRULY NOLEN INC 101-2002-60116 -7.00Sales Taxes Payable07/03-07/23/19 CADET FLAG SALES TAXJULY'197143AWELLS FARGO BUSINESS CARD 101-0000-20304 165.18Professional Services07/03-07/23/19 GALLUP WORK BOOKSJULY'197143AWELLS FARGO BUSINESS CARD 101-1004-60103 84.62Recruiting/Pre-Employment07/03-07/23/19 SR REC. LEADER PANEL L…JULY'197143AWELLS FARGO BUSINESS CARD 101-1004-60129 449.00Travel & Training07/03-07/23/19 CALPERS EDU FORUM S. …JULY'197143AWELLS FARGO BUSINESS CARD 101-1006-60320 449.00Travel & Training07/03-07/23/19 CALPERS EDU. FORUM C…JULY'197143AWELLS FARGO BUSINESS CARD 101-1006-60320 225.00Travel & Training07/03-07/23/19 UCR TRAINING C MARTIN…JULY'197143AWELLS FARGO BUSINESS CARD 101-1006-60320 96.95LQ Police Volunteers07/03-07/23/19 CADET FLAGJULY'197143AWELLS FARGO BUSINESS CARD 101-2001-60109 515.07LQ Police Volunteers07/03-07/23/19 CADET ACADEMY SUPPLI…JULY'197143AWELLS FARGO BUSINESS CARD 101-2001-60109 45.78LQ Police Volunteers07/03-07/23/19 CADET ACADEMY SUPPLI…JULY'197143AWELLS FARGO BUSINESS CARD 101-2001-60109 1,800.00Special Enforcement Funds07/03-07/23/19 LQPD TRAFFIC TRAININGJULY'197143AWELLS FARGO BUSINESS CARD 101-2001-60175 312.41Operating Supplies07/03-07/23/19 10 DOMAIN NAMESJULY'197143AWELLS FARGO BUSINESS CARD 101-3001-60420 855.33Operating Supplies07/03-07/23/19 WC FITNESS MEMBERSHI…JULY'197143AWELLS FARGO BUSINESS CARD 101-3002-60420 75.00Membership Dues07/2019 MAILCHIMPJULY'197143AWELLS FARGO BUSINESS CARD 101-3007-60351 -2.99Marketing & Tourism Promoti…07/03-07/23/19 APPLE ITUNES CREDITJULY'197143AWELLS FARGO BUSINESS CARD 101-3007-60461 1,398.00Marketing & Tourism Promoti…07/03-07/23/19 ALT SUMMITJULY'197143AWELLS FARGO BUSINESS CARD 101-3007-60461 -4.99Marketing & Tourism Promoti…07/03-07/23/19 APPLE ITUNES CREDITJULY'197143AWELLS FARGO BUSINESS CARD 101-3007-60461 -2.99Marketing & Tourism Promoti…07/03-07/23/19 APPLE ITUNES CREDITJULY'197143AWELLS FARGO BUSINESS CARD 101-3007-60461 -3.99Marketing & Tourism Promoti…07/03-07/23/19 APPLE ITUNES CREDITJULY'197143AWELLS FARGO BUSINESS CARD 101-3007-60461 950.00Marketing & Tourism Promoti…07/03-07/23/19 GPS CVB MEDIA DINNERJULY'197143AWELLS FARGO BUSINESS CARD 101-3007-60461 575.00Travel & Training07/03-07/23/19 APA CONFERENCEJULY'197143AWELLS FARGO BUSINESS CARD 101-6001-60320 950.00Travel & Training07/03-07/23/19 APA CONFERENCEJULY'197143AWELLS FARGO BUSINESS CARD 101-6002-60320 325.00Membership Dues07/03-07/23/19 ICC MEMBERSHIPJULY'197143AWELLS FARGO BUSINESS CARD 101-6003-60351 2,569.06Subscriptions & Publications07/03-07/23/19 ICC CODE BOOKSJULY'197143AWELLS FARGO BUSINESS CARD 101-6003-60352 95.00Travel & Training07/03-07/23/19 STORMWATER CERTIFICA…JULY'197143AWELLS FARGO BUSINESS CARD 101-7002-60320 495.00Sales Taxes Payable04/2019-06/2019 QUARTERLY SALES/USE …JUN'19SILVERROCK RESORT 101-0000-20304 1,200.00Sexual Assault Exam Fees06/14/19 - LA191650033JUN'19700000132EISENHOWER MEDICAL CENTER 101-2001-60193 39.02Materials/Supplies06/13-06/26/19 - FB AERATORJUN'19980015809…LOWE'S HOME IMPROVEMENT…101-3008-60431 3,263.64Tools/Equipment06/13-06/26/19 - MOBILE PRESSURE WAS…JUN'19980015809…LOWE'S HOME IMPROVEMENT…101-3008-60432 133.27Tools/Equipment06/13-06/26/19 - LED WORKLIGHTJUN'19980015809…LOWE'S HOME IMPROVEMENT…101-3008-60432 1,000.00Administrative Citations06/28/19 - LQ160511 REF DISMISSED CITA…LQ160511VOGT, KEVIN AND ALICIA 101-0000-42700 100.00Parking Violations06/18/19 - REFUND CITATION LQPLQP12363TAMPLIN, RICHARD L 101-0000-42706 305.00Parking Violations06/28/19 - LQP23395 PARKING CITATION …LQP23395FERRARO, SHERRY 101-0000-42706 194.08Postage MachineFINAL PROP TAX RECOVERY ON TERMINA…P7825281MAILFINANCE 101-1007-60661 5,597.00Special Enforcement Funds05/27/19 PALM DESERT REGIONAL POLICE…PD1MATRIX CONSULTING GROUP 101-2001-60175 202.49Water - Utilities07/23/19 - WATER SERVICEPWW199COACHELLA VALLEY WATER DI…101-2002-61200 114.94Water -Eisenhower Park - Utilit…07/23/19 - WATER SERVICEPWW199COACHELLA VALLEY WATER DI…101-3005-61203 76.66Water -Velasco Park - Utilities07/23/19 - WATER SERVICEPWW199COACHELLA VALLEY WATER DI…101-3005-61205 1,200.00Building Plan Check Fees07/22/19 - BRES2018-0018 REFUND DEPO…R31458ALONZO, LUIS 101-0000-42600 25.00Cash Over/Short07/12/19 - LIC-0103609 REFUND OVERPY…R51379AQUA RITE POOL & SPA 101-0000-42300 75.00Cash Over/Short07/15/19 - LIC-763178 REFUNDR51466ANTHONY TORRES DEMOLITI…101-0000-42300 50.00Cash Over/Short07/22/19 - LIC-0110862 REFUND WRONG …R51757INDEPENDENT MASONRY 101-0000-42300 42.89Materials/Supplies07/17/19 LANDSCAPE MATERIALSREG001-12125VINTAGE ASSOCIATES 101-3005-60431 5,597.00Special Enforcement Funds05/27/19 RANCHO MIRAGE REGIONAL PO…RM1MATRIX CONSULTING GROUP 101-2001-60175 175.56Mobile/Cell Phones/Satellites07/23-08/22/19 - EOC SATELLITE PHONESRU08202070ROADPOST USA INC.101-2002-61304 85.18Supplies-Graffiti and Vandalism07/22/19 MATERIALS FOR VANDALISM RE…S113587868.001WALTERS WHOLESALE ELECTR…101-3005-60423 930,018.46Sheriff Patrol05/23-06/30/19 - BP13 POLICE SERVICESH0000035767RIVERSIDE COUNTY SHERIFF D…101-2001-60161 25,916.95Police Overtime05/23-06/30/19 - BP13 POLICE SERVICESH0000035767RIVERSIDE COUNTY SHERIFF D…101-2001-60162 173,381.92Target Team05/23-06/30/19 - BP13 POLICE SERVICESH0000035767RIVERSIDE COUNTY SHERIFF D…101-2001-60163 84,948.37Community Services Officer05/23-06/30/19 - BP13 POLICE SERVICESH0000035767RIVERSIDE COUNTY SHERIFF D…101-2001-60164 18,730.80Gang Task Force05/23-06/30/19 - BP13 POLICE SERVICESH0000035767RIVERSIDE COUNTY SHERIFF D…101-2001-60166 18,730.80Narcotics Task Force05/23-06/30/19 - BP13 POLICE SERVICESH0000035767RIVERSIDE COUNTY SHERIFF D…101-2001-60167 167,769.59Motor Officer05/23-06/30/19 - BP13 POLICE SERVICESH0000035767RIVERSIDE COUNTY SHERIFF D…101-2001-60169 56,845.25Dedicated Sargeants05/23-06/30/19 - BP13 POLICE SERVICESH0000035767RIVERSIDE COUNTY SHERIFF D…101-2001-60170 28,439.76Dedicated Lieutenant05/23-06/30/19 - BP13 POLICE SERVICESH0000035767RIVERSIDE COUNTY SHERIFF D…101-2001-60171 49,022.34Sheriff - Mileage05/23-06/30/19 - BP13 POLICE SERVICESH0000035767RIVERSIDE COUNTY SHERIFF D…101-2001-60172 15,387.96Special Enforcement Funds05/23-06/30/19 - BP13 POLICE SERVICESH0000035767RIVERSIDE COUNTY SHERIFF D…101-2001-60175 228 Demand Register Packet: APPKT02083 - BC 08/02/19 8/2/2019 6:44:19 PM Page 4 of 9 AmountVendor Name Payable Number Description (Item)Account Name Account Number 41,204.00Sheriff - Other07/1/19-06/30/20 MEMBER ASSESMENTSH000035743RIVERSIDE COUNTY SHERIFF D…101-2001-60176 Fund 101 - GENERAL FUND Total:1,890,459.86 Fund: 201 - GAS TAX FUND 221.85Traffic Control Signs04/30/19 - TRAFFIC CONTROL SIGNS1074775TOPS'N BARRICADES INC 201-7003-60429 140.94Traffic Control Signs04/30/19 - TRAFFIC CONTROL SIGNS1074776TOPS'N BARRICADES INC 201-7003-60429 165.57Traffic Control Signs07/03/19-TRAFFIC CONTROL SIGNS1076063TOPS'N BARRICADES INC 201-7003-60429 229.14Traffic Control Signs07/09/19 TRAFFIC CONTROL SIGNS1076117TOPS'N BARRICADES INC 201-7003-60429 49.92Traffic Control Signs07/10/19-TRAFFIC CONTROL SIGNS1076156TOPS'N BARRICADES INC 201-7003-60429 76.34Traffic Control Signs07/12/19-TRAFFIC CONTROL SIGNS1076206TOPS'N BARRICADES INC 201-7003-60429 64.98Traffic Control Signs07/12/19-TRAFFIC CONTROL SIGNS1076207TOPS'N BARRICADES INC 201-7003-60429 242.08Traffic Control Signs07/17/19-TRAFFIC CONTOL SIGNS1076273TOPS'N BARRICADES INC 201-7003-60429 65.03Traffic Control Signs07/18/19-TRAFFIC CONTROL SIGNS1076297TOPS'N BARRICADES INC 201-7003-60429 124.79Traffic Control Signs07/18/19-TRAFFIC CONTROL SIGNS1076298TOPS'N BARRICADES INC 201-7003-60429 145.78Traffic Control Signs07/23/19-TRAFFIC CONTROL SIGNS1076400TOPS'N BARRICADES INC 201-7003-60429 896.14Safety Gear07/11/19 - SAFETY GEAR1348111BIG STATE INDUSTRIAL SUPPLY 201-7003-60427 184.86Safety Gear07/16/19 - SAFETY BOOTS M SALAS14026JERNIGAN'S, INC 201-7003-60427 Fund 201 - GAS TAX FUND Total:2,607.42 Fund: 202 - LIBRARY & MUSEUM FUND 2,644.42Janitorial07/2019 JANITORIAL SERVICES LIBRARY534976MERCHANTS BUILDING MAINT…202-3004-60115 698.50Janitorial07/2019 JANITORIAL SERVICES MUSEUM534976MERCHANTS BUILDING MAINT…202-3006-60115 74.00Pest Control07/05/19-LIBRARY PEST CONTROL660209728TRULY NOLEN INC 202-3004-60116 49.00Pest Control07/05/19-MUSEUM PEST CONTROL660209777TRULY NOLEN INC 202-3006-60116 165.00Security & Alarm07/01-09/30/19 BURG LIBRARY ALARM M…77348ALARM MONITORING SERVICE…202-3004-60123 165.00Security & Alarm07/01-09/30/19 BURG MUSEUM ALARM …77348ALARM MONITORING SERVICE…202-3006-60123 304.67Maintenance/Services06/18/19 - LIBRARY LEVER LOCKSET9208455981GRAINGER 202-3004-60691 130.24Telephone - Utilities07/13-08/12/19 - MUSEUM PHONEJUL'197710105FRONTIER COMMUNICATIONS…202-3006-61300 36.70Maintenance/Services06/13-06/26/19 - LIBRARY GLADEJUN'19980015809…LOWE'S HOME IMPROVEMENT…202-3004-60691 Fund 202 - LIBRARY & MUSEUM FUND Total:4,267.53 Fund: 212 - SLESA (COPS) FUND 1,392.92COPS Burglary/Theft Preventi…07/03-07/23/19 POLICE TRAININGJULY'197143AWELLS FARGO BUSINESS CARD 212-0000-60179 1,024.44COPS Robbery Prevention05/23-06/30/19 - BP13 POLICE SERVICESH0000035767RIVERSIDE COUNTY SHERIFF D…212-0000-60178 628.87COPS Burglary/Theft Preventi…05/23-06/30/19 - BP13 POLICE SERVICESH0000035767RIVERSIDE COUNTY SHERIFF D…212-0000-60179 Fund 212 - SLESA (COPS) FUND Total:3,046.23 Fund: 215 - LIGHTING & LANDSCAPING FUND 331.75Materials/Supplies07/08/19-INSECT SPRAY031-22PRESTIGE CHEMICALS INC 215-7004-60431 206.61Safety Gear07/10/19 - SAFETY BOOTS S HAMILTON14911JERNIGAN'S, INC 215-7004-60427 250.11Safety Gear07/10/19 - SAFETY BOOTS T STOIANOVICI14913JERNIGAN'S, INC 215-7004-60427 6,349.83Consultants07/2019 LIGHTING MAINTENANCE SERVICE16651CREATIVE LIGHTING & ELECTR…215-7004-60104 94.66Tools/Equipment07/24/19-CHAINSAW REPAIR192150MOWERS PLUS INC 215-7004-60432 222.20Administration06/06/19 - L&L HEARING NOTICE (360991…2602605DESERT SUN PUBLISHING, LLC 215-7004-60102 437.49Materials/Supplies07/11/19- IRRIGATION MATERIALS3465642SMITH PIPE & SUPPLY CO 215-7004-60431 2,215.00Palm Trees07/22/19 - PALM TREES TRIMMING91566PWLC II, INC 215-7004-60673 114.48Electric - Utilities07/07-08/06/19 - PHONE SERVICEJUL'193453493FRONTIER COMMUNICATIONS…215-7004-61116 49.04Electric - Utilities07/10-08/09/19 - PHONE SERVICEJUL'195646974FRONTIER COMMUNICATIONS…215-7004-61116 22.93Electric - Utilities07/25/19 - ELECTRICITY SERVICEPW216IMPERIAL IRRIGATION DIST 215-7004-61116 202.45Electric - Medians - Utilities07/25/19 - ELECTRICITY SERVICEPW216IMPERIAL IRRIGATION DIST 215-7004-61117 2,357.32Electric - Utilities07/29/19 - ELECTRICITY SERVICEPW217IMPERIAL IRRIGATION DIST 215-7004-61116 827.93Electric - Medians - Utilities07/29/19 - ELECTRICITY SERVICEPW217IMPERIAL IRRIGATION DIST 215-7004-61117 2,007.80Water - Medians - Utilities07/23/19 - WATER SERVICEPWW199COACHELLA VALLEY WATER DI…215-7004-61211 3,140.83Water - Medians - Utilities07/25/19 - WATER SERVICEPWW200COACHELLA VALLEY WATER DI…215-7004-61211 108.32Materials/Supplies07/22/19-L&L MATERIALSS113587721.001WALTERS WHOLESALE ELECTR…215-7004-60431 79.93Materials/Supplies07/22/19-L&L MATERIALSS113587817.001WALTERS WHOLESALE ELECTR…215-7004-60431 130.50Materials/Supplies07/22/19-L&L MATERIALSS113587887.001WALTERS WHOLESALE ELECTR…215-7004-60431 5.55Materials/Supplies07/22/19-L&L MATERIALSS113587943.001WALTERS WHOLESALE ELECTR…215-7004-60431 11.09Materials/Supplies07/22/19-L&L MATERIALSS113587980.001WALTERS WHOLESALE ELECTR…215-7004-60431 44.04Materials/Supplies07/22/19-L&L MATERIALSS113588012.001WALTERS WHOLESALE ELECTR…215-7004-60431 55.84Materials/Supplies07/22/19-L&L MATERIALSS113588095.001WALTERS WHOLESALE ELECTR…215-7004-60431 20.99Materials/Supplies07/22/19-L&L MATERIALSS113588197.001WALTERS WHOLESALE ELECTR…215-7004-60431 229 Demand Register Packet: APPKT02083 - BC 08/02/19 8/2/2019 6:44:19 PM Page 5 of 9 AmountVendor Name Payable Number Description (Item)Account Name Account Number 11.09Materials/Supplies07/22/19 L&L MATERIALSS113588275.001WALTERS WHOLESALE ELECTR…215-7004-60431 Fund 215 - LIGHTING & LANDSCAPING FUND Total:19,297.78 Fund: 241 - HOUSING AUTHORITY 149.00Travel & Training07/03-07/23/19 TRANING SEMINAR R.CA…JULY'197143AWELLS FARGO BUSINESS CARD 241-9101-60320 66.37Operating Supplies07/03-07/23/19 RUTAN &RSG CONFEREN…JULY'197143AWELLS FARGO BUSINESS CARD 241-9101-60420 Fund 241 - HOUSING AUTHORITY Total:215.37 Fund: 248 - SA 2004 LO/MOD BOND FUND (Refinanced in 2014) 105.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819CABRERA, ROSA 248-9102-60159 770.05Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819MARTINEZ, LINDA 248-9102-60159 95.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819DEVULDER MICHAEL 248-9102-60159 676.05Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819CORDERO, JOSEPH 248-9102-60159 90.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819CORDERO, SUSANA M.248-9102-60159 484.12Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819DEMARBIEX, TERESA 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819OLIVARES DE SALINAS, MARIA 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819GARZA, MARIA 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819MOLINA, MARIA 248-9102-60159 527.13Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819CARESCO, PAULA 248-9102-60159 768.49Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819HARLAND, GARY 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819MARQUEZ, KAREN 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819FREITAS, DELLA 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819BISANO, MARK 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819SCHOLTS, SANDRA 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819NGOC, TRAN 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819GARCIA, ROSALINA 248-9102-60159 125.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819MEZA, MARIA 248-9102-60159 109.99Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819TELLEZ, GARY 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819DOMINGUEZ, MARIA 248-9102-60159 105.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819DIAZ JUANITA 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819ABAZARI, PARVIN 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819CARRENO, HELADIA 248-9102-60159 200.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819DAVIDSON, GWENDOLYN 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819MACKAMAN, KATHIE 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819VELA, BERTHA 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819HUNTER, WILLIAM 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819TAYLOR, EUGENE 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819RAMIREZ, JOSE 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819NEWMAN, MICHAEL 248-9102-60159 90.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819CALKINS, LINDA 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819ORTIZ, ADELAIDA 248-9102-60159 115.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819ESPINOZA, BLANCA 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819RAIGOZA, LEOVELDINA 248-9102-60159 434.21Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819BEDWELL, SANDY 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819RUSSEL, MYRA 248-9102-60159 150.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819WILLIAMS, FRANCIS 248-9102-60159 944.35Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819KEPLINGER, DENNIS 248-9102-60159 100.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819CAMPOS, FRANCISCA 248-9102-60159 234.93Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819KIRKWOOD DIANA 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819MEZA, PENNY 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819RANGEL, ELENA 248-9102-60159 170.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819BROWN, GLORIA 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819VILLAVICENCIO, ROBERTO 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819DORF, MARYANN 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819ROBERTS, ERNESTINE 248-9102-60159 241.41Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819BAUMGARTNER, HELGA 248-9102-60159 150.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819CHAVEZ, YGNACIA 248-9102-60159 95.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819LOPEZ, MARIA 248-9102-60159 160.81Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819HERNANDEZ, YOLANDA 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819RUIZ, ROY 248-9102-60159 154.15Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819BRENNER, CRAIG 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819HILDEBRAND, PATRICIA 248-9102-60159 230 Demand Register Packet: APPKT02083 - BC 08/02/19 8/2/2019 6:44:19 PM Page 6 of 9 AmountVendor Name Payable Number Description (Item)Account Name Account Number 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819LUGO, CARMEN 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819CARVER, JANE 248-9102-60159 110.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819COX, JOHN 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819JORDAN, SHIRLEY 248-9102-60159 786.50Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819ROWLES MARIJA 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819DUMAS, MARY 248-9102-60159 75.00Relocation Benefits06/28/19 - FINAL CLAIM WSA RELOC PRJ062819SPINDOLA, TERESA 248-9102-60159 163.19Relocation Benefits06/20-07/18/19 - FINAL WSA RELOCJUL'1950744515IMPERIAL IRRIGATION DIST 248-9102-60159 Fund 248 - SA 2004 LO/MOD BOND FUND (Refinanced in 2014) Total:11,120.38 Fund: 401 - CAPITAL IMPROVEMENT PROGRAMS 76.97Construction07/23/19-REIMBURSEMENT FOR SUPPLIES…072319MIGNOGNA, JULIE 401-0000-60188 5,773.11Design06/2019 EISENHOWER DRAINAGE PRJ 201…1055337MICHAEL BAKER INTERNATIO…401-0000-60185 49,372.31Design06/30/19 GHD VILLAGE COMPLETE STREE…123567GHD INC.401-0000-60185 940.37Construction07/18/19 - PROJ SIGNS COMPLETE STREETS19-32503XPRESS GRAPHICS 401-0000-60188 2,500.00Design06/30/19 ON-CALL SURVEY HWY 111 SID…2219.009-02MSA CONSULTING INC 401-0000-60185 9,441.25Technical06/30/19 ON-CALL SURVEY EISENHOWER …2219.012-01MSA CONSULTING INC 401-0000-60108 1,156.50DesignJUNE 2019 DUNE PALMS WIDENING PRJ 0…3764BENGAL ENGINEERING INC 401-0000-60185 17,394.92DesignJUNE 2019 DUNE PALMS BRIDGE LOW W…3765BENGAL ENGINEERING INC 401-0000-60185 -3,010.24Retention PayablePO 1920-0033 RETENTION #15047URBAN HABITAT ENVIRONME…401-0000-20600 60,204.80Construction07/2019 2016-03D LQ LANDSCAPE IMPR -…5047URBAN HABITAT ENVIRONME…401-0000-60188 13.82Construction06/13-06/26/19 - GROUND WIREJUN'19980015809…LOWE'S HOME IMPROVEMENT…401-0000-60188 8,529.72Construction06/2019 - LQ VILLAGE COMPLETE STREETSLQ001SOUTHSTAR ENGINEERING AN…401-0000-60188 Fund 401 - CAPITAL IMPROVEMENT PROGRAMS Total:152,393.53 Fund: 501 - FACILITY & FLEET REPLACEMENT 1,774.51Fuel & Oil07/01-07/11/19 VEHICLE FUELL1318TOWER ENERGY GROUP 501-0000-60674 760.14Street Sweeper07/08/19-SWEEPER PARTS191063SWEEPER SHOP 501-0000-60678 1,144.28Street Sweeper07/11/19-SWEEPER PARTS AND REPAIR191098SWEEPER SHOP 501-0000-60678 3,750.00Cvc Ctr Bldg Repl/Repair06/17/19 - DESIGN FOR WELLNESS CENTER1932DESIGN ONE ELEVEN LLC 501-0000-71103 16.30Vehicle Repair & Maintenance05/23/19 - VEHICLE REPAIR5560011644AUTOZONE 501-0000-60676 29.35Vehicle Repair & Maintenance06/21/19 - VEHICLE REPAIR5560044376AUTOZONE 501-0000-60676 Fund 501 - FACILITY & FLEET REPLACEMENT Total:7,474.58 Fund: 502 - INFORMATION TECHNOLOGY 4,331.25Software Licenses09/01/19-08/31/20 AR MODULE MAINTE…025-266974TYLER TECHNOLOGIES 502-0000-60301 809.93Copiers07/20-08/19/19 CANON COPIER CONTRA…20364900CANON FINANCIAL SERVICES, …502-0000-60662 78.75D & D, Software Enhancements06/01-06/30/19 - TRAKIT CHECK API ACCE…246603SUPERION, LLC 502-0000-71042 4,333.33D & D, Software Enhancements06/2019 - TRAKIT ANNUAL MAINT246606SUPERION, LLC 502-0000-71042 355.07Copiers05/16/19 - PRINTER HEAD PLOTTER D&D3414054260STAPLES ADVANTAGE 502-0000-60662 240.33Machinery & Equipment07/29/19 - HEADSET K ROMERO349869840001OFFICE DEPOT 502-0000-80100 76.86Cable - Utilities07/12-08/11/19504080071219TIME WARNER CABLE 502-0000-61400 95.98Cable - Utilities07/10-08/09/19 - CITY HALL INTERNETJUL'191712626FRONTIER COMMUNICATIONS…502-0000-61400 50.00Software Licenses07/13-8/13/19 BASECAMPJULY'197143AWELLS FARGO BUSINESS CARD 502-0000-60301 119.88Software Licenses07/03-07/23/19 DROPBOX ANNUALJULY'197143AWELLS FARGO BUSINESS CARD 502-0000-60301 167.45Comm. Resources, Software E…07/03-07/23/19 INFOGRAPHICSJULY'197143AWELLS FARGO BUSINESS CARD 502-0000-71043 Fund 502 - INFORMATION TECHNOLOGY Total:10,658.83 Fund: 504 - INSURANCE FUND 32.61Office Supplies07/17/19 - W/C FILE INSERTS343258933001OFFICE DEPOT 504-1010-60400 Fund 504 - INSURANCE FUND Total:32.61 Fund: 601 - SILVERROCK RESORT 16.00Bank Fees06/2019 - SRR ARMORED SERVICES20380121GARDAWORLD 601-0000-60455 Fund 601 - SILVERROCK RESORT Total:16.00 Grand Total:2,101,590.12 231 Demand Register Packet: APPKT02083 - BC 08/02/19 8/2/2019 6:44:19 PM Page 7 of 9 Fund Summary Fund Expense Amount 101 - GENERAL FUND 1,890,459.86 201 - GAS TAX FUND 2,607.42 202 - LIBRARY & MUSEUM FUND 4,267.53 212 - SLESA (COPS) FUND 3,046.23 215 - LIGHTING & LANDSCAPING FUND 19,297.78 241 - HOUSING AUTHORITY 215.37 248 - SA 2004 LO/MOD BOND FUND (Refinanced in 2014)11,120.38 401 - CAPITAL IMPROVEMENT PROGRAMS 152,393.53 501 - FACILITY & FLEET REPLACEMENT 7,474.58 502 - INFORMATION TECHNOLOGY 10,658.83 504 - INSURANCE FUND 32.61 601 - SILVERROCK RESORT 16.00 Grand Total:2,101,590.12 Account Summary Account Number Account Name Expense Amount 101-0000-20304 Sales Taxes Payable 468.10 101-0000-42300 Cash Over/Short 150.00 101-0000-42600 Building Plan Check Fees 1,200.00 101-0000-42700 Administrative Citations 1,500.00 101-0000-42706 Parking Violations 405.00 101-1004-60103 Professional Services 165.18 101-1004-60129 Recruiting/Pre-Employme…84.62 101-1004-60322 Training & Education/MOU 3,225.00 101-1004-60340 Employee Recognition Ev…657.50 101-1004-60400 Office Supplies 451.73 101-1005-60320 Travel & Training 3,100.00 101-1005-60400 Office Supplies 163.35 101-1005-60420 Operating Supplies 245.82 101-1006-60320 Travel & Training 1,123.00 101-1006-60400 Office Supplies 138.47 101-1006-60410 Printing 60.49 101-1007-60351 Membership Dues 120.00 101-1007-60402 Forms, Copier Paper 346.59 101-1007-60403 Citywide Conf Room Suppl…273.74 101-1007-60470 Postage 3,580.39 101-1007-60661 Postage Machine 194.08 101-2001-60109 LQ Police Volunteers 657.80 101-2001-60161 Sheriff Patrol 930,018.46 101-2001-60162 Police Overtime 25,916.95 101-2001-60163 Target Team 173,381.92 101-2001-60164 Community Services Offic…84,948.37 101-2001-60165 Special Enforcement/Hu…125.01 101-2001-60166 Gang Task Force 18,730.80 101-2001-60167 Narcotics Task Force 18,730.80 101-2001-60169 Motor Officer 167,769.59 101-2001-60170 Dedicated Sargeants 56,845.25 101-2001-60171 Dedicated Lieutenant 28,439.76 101-2001-60172 Sheriff - Mileage 49,022.34 101-2001-60174 Blood/Alcohol Testing 674.00 101-2001-60175 Special Enforcement Funds 33,978.96 101-2001-60176 Sheriff - Other 41,204.00 101-2001-60193 Sexual Assault Exam Fees 1,200.00 101-2001-60420 Operating Supplies 787.96 101-2001-61300 Telephone - Utilities 44.92 101-2001-71031 Vehicles 29,824.42 101-2002-60116 Pest Control 2,268.60 101-2002-60320 Travel & Training 363.26 101-2002-60400 Office Supplies 95.88 232 Demand Register Packet: APPKT02083 - BC 08/02/19 8/2/2019 6:44:19 PM Page 8 of 9 Account Summary Account Number Account Name Expense Amount 101-2002-60691 Maintenance/Services 220.00 101-2002-61101 Electricity - Utilities 1,361.09 101-2002-61200 Water - Utilities 202.49 101-2002-61304 Mobile/Cell Phones/Satell…193.38 101-2002-61400 Cable - Utilities 201.59 101-2002-72110 Building Improvements 8,720.74 101-3001-60420 Operating Supplies 312.41 101-3002-60107 Instructors 446.00 101-3002-60420 Operating Supplies 1,576.35 101-3005-60184 Fritz Burns Pool 11,000.98 101-3005-60423 Supplies-Graffiti and Van…85.18 101-3005-60431 Materials/Supplies 2,865.77 101-3005-60557 Tree Maintenance 900.00 101-3005-61102 Electric - Monticello Park -…12.34 101-3005-61108 Electric - Colonel Paige - U…35.36 101-3005-61109 Electric - Community Park …1,612.79 101-3005-61110 Electric - Adams Park - Util…35.36 101-3005-61111 Electric - Velasco Park - Uti…13.38 101-3005-61113 Electric - Eisenhower Park …21.55 101-3005-61114 Electric - Desert Pride - Uti…13.26 101-3005-61202 Water - Civic Center Park -…4,038.84 101-3005-61203 Water -Eisenhower Park -…114.94 101-3005-61205 Water -Velasco Park - Utili…76.66 101-3005-61209 Water -Community Park -…7,482.16 101-3007-60351 Membership Dues 75.00 101-3007-60410 Printing 170.91 101-3007-60461 Marketing & Tourism Pro…53,235.91 101-3008-60115 Janitorial 11,091.38 101-3008-60116 Pest Control 225.00 101-3008-60123 Security & Alarm 660.00 101-3008-60431 Materials/Supplies 3,969.30 101-3008-60432 Tools/Equipment 3,396.91 101-3008-60667 HVAC 6,420.00 101-3008-60691 Maintenance/Services 1,549.50 101-6001-60320 Travel & Training 575.00 101-6001-60420 Operating Supplies 3.80 101-6002-60103 Professional Services 57,591.00 101-6002-60320 Travel & Training 950.00 101-6003-60351 Membership Dues 325.00 101-6003-60352 Subscriptions & Publicati…2,569.06 101-6003-60420 Operating Supplies 441.83 101-6004-60103 Professional Services 3,000.00 101-6004-60111 Administrative Citation Se…417.00 101-6004-60125 Temporary Agency Servic…1,316.06 101-6004-60197 Animal Shelter Contract S…13,722.43 101-6004-60400 Office Supplies 45.66 101-6006-60125 Temporary Agency Servic…3,541.53 101-6006-60320 Travel & Training 299.00 101-7002-60320 Travel & Training 95.00 101-7002-60420 Operating Supplies 168.96 101-7003-60420 Operating Supplies 242.41 101-7006-60146 PM 10 - Dust Control 137.48 201-7003-60427 Safety Gear 1,081.00 201-7003-60429 Traffic Control Signs 1,526.42 202-3004-60115 Janitorial 2,644.42 202-3004-60116 Pest Control 74.00 202-3004-60123 Security & Alarm 165.00 202-3004-60691 Maintenance/Services 341.37 233 Demand Register Packet: APPKT02083 - BC 08/02/19 8/2/2019 6:44:19 PM Page 9 of 9 Account Summary Account Number Account Name Expense Amount 202-3006-60115 Janitorial 698.50 202-3006-60116 Pest Control 49.00 202-3006-60123 Security & Alarm 165.00 202-3006-61300 Telephone - Utilities 130.24 212-0000-60178 COPS Robbery Prevention 1,024.44 212-0000-60179 COPS Burglary/Theft Prev…2,021.79 215-7004-60102 Administration 222.20 215-7004-60104 Consultants 6,349.83 215-7004-60427 Safety Gear 456.72 215-7004-60431 Materials/Supplies 1,236.59 215-7004-60432 Tools/Equipment 94.66 215-7004-60673 Palm Trees 2,215.00 215-7004-61116 Electric - Utilities 2,543.77 215-7004-61117 Electric - Medians - Utiliti…1,030.38 215-7004-61211 Water - Medians - Utilities 5,148.63 241-9101-60320 Travel & Training 149.00 241-9101-60420 Operating Supplies 66.37 248-9102-60159 Relocation Benefits 11,120.38 401-0000-20600 Retention Payable -3,010.24 401-0000-60108 Technical 9,441.25 401-0000-60185 Design 76,196.84 401-0000-60188 Construction 69,765.68 501-0000-60674 Fuel & Oil 1,774.51 501-0000-60676 Vehicle Repair & Mainte…45.65 501-0000-60678 Street Sweeper 1,904.42 501-0000-71103 Cvc Ctr Bldg Repl/Repair 3,750.00 502-0000-60301 Software Licenses 4,501.13 502-0000-60662 Copiers 1,165.00 502-0000-61400 Cable - Utilities 172.84 502-0000-71042 D & D, Software Enhance…4,412.08 502-0000-71043 Comm. Resources, Softwa…167.45 502-0000-80100 Machinery & Equipment 240.33 504-1010-60400 Office Supplies 32.61 601-0000-60455 Bank Fees 16.00 Grand Total:2,101,590.12 Project Account Summary Project Account Key Expense Amount **None**1,854,997.87 091004D 1,156.50 111205D 17,394.92 151603CT 9,547.06 151603D 49,372.31 151612D 5,773.11 151612T 9,441.25 1819TMICT 13.82 201603CT 60,204.80 201603RP -3,010.24 201803D 2,500.00 201823E 57,591.00 201835E 8,720.74 CSA152E 95.00 FBPOPSE 11,000.98 MATRIXE 16,791.00 Grand Total:2,101,590.12 234 8/12/2019 2:17:49 PM Page 1 of 2 Demand Register City of La Quinta Packet: APPKT02086 - BC 08/09/19 AmountVendor Name Payable Number Description (Item)Account Name Account Number Fund: 101 - GENERAL FUND 196.05LT Care Insurance PayLONG TERM CARE0001999CALPERS LONG-TERM CARE P…101-0000-20949 92.00United Way DeductionsCONTRIBUTION0002000UNITED WAY OF THE DESERT 101-0000-20981 162.00Garnishments PayableGARNISHMENT0002001RIVERSIDE COUNTY SHERIFF'S …101-0000-20985 349.31Garnishments PayableGARNISHMENT0002002RIVERSIDE COUNTY SHERIFF'S …101-0000-20985 Fund 101 - GENERAL FUND Total:799.36 Grand Total:799.36 235 Demand Register Packet: APPKT02086 - BC 08/09/19 8/12/2019 2:17:49 PM Page 2 of 2 Fund Summary Fund Expense Amount 101 - GENERAL FUND 799.36 Grand Total:799.36 Account Summary Account Number Account Name Expense Amount 101-0000-20949 LT Care Insurance Pay 196.05 101-0000-20981 United Way Deductions 92.00 101-0000-20985 Garnishments Payable 511.31 Grand Total:799.36 Project Account Summary Project Account Key Expense Amount **None**799.36 Grand Total:799.36 236 8/16/2019 7:38:45 PM Page 1 of 11 Demand Register City of La Quinta Packet: APPKT02094 - BC 08/16/19 AmountVendor Name Payable Number Description (Item)Account Name Account Number Fund: 101 - GENERAL FUND 300.00Lot Cleaning/Gravel Program07/08/19 - WEED ABATEMENT CASE #19-…070819MOYA, DANIEL 101-6004-60120 595.00Maintenance/Services08/05/19 - FB REPLACE COMPRESSOR080519SOUTHLAND APLIANCE SERVICE 101-3008-60691 15.00Consultants07/05-07/26/19 - FINGERPRINT VOL & REC…080619RJW NOTARY PUBLIC 101-1004-60104 94.00Recruiting/Pre-Employment07/05-07/26/19 - FINGERPRINT VOL & REC…080619RJW NOTARY PUBLIC 101-1004-60129 16.58Employee Recognition Events06/05/19-LQ GRAD SUPPLIES080819CASH/PETTY CASH 101-1004-60340 9.02Employee Recognition Events05/20/19-GALLUP SURVEY080819CASH/PETTY CASH 101-1004-60340 14.74Travel & Training06/19/19- HUB/FINANCE TRAINING SNAC…080819CASH/PETTY CASH 101-1006-60320 23.83Travel & Training06/26/19- HUB/FINANCE TRAINING SNAC…080819CASH/PETTY CASH 101-1006-60320 15.22Postage Machine06/24/19-POSTAGE080819CASH/PETTY CASH 101-1007-60661 13.99Volunteers - Fire04/27/19-BREAKFAST FOR CERT AT CITY P…080819CASH/PETTY CASH 101-2002-60110 11.51Materials/Supplies05/21/19-EISENHOWER PARK SUPPLIES080819CASH/PETTY CASH 101-3005-60431 33.00Travel & Training05/09/19- DVBA MTG FOR J.MIGNOGNA080819CASH/PETTY CASH 101-6001-60320 33.00Travel & Training05/09/19- DVBA MTG FOR CHERI FLORES080819CASH/PETTY CASH 101-6002-60320 282.25Training & Education/MOU08/1/19-TUITION REIMBURSEMENT081219SCOTT, ANGELA 101-1004-60322 241.08Instructors08/12/19 - BALLROOM DANCING081219SHIRY, TERESA 101-3002-60107 199.92Instructors08/12/19 - TAI CHI CHUAN081219MEDEIROS, JOYCELEEN 101-3002-60107 350.84Instructors08/12/19 - CARDIO & SUN STYLE TAI CHI081219COHEN, ANN MARIE 101-3002-60107 600.25Instructors08/12/19 - TAEKWONDO081219ROJAS, MIGUEL ANGEL 101-3002-60107 333.20Instructors08/12/19 - SUNSET YOGA081219TRUE, ARTHUR ALLEN 101-3002-60107 102.40Instructors8/12/19 - PERSONAL TRAINER081219ROSE-FARKAS, LORETTA ANN 101-3002-60107 111.23Instructors08/12/19 - ZUMBA081219MISELL, STACY 101-3002-60107 148.96Instructors08/12/19 - EVENING & GENTLE YOGA081219WILSON, ALBA 101-3002-60107 225.00Instructors08/12/19 - STRETCH & RESTORE081219JOHNSON, KAREN T. PAYNE 101-3002-60107 1,670.00BSAS SB 1473 Fees04/01-06/30/19- BSAS FEES081319CALIFORNIA BUILDING STAND…101-0000-20306 -167.00CBSC Administrative Fees04/01-06/30/19- BSAS FEES081319CALIFORNIA BUILDING STAND…101-0000-42615 41.86Travel & Training08/13/19 - FOOD TRAINING081319CASH/PETTY CASH 101-1002-60320 95.00Membership Dues07/01/19-06/30/20 - MEMBERSHIP ANNU…081319CALIFORNIA MUNICIPAL TREA…101-1006-60351 15.99Travel & Training08/13/19 - VEHICLE WASH081319CASH/PETTY CASH 101-2002-60320 15.23Operating Supplies08/13/19 - ART EVENT WKSHOP SUPP 7/1…081319CASH/PETTY CASH 101-3001-60420 270.00Instructors08/13/19 - SCULPT FIT CORE081319JOHNSON, KAREN T. PAYNE 101-3002-60107 161.00Administrative Citation Services08/13/19 - LQP30068 REFUND CITATION081319DE LA FUENTE, ERICA 101-6004-60111 55.00Administrative Citation Services08/13/19 - LQP12071 REFUND CITATION081319CALHOUN, BRYCE 101-6004-60111 200.00Administrative Citation Services08/13/19 - LQA162733 REFUND CITATION081319CARROLL, CORINNE 101-6004-60111 10.00Administrative Citation Services08/13/19 - LQP23564 REFUND CITATION081319CHAPPEL, RON 101-6004-60111 105.00Administrative Citation Services08/13/19 - LQP15417 REFUND CITATION081319AMERICAN TRAFFIC PROCESSI…101-6004-60111 40.00Administrative Citation Services08/13/19 - LQP12093 REFUND CITATION081319DYNAMIC INTERIOR/EXT 101-6004-60111 45.00Over Payments, AR Policy08/14/19 - LIC-0003629 REFUND OVERPY…081419J-Z CONCRETE CONSTRUCTION …101-0000-20330 10.00Administrative Citation Services08/14/19 - LQP22288 REFUND CITATION081419HARRISON, GLORIA 101-6004-60111 50.00Administrative Citation Services08/14/19 - LQP23934 REFUND CITATION081419GALLEGOS, DENISE ROXANNE 101-6004-60111 50.00Administrative Citation Services08/14/19 - LQP29948 REFUND CITATION081419HMR DESIGNS 101-6004-60111 100.00Administrative Citation Services08/14/19 - LQ160187 REFUND CITATION081419GIBSON, MICHAEL 101-6004-60111 158.78Travel & Training08/15/19 - REIMB COUNCIL MTG DINNER …081519THOMPSON, TERESA 101-1001-60320 36.62Travel & Training08/15/19 - REIMB COUNCIL MTG SNACKS …081519THOMPSON, TERESA 101-1001-60320 32.61Operating Supplies08/15/19 - REIMB PROCLAMATION FRAME081519THOMPSON, TERESA 101-1001-60420 854.72Special Enforcement/Humana07/14-07/26/19 - TRAVEL ADV TRAFFIC C…081519KNIGHT, DANIEL 101-2001-60165 29.70Administrative Citation Services08/15/19 - LQP23566 REFUND CITATION081519WILEY, KAY AND RONALD 101-6004-60111 355.00Administrative Citation Services08/15/19 - LQP27215 REFUND CITATION081519MILAN, MAIBEL RIVAS 101-6004-60111 25.00Administrative Citation Services08/15/19 - LQP30406 REFUND CITATION081519MECH, CHARLES 101-6004-60111 25.00Administrative Citation Services08/15/19 - LQP15214 REFUND CITATION081519LOCKEN, LINDA SUE 101-6004-60111 98.42Safety Gear08/15/19 - REIMB WORK BOOTS081519ST SAUVER, LEONARD 101-7006-60427 43.74Water - Utilities08/16/19 - WATER SVC DUNE PALMS 304…081619304910COACHELLA VALLEY WATER DI…101-3008-61200 1,350.00Civic Center Lake Maintenance07/2019 - LAKE MAINTENANCE10004917DIVERSIFIED WATERSCAPES IN…101-3005-60117 1,350.00Civic Center Lake Maintenance08/2019 - LAKE MAINTENANCE10004918DIVERSIFIED WATERSCAPES IN…101-3005-60117 237 Demand Register Packet: APPKT02094 - BC 08/16/19 8/16/2019 7:38:45 PM Page 2 of 11 AmountVendor Name Payable Number Description (Item)Account Name Account Number 155.62Professional Services08/2019 - ARMORED SERVICES10504897GARDAWORLD 101-1006-60103 2,670.03Community Experiences08/24/19 - CLQ SUMMER GOLF TOUR BA…1LA QUINTA RESORT & CLUB 101-3003-60149 850.00Marketing & Tourism Promoti…07/17-08/13/19 PS AIRPORT AD110460528THE LAMAR COMPANIES 101-3007-60461 1,519.00Maintenance/Services08/07/19 - SPORTS COMPLEX MAINT1114BLOWNAWAY BY WILLIAM 101-3005-60691 1,298.48Telephone - Utilities07/23-08/22/19 - EOC119143031-0TPX COMMUNICATIONS 101-2002-61300 692.03Special Enforcement Funds7/16/19 - MOTORCYCLE BLUE TOOTH UP…126060PVP COMMUNICATIONS INC 101-2001-60175 203.73Operating Supplies07/18-08/01/19 - WC JANITORIAL SUPPLIES1402156575AMERIPRIDE SERVICES INC 101-3002-60420 75.00Blood/Alcohol Testing07/25/19 - BLOOD/ALCOHOL ANALYSIS14534LAW ENFORCEMENT MEDICAL…101-2001-60174 206.61Safety Gear07/08/19 - SAFETY BOOTS D PECINA14904JERNIGAN'S, INC 101-3008-60427 212.46Materials/Supplies08/07/19 - COPPER CYN BOULDERS155437SOUTHWEST BOULDER & STO…101-3005-60431 435.29Materials/Supplies08/08/19 - COPPER CYN BOULDERS & IND…155588SOUTHWEST BOULDER & STO…101-3005-60431 378.72Materials/Supplies08/08/19 - CALIF GOLD155652SOUTHWEST BOULDER & STO…101-3005-60431 412.00Supplies-Graffiti and Vandalism07/31/19 - LQ MIDDLE SCHOOL SPORTS F…16827CREATIVE LIGHTING & ELECTR…101-3005-60423 474.60Fritz Burns Pool07/31/19 - FB POOL ELECTRICAL REPAIRS16828CREATIVE LIGHTING & ELECTR…101-3005-60184 935.50Supplies-Graffiti and Vandalism07/31/19 - LQ MIDDLE SCHOOL SPORTS F…16829CREATIVE LIGHTING & ELECTR…101-3005-60423 4,000.00Marketing & Tourism Promoti…08/2019 GRAPHIC DESIGN1687ARK CONNECTS LLC 101-3007-60461 1,500.00Supplies-Graffiti and Vandalism08/09/19 - LQ MIDDLE SCHOOL SPORTS F…16931CREATIVE LIGHTING & ELECTR…101-3005-60423 30,375.00Professional ServicesJULY 2019 HWY 111 AREA PLANNING1806RANGWALA ASSOCIATES 101-6002-60103 400.00Consultants07/2019 WELLNESS WORKS - EMP ASSIST …18-084WELLNESS WORKS 101-1004-60104 125.00HVAC07/17/19 - WC HVAC SVC18600824HYDE'S AC 101-3008-60667 2,627.00HVAC07/17/19 - CITY HALL HVAC SVC18617718HYDE'S AC 101-3008-60667 133.37PM 10 - Dust Control08/05-09/01/19 - PM10 ANSWERING SERV…190802190101ANSAFONE CONTACT CENTERS 101-7006-60146 995.26LQ Park Water Feature06/27/19-LQ PARK WF CHEMICAL FEEDERS19110703SHARK POOLS INC 101-3005-60554 112.00LQ Park Water Feature07/2019 - LQ PARK WF CHLOR TABS DEL 7…19110801SHARK POOLS INC 101-3005-60554 295.00LQ Park Water Feature08/2019 - LQ PARK WF SERVICE19110802SHARK POOLS INC 101-3005-60554 1,475.00Fritz Burns Pool08/2019 - FB POOL SERVICE19120801SHARK POOLS INC 101-3005-60184 407.50Fritz Burns Pool06/25/19 F.B.PULSAR TABS19120802SHARK POOLS INC 101-3005-60184 407.50Fritz Burns Pool07/2019 - FB POOL CHLOR TABS DEL 7/319120803SHARK POOLS INC 101-3005-60184 407.50Fritz Burns Pool07/2019 - FB POOL CHLOR TABS DEL 7/1219120804SHARK POOLS INC 101-3005-60184 407.50Fritz Burns Pool07/2019 - FB POOL CHLOR TABS DEL 7/1919120805SHARK POOLS INC 101-3005-60184 348.00Operating Supplies07/31/19 - GREY RETURN ENV BUS LIC191376PRINTING PLACE, THE 101-6006-60420 22.42Operating Supplies08/06/19 - NAME PLATE CITY CLERK2018-4602MCDOWELL AWARDS 101-1005-60420 10,460.48School Officer05/23-06/30/19- SCHOOL RESOURCE OFFI…2019-/1695DESERT SANDS UNIFIED SCHO…101-2001-60168 384.75Recruiting/Pre-Employment07/2019 - PRE EMPLOYMENT BACKGROU…2019070001IRC INC 101-1004-60129 350.00Materials/Supplies08/06/19 - MONTECITO PK INSTALL TIPU …213250VINTAGE ASSOCIATES 101-3005-60431 120.00Travel & Training07/08/19 - RIVCO DIVISION MTG2346LEAGUE OF CALIFORNIA CITIES 101-1001-60320 80.00Travel & Training07/08/19 - RIVCO DIVISION MTG2346LEAGUE OF CALIFORNIA CITIES 101-1002-60320 8,631.95Dental Insurance Pay08/2019 - DENTAL INSURANCE2503980CIGNA HEALTH CARE 101-0000-20943 -26.53Sales Taxes Payable08/07/19 - WC GYM WIPES SALES TAX2551762XL CORPORATION 101-0000-20304 438.45Operating Supplies08/07/19 - WC GYM WIPES2551762XL CORPORATION 101-3002-60420 645.00Subscriptions & Publications08/05/19 - 18/19 CAFR STATS PACKAGE26991-INHDL COREN & CONE 101-1006-60352 102.98Fritz Burns Pool07/16/19 - FB POOL SUPPLIES29477044LINCOLN AQUATICS 101-3005-60184 1,525.00Maintenance/Services07/26/19 - FB POOL RESTROOMS SVC331043835ROTO ROOTER PLUMBERS INC 101-3008-60691 575.00Maintenance/Services07/26/19 - FS #70 RESTROOM331132424ROTO ROOTER PLUMBERS INC 101-2002-60691 338.72Uniforms07/25/19 - UNIFORMS33579358SERVICE WEAR APPAREL 101-3008-60690 357.64Uniforms08/05/19 - UNIFORMS33636814SERVICE WEAR APPAREL 101-3005-60690 -104.38Office Supplies07/23/19-CREDIT FOR INV 3418893968 06…3420265059STAPLES ADVANTAGE 101-3002-60400 35.29Office Supplies07/27/19 - OFFICE SUPPLIES3420458182STAPLES ADVANTAGE 101-3005-60400 18.00Office Supplies07/31/19 - OFFICE SUPPLIES FIRE3420861877STAPLES ADVANTAGE 101-2002-60400 171.83Office Supplies07/31/19 - OFFICE SUPPLIES CODE3420861877STAPLES ADVANTAGE 101-6004-60400 84.30Citywide Conf Room Supplies07/31/19 - INK T920 PLOTTER3420861878STAPLES ADVANTAGE 101-1007-60403 39.97Operating Supplies07/31/19 - OFFICE SUPPLIES3420861878STAPLES ADVANTAGE 101-6001-60420 106.55Citywide Conf Room Supplies08/02/19 - CITY WIDE SUPPLIES COFFEE3421056858STAPLES ADVANTAGE 101-1007-60403 40.71Office Supplies07/26/19 - OFFICE SUPPLIES349095110001OFFICE DEPOT 101-1005-60400 78.76Office Supplies07/30/19 - OFFICE SUPPLIES FIRE351632597001OFFICE DEPOT 101-2002-60400 39.94Office Supplies07/31/19 - OFFICE SUPPLIES FIRE352388557001OFFICE DEPOT 101-2002-60400 20.13Office Supplies07/31/19 - OFFICE SUPPLIES CODE352388557001OFFICE DEPOT 101-6004-60400 15.77Office Supplies07/31/19 - AP FILE FOLDERS352804836001OFFICE DEPOT 101-1006-60400 19.59Office Supplies08/01/19 - OFFICE SUPPLIES353315477001OFFICE DEPOT 101-1005-60400 22.28Office Supplies08/02/19 - OFFICE SUPPLIES354476353001OFFICE DEPOT 101-1006-60400 238 Demand Register Packet: APPKT02094 - BC 08/16/19 8/16/2019 7:38:45 PM Page 3 of 11 AmountVendor Name Payable Number Description (Item)Account Name Account Number 715.45Materials/Supplies07/11/19 - PLAYGROUND SWINGS47133DAVE BANG, INC.101-3005-60431 160.00Maintenance/Services07/19/19 - FB POOL ENTRY DOORS4763KEEP IT COOL WINDOW TINTI…101-3008-60691 108.94Cable - Utilities07/24-08/23/19 - FS #93 CABLE SVC (2415)502415072419TIME WARNER CABLE 101-2002-61400 2,347.50Professional Services08/06/19 - 19/20 BUDGET AT A GLANCE5168CV STRATEGIES 101-1006-60103 -80.94Temporary Agency Services04/19/19 HUB TEMP SVC M.GONZALEZ53389989ROBERT HALF TECHNOLOGY 101-6006-60125 762.24Temporary Agency Services07/26/19 - CODE TEMP SVCS C HARGENS53976480OFFICE TEAM 101-6004-60125 1,153.80Temporary Agency Services08/02/19 - HUB TEMP SVCS M GONZALEZ54008984ROBERT HALF TECHNOLOGY 101-6006-60125 315.00Operating Supplies07/2019 - WC GYM EQUIP PREV MAINT5536ROYAL GYM SERVICES, LLC 101-3002-60420 84.99Cable - Utilities08/03-09/02/19 - FS #93 INTERNET (3514)583514080319TIME WARNER CABLE 101-2002-61400 84.99Cable - Utilities07/29-08/28/19 - FS #32 INTERNET (6491)586491080119TIME WARNER CABLE 101-2002-61400 23,264.00Contract Traffic Engineer06/22-06/28/19 ON-CALL TRAFFIC ENGIN…617841WILLDAN 101-7006-60144 2,240.00Contract Traffic Engineer06/29-06/30/19 ON-CALL TRAFFIC ENGIN…617893WILLDAN 101-7006-60144 175.00Travel & Training08/06/19 - MGMT ACADEMY C MARTINEZ6234CALIFORNIA JOINT POWERS IN…101-1006-60320 175.00Travel & Training08/06/19 - MGMT ACADEMY L ST SAUVER6234CALIFORNIA JOINT POWERS IN…101-7006-60320 258.13Citywide Conf Room Supplies07/31/19 - WC COFFEE SUPPLIES654116DAIOHS FIRST CHOICE SERVICES 101-1007-60403 20.00Credit Card Fees08/05/19 - WC CREDIT CARD FEES716324PLUG & PAY TECHNOLOGIES I…101-3003-60122 20.00Administration08/05/19 - HUB CREDIT CARD FEES716325PLUG & PAY TECHNOLOGIES I…101-6001-60102 388.41Materials/Supplies05/03/19 - CITY HALL SIGNS7514TOP OF THE LINE SIGNS 101-3008-60431 510.00Fire Station07/01-09/30/19 FIRE ALARM MONITORIN…77349ALARM MONITORING SERVICE…101-2002-60670 510.00Security & Alarm07/01-09/30/19 FIRE ALARM MONITORIN…77349ALARM MONITORING SERVICE…101-3008-60123 19.25LQ Police Volunteers07/15/19 - SHREDDING POLICE8127714035SHRED-IT USA - SAN BERNADI…101-2001-60109 2,400.00Land Acquisition08/01/19 - SRR PHASE 1 ENVIRONMENTAL813294EARTH SYSTEMS PACIFIC 101-1007-74010 165.00Consultants08/02/19 - PHYSICALS81638EISENHOWER OCCUPATIONAL…101-1004-60104 665.00Recruiting/Pre-Employment08/02/19 - PHYSICALS81638EISENHOWER OCCUPATIONAL…101-1004-60129 1,461.00Landscape Contract08/2019 GENERAL MAINT LLMC PROJ 201…91590PWLC II, INC 101-2002-60112 45.48Telephone - Utilities08/2019 - LQ PARK PHONEAUG'193452951FRONTIER COMMUNICATIONS…101-3005-61300 313.20Life Insurance Pay08/2019 - LIFE INSURANCE/DISABILITYAUG'196430680001STANDARD INSURANCE COMP…101-0000-20947 2,723.82Disability Insurance Pay08/2019 - LIFE INSURANCE/DISABILITYAUG'196430680001STANDARD INSURANCE COMP…101-0000-20955 464.05Add'l Life Insurance Pay08/2019 - ADD'L LIFE INSURANCEAUG'196430680002STANDARD INSURANCE COMP…101-0000-20948 37.32Telephone - Utilities07/28-08/27/19 - SPORTS COMPLEX PHO…AUG'197713100FRONTIER COMMUNICATIONS…101-3005-61300 100.00Travel & Training07/19-08/01/19 - LEAGUE DINNERAUG'199721WELLS FARGO BUSINESS CARD 101-1001-60320 160.36LQ Police Volunteers07/19-08/01/19 - CADET ACADEMY FOODAUG'199721WELLS FARGO BUSINESS CARD 101-2001-60109 120.00Special Enforcement Funds07/19-08/01/19 - SPYPOINT POLICE CAME…AUG'199721WELLS FARGO BUSINESS CARD 101-2001-60175 273.78Travel & Training07/19-08/01/19 - HOTEL DEPOSITAUG'199721WELLS FARGO BUSINESS CARD 101-3007-60320 76.29Materials/Supplies08/08/19 - CITY HALL KEYSBB00533584LOCK SHOP INC, THE 101-3008-60431 857.21Water -Pioneer Park - Utilities08/02/19 - WATER SERVICECSW219COACHELLA VALLEY WATER DI…101-3005-61207 681.89Water - Utilities08/14/19 - WATER SERVICECSW221COACHELLA VALLEY WATER DI…101-2002-61200 2,981.77Water -Monticello Park - Utiliti…08/14/19 - WATER SERVICECSW221COACHELLA VALLEY WATER DI…101-3005-61201 117.92Water -Fritz Burns Park - Utiliti…08/14/19 - WATER SERVICECSW221COACHELLA VALLEY WATER DI…101-3005-61204 19.05Water -Seasons Park - Utilities08/14/19 - WATER SERVICECSW221COACHELLA VALLEY WATER DI…101-3005-61208 205.65Water -Community Park - Utilit…08/14/19 - WATER SERVICECSW221COACHELLA VALLEY WATER DI…101-3005-61209 115.18Water - Utilities08/14/19 - WATER SERVICECSW221COACHELLA VALLEY WATER DI…101-3008-61200 771.50Due to SunLine07/2019 - SUNLINE BUS PASSESINV03512SUNLINE TRANSIT AGENCY 101-0000-20305 -40.75Miscellaneous Revenue07/2019 - SUNLINE BUS PASSESINV03512SUNLINE TRANSIT AGENCY 101-0000-42301 1,603.33Marketing & Tourism Promoti…07/19-08/15/19 IN-THEATER ADVERTISINGINV-184349NATIONAL CINEMEDIA LLC 101-3007-60461 194.53Operating Supplies08/06/19 - WC FITPASS INKINV6301032ALPHA CARD 101-3002-60420 55.00Travel & Training07/31/19 - BILINGUAL TESTING - E HERNA…IS442300ALTA LANGUAGE SERVICES INC 101-1004-60320 30.14Gas - Utilities06/20-07/22/19 - FS #32 GAS SERVICEJUL'191208591246GAS COMPANY, THE 101-2002-61100 -68.94Administration06/28/19 - ADJ FRAUD (PRO FLOWERS)JUL'191640AWELLS FARGO BUSINESS CARD 101-1006-60102 42.46Gas - Utilities06/20-07/22/19 - CITY HALL GAS SVCJUL'192692565001GAS COMPANY, THE 101-3008-61100 73.26Gas - Utilities06/20-07/22/19 - WC GAS SERVICEJUL'199422738006GAS COMPANY, THE 101-3008-61100 35.49Supplies-Graffiti and Vandalism07/08-07/24/19 - EISENHOWER PK VAND…JUL'1998001580913LOWE'S HOME IMPROVEMENT…101-3005-60423 18.36Materials/Supplies07/08-07/24/19 - EISENHOWER PARK BOL…JUL'1998001580913LOWE'S HOME IMPROVEMENT…101-3005-60431 102.28Materials/Supplies07/08-07/24/19 - FB MATERIALSJUL'1998001580913LOWE'S HOME IMPROVEMENT…101-3008-60431 18.36Materials/Supplies07/08-07/24/19 - CITY HALL MATERIALSJUL'1998001580913LOWE'S HOME IMPROVEMENT…101-3008-60431 33.88Materials/Supplies07/08-07/24/19 - CITY HALL MATERIALSJUL'1998001580913LOWE'S HOME IMPROVEMENT…101-3008-60431 3.92Materials/Supplies07/08-07/24/19 - CITY HALLJUL'1998001580913LOWE'S HOME IMPROVEMENT…101-3008-60431 39.74Materials/Supplies07/08-07/24/19 - CITY HALL MATERIALSJUL'1998001580913LOWE'S HOME IMPROVEMENT…101-3008-60431 23.64Materials/Supplies07/08-07/24/19 - CITY HALL MATERIALSJUL'1998001580913LOWE'S HOME IMPROVEMENT…101-3008-60431 93.45Tools/Equipment07/08-07/24/19 - TOOLSJUL'1998001580913LOWE'S HOME IMPROVEMENT…101-3008-60432 239 Demand Register Packet: APPKT02094 - BC 08/16/19 8/16/2019 7:38:45 PM Page 4 of 11 AmountVendor Name Payable Number Description (Item)Account Name Account Number 47.42Operating Supplies07/08-07/24/19 - WATER COOLER 2 GALL…JUL'1998001580913LOWE'S HOME IMPROVEMENT…101-7003-60420 66.03Operating Supplies07/08-07/24/19 - WELDING SUPPLIESJUL'1998001580913LOWE'S HOME IMPROVEMENT…101-7003-60420 15.49Tools/Equipment07/08-07/24/19 -TOOLSJUL'1998001580913LOWE'S HOME IMPROVEMENT…101-7003-60432 -10.48Sales Taxes Payable07/24-07/31/19 - FIELD SUPPLIES SALES T…JULY'191640WELLS FARGO BUSINESS CARD 101-0000-20304 -2.54Sales Taxes Payable07/24-07/31/19 - FIELD SUPPLIES SALES T…JULY'191640WELLS FARGO BUSINESS CARD 101-0000-20304 -19.34Sales Taxes Payable07/24-07/31/19 - FIELD SUPPLIES SALES T…JULY'191640WELLS FARGO BUSINESS CARD 101-0000-20304 71.22Recruiting/Pre-Employment07/24-07/31/19 - CC ADMIN INTERVIEW …JULY'191640WELLS FARGO BUSINESS CARD 101-1004-60129 60.00Recruiting/Pre-Employment07/24-07/31/19 - BLDG INS II JOB ADJULY'191640WELLS FARGO BUSINESS CARD 101-1004-60129 41.66Administration07/24-07/31/19 - PAPA JOHN'SJULY'191640WELLS FARGO BUSINESS CARD 101-1006-60102 -41.66Administration07/24-07/31/19 - ADJ - FRAUDJULY'191640WELLS FARGO BUSINESS CARD 101-1006-60102 14.99Administration07/24-07/31/19 - APL ITUNESJULY'191640WELLS FARGO BUSINESS CARD 101-1006-60102 -14.99Administration07/24-07/31/19 - ADJ - FRAUDJULY'191640WELLS FARGO BUSINESS CARD 101-1006-60102 1,347.84Special Enforcement/Humana07/24-07/31/19 - HOTEL POLICE TRAININGJULY'191640WELLS FARGO BUSINESS CARD 101-2001-60165 722.40Travel & Training07/24-07/31/19 - TRAINING HOTELJULY'191640WELLS FARGO BUSINESS CARD 101-2002-60320 16.30Fire Station07/24-07/31/19 - FS #70 SUPPLIESJULY'191640WELLS FARGO BUSINESS CARD 101-2002-60670 31.62Supplies - Field07/24-07/31/19 - FIELD SUPPLIESJULY'191640WELLS FARGO BUSINESS CARD 101-6003-60425 359.81Supplies - Field07/24-07/31/19 - FIELD SUPPLIESJULY'191640WELLS FARGO BUSINESS CARD 101-6003-60425 23.63Supplies - Field07/24-07/31/19 - SHOE COVERS FOR INSP…JULY'191640WELLS FARGO BUSINESS CARD 101-6003-60425 240.38Supplies - Field07/24-07/31/19 - FIELD SUPPLIESJULY'191640WELLS FARGO BUSINESS CARD 101-6003-60425 72.80Operating Supplies07/24-07/31/19 - WATCHBOOK 2019JULY'191640WELLS FARGO BUSINESS CARD 101-7002-60420 79.90Travel & Training07/24-07/31/19 - ONLINE TRAININGJULY'191640WELLS FARGO BUSINESS CARD 101-7006-60320 145.61Operating Supplies07/24-07/31/19 - WATCHBOOK 2019JULY'191640WELLS FARGO BUSINESS CARD 101-7006-60420 3,150.00State Unemployment Insurance04/01-06/30/19 2ND QTR SU1 PAYMENTL1063546208EMPLOYMENT DEVELOPMENT…101-1004-50244 100.00Administrative Citations02/14/19-REFUND CITATION CASE #19-03…LQ160270ORTEGA, JESUS 101-0000-42700 100.00Administrative Citations06/18/18- REFUND CITATION CASE #18-1…LQ162003FIGUEROA, DAVID 101-0000-42700 500.00Administrative Citations05/28/19-REFUND CITATIONLQ162086BLUE COACHELLA, INC.101-0000-42700 100.00Administrative Citations03/12/19-REFUND CITATION CASE #19-05…LQA164064GARIBAY, ANTONIO OR FRANC…101-0000-42700 50.00Parking Violations12/28/18-REFUND CITATIONLQP170200LADIN, JIM 101-0000-42706 320.00Parking Violations12/31/18-REFUND CITATIONLQP26504VANCE, GERRY LEE 101-0000-42706 50.00Parking Violations03/10/19-REFUND CITATIONLQP26511KAMADA, KIMBERLY 101-0000-42706 50.00Parking Violations11/25/18-REFUND CITATIONLQP26614KHALAF, LISA 101-0000-42706 2,359.39Water -Fritz Burns Park - Utiliti…08/01/19 - WATER SERVICEPWW201COACHELLA VALLEY WATER DI…101-3005-61204 596.83Water - Utilities08/01/19 - WATER SERVICEPWW201COACHELLA VALLEY WATER DI…101-3008-61200 566.81Water -Desert Pride - Utilities08/14/19 - WATER SERVICEPWW203COACHELLA VALLEY WATER DI…101-3005-61206 39.55PM 10 - Dust Control08/14/19 - WATER SERVICEPWW203COACHELLA VALLEY WATER DI…101-7006-60146 40.00Cash Over/Short07/26/19 - LIC763961 REFUND OVERPYM…R51958MAHTABAN, JAMIE 101-0000-42300 50.62Tools/Equipment07/12/19 - INSULATED POP-UP BITS113417165.001WALTERS WHOLESALE ELECTR…101-7003-60432 437.99Materials/Supplies07/25/19 - CITY HALL MATERIALSS2657953.001DESERT ELECTRIC SUPPLY 101-3008-60431 1,000.00Auditors07/19/19- 18/19 AUDIT PLANNINGVT25376VAVRINEK, TRINE, DAY & CO., …101-1006-60106 Fund 101 - GENERAL FUND Total:153,050.65 Fund: 201 - GAS TAX FUND 179.43Safety Gear07/08/19 - SAFETY BOOTS J PALAFOX14905JERNIGAN'S, INC 201-7003-60427 206.61Safety Gear07/08/19 - SAFETY BOOTS B GONZALES14906JERNIGAN'S, INC 201-7003-60427 24.08Materials/Supplies08/2019 - CA STATE FEE DIG ALERT18DSBFEE3931UNDERGROUND SERVICE ALERT 201-7003-60431 1,295.85Uniforms07/25/19 - UNIFORMS33579358SERVICE WEAR APPAREL 201-7003-60690 95.80Materials/Supplies08/01/19 - DIG ALERT FEES720190383UNDERGROUND SERVICE ALERT 201-7003-60431 40.37Materials/Supplies07/08-07/24/19 - SIDEWALK REPAIRJUL'1998001580913LOWE'S HOME IMPROVEMENT…201-7003-60431 632.31Equipment Rental07/24-07/31/19 - CONCRETE ROTARY MIX…JULY'191640WELLS FARGO BUSINESS CARD 201-7003-61701 -440.00Equipment Rental07/24-07/31/19 - CONCRETE ROTARY DEP…JULY'191640WELLS FARGO BUSINESS CARD 201-7003-61701 Fund 201 - GAS TAX FUND Total:2,034.45 Fund: 202 - LIBRARY & MUSEUM FUND 404.86Operating Supplies8/15/19 - REPLACEMENT PART 3D PRINTER081519RAISE3D TECHNOLOGIES, INC.202-3004-60420 255.00Security & Alarm07/01-09/30/19 FIRE ALARM MONITORIN…77349ALARM MONITORING SERVICE…202-3004-60123 255.00Security & Alarm07/01-09/30/19 FIRE ALARM MONITORIN…77349ALARM MONITORING SERVICE…202-3006-60123 201.53Water - Utilities08/14/19 - WATER SERVICECSW221COACHELLA VALLEY WATER DI…202-3006-61200 250.00HVAC07/2019 - LIBRARY WATER TREATMENTI30991PACIFIC WEST AIR CONDITION…202-3004-60667 15.78Gas - Utilities06/20-07/22/19 - LIBRARY GAS SVCJUL'1915294440449GAS COMPANY, THE 202-3004-61100 Fund 202 - LIBRARY & MUSEUM FUND Total:1,382.17 240 Demand Register Packet: APPKT02094 - BC 08/16/19 8/16/2019 7:38:45 PM Page 5 of 11 AmountVendor Name Payable Number Description (Item)Account Name Account Number Fund: 215 - LIGHTING & LANDSCAPING FUND 173.99Safety Gear07/26/19 - SAFETY BOOTS A ARELLANO14064JERNIGAN'S, INC 215-7004-60427 6,349.83Consultants08/2019 LIGHTING MAINTENANCE SERVICE16891CREATIVE LIGHTING & ELECTR…215-7004-60104 139.67Safety Gear08/05/19 - SAFETY GEAR241166ASUMMIT SAFETY LLC 215-7004-60427 117.83Safety Gear08/01/19 - SAFETY GEAR241172ASUMMIT SAFETY LLC 215-7004-60427 338.72Uniforms07/25/19 - UNIFORMS33579358SERVICE WEAR APPAREL 215-7004-60690 142.09Materials/Supplies07/18/19 - MATERIALS & SUPPLIES3469167SMITH PIPE & SUPPLY CO 215-7004-60431 43.39Materials/Supplies07/22/19 - IRRIGATION PARTS3470697SMITH PIPE & SUPPLY CO 215-7004-60431 1,126.05Materials/Supplies07/31/19 - IRRIGATION MATERIALS595913HIGH TECH IRRIGATION INC 215-7004-60431 55,793.00Landscape Contract08/2019 GENERAL MAINT LLMC PROJ 201…91590PWLC II, INC 215-7004-60112 60.86Supplies-Graffiti and Vandalism07/08-07/24/19 - GRAFFITI SUPPLIESJUL'1998001580913LOWE'S HOME IMPROVEMENT…215-7004-60423 15.25Supplies-Graffiti and Vandalism07/08-07/24/19 - GRAFFITI REMOVALJUL'1998001580913LOWE'S HOME IMPROVEMENT…215-7004-60423 51.87Electric - Utilities08/01/19 - ELECTRICITY SERVICEPW218IMPERIAL IRRIGATION DIST 215-7004-61116 181.11Electric - Medians - Utilities08/01/19 - ELECTRICITY SERVICEPW218IMPERIAL IRRIGATION DIST 215-7004-61117 453.85Electric - Utilities08/16/19 - ELECTRICITY SERVICEPW219IMPERIAL IRRIGATION DIST 215-7004-61116 50.97Electric - Medians - Utilities08/16/19 - ELECTRICITY SERVICEPW219IMPERIAL IRRIGATION DIST 215-7004-61117 11,500.25Water - Medians - Utilities08/01/19 - WATER SERVICEPWW201COACHELLA VALLEY WATER DI…215-7004-61211 678.65Water - Medians - Utilities08/06/19 - WATER SERVICEPWW202COACHELLA VALLEY WATER DI…215-7004-61211 4,161.15Water - Medians - Utilities08/14/19 - WATER SERVICEPWW203COACHELLA VALLEY WATER DI…215-7004-61211 -7.83Materials/Supplies07/25/19 - L&L MATERIALSS113587721.002WALTERS WHOLESALE ELECTR…215-7004-60431 -6.09Materials/Supplies07/25/19 - L&L MATERIALSS113587817.002WALTERS WHOLESALE ELECTR…215-7004-60431 -7.83Materials/Supplies07/29/19 - L&L MATERIALSS113587887.002WALTERS WHOLESALE ELECTR…215-7004-60431 -2.61Materials/Supplies07/25/19 - L&L MATERIALSS113588095.002WALTERS WHOLESALE ELECTR…215-7004-60431 21.10Materials/Supplies07/25/19 - MATERIALSS113588197.002WALTERS WHOLESALE ELECTR…215-7004-60431 73.84Materials/Supplies07/25/19 - MATERIALSS113588275.002WALTERS WHOLESALE ELECTR…215-7004-60431 Fund 215 - LIGHTING & LANDSCAPING FUND Total:81,449.11 Fund: 221 - AB 939 - CALRECYCLE FUND 2,200.00AB 939 Recycling Solutions07/19-08/01/19 - RECYCLING CONFERENCEAUG'199721WELLS FARGO BUSINESS CARD 221-0000-60127 Fund 221 - AB 939 - CALRECYCLE FUND Total:2,200.00 Fund: 225 - INFRASTRUCTURE FUND 667.82Consultants, Fee Study07/2019 NBS DEVELOPMENT IMPACT FEE …719000161NBS 225-0000-60104 Fund 225 - INFRASTRUCTURE FUND Total:667.82 Fund: 227 - STATE HOMELAND SECURITY PROGRAMS (SHSP) 3,018.43SHSP Grant03/22-03/24/19- CERT TRAINING LQ SHSP …20190322COUNTY OF RIVERSIDE 227-0000-43120 Fund 227 - STATE HOMELAND SECURITY PROGRAMS (SHSP) Total:3,018.43 Fund: 237 - SUCCESSOR AGCY PA 1 ADMIN 1,650.00Consultants07/01/19-06/30/20 - 2014 BOND ADMIN …5435950US BANK 237-9001-60104 Fund 237 - SUCCESSOR AGCY PA 1 ADMIN Total:1,650.00 Fund: 241 - HOUSING AUTHORITY 41.39Travel & Training08/15/19 - REIMB HOUSING RECEPTION 7…081519THOMPSON, TERESA 241-9101-60320 7,248.50Professional Services07/2019 HOUSING COMPLIANCE AND M…91CAHA, BECKY 241-9101-60103 Fund 241 - HOUSING AUTHORITY Total:7,289.89 Fund: 250 - TRANSPORTATION DIF FUND 667.82Consultants, Fee Study07/2019 NBS DEVELOPMENT IMPACT FEE …719000161NBS 250-0000-60104 Fund 250 - TRANSPORTATION DIF FUND Total:667.82 Fund: 251 - PARKS & REC DIF FUND 667.82Consultants, Fee Study07/2019 NBS DEVELOPMENT IMPACT FEE …719000161NBS 251-0000-60104 Fund 251 - PARKS & REC DIF FUND Total:667.82 Fund: 252 - CIVIC CENTER DIF FUND 668.43Consultants, Fee Study07/2019 NBS DEVELOPMENT IMPACT FEE …719000161NBS 252-0000-60104 Fund 252 - CIVIC CENTER DIF FUND Total:668.43 Fund: 253 - LIBRARY DEVELOPMENT DIF 667.82Consultants, Fee Study07/2019 NBS DEVELOPMENT IMPACT FEE …719000161NBS 253-0000-60104 Fund 253 - LIBRARY DEVELOPMENT DIF Total:667.82 Fund: 254 - COMMUNITY CENTER DIF 667.82Consultants, Fee Study07/2019 NBS DEVELOPMENT IMPACT FEE …719000161NBS 254-0000-60104 Fund 254 - COMMUNITY CENTER DIF Total:667.82 241 Demand Register Packet: APPKT02094 - BC 08/16/19 8/16/2019 7:38:45 PM Page 6 of 11 AmountVendor Name Payable Number Description (Item)Account Name Account Number Fund: 255 - STREET FACILITY DIF FUND 667.82Consultants, Fee Study07/2019 NBS DEVELOPMENT IMPACT FEE …719000161NBS 255-0000-60104 Fund 255 - STREET FACILITY DIF FUND Total:667.82 Fund: 256 - PARK FACILITY DIF FUND 667.82Consultants, Fee Study07/2019 NBS DEVELOPMENT IMPACT FEE …719000161NBS 256-0000-60104 Fund 256 - PARK FACILITY DIF FUND Total:667.82 Fund: 257 - FIRE PROTECTION DIF 667.82Consultants, Fee Study07/2019 NBS DEVELOPMENT IMPACT FEE …719000161NBS 257-0000-60104 Fund 257 - FIRE PROTECTION DIF Total:667.82 Fund: 401 - CAPITAL IMPROVEMENT PROGRAMS 3,600.00Construction08/13/19 - CVWD CONST INSP DEP LQ VIL…081319COACHELLA VALLEY WATER DI…401-0000-60188 6,284.92Design06/2019 SRR PHASE II INFRASTRUCTURE P…1055351MICHAEL BAKER INTERNATIO…401-0000-60185 2,000.00Design06/2019 SRR PHASE II INFRASTRUCTURE P…1055354MICHAEL BAKER INTERNATIO…401-0000-60185 500.00Land Acquisition07/31/19 - PRELIM REPORT 492184105831STEWART TITLE OF CALIFORNI…401-0000-74010 500.00Land Acquisition07/31/19 - PRELIM REPORT 492282105851STEWART TITLE OF CALIFORNI…401-0000-74010 800.00Land Acquisition07/31/19 - PRELIM REPORT 492423105862STEWART TITLE OF CALIFORNI…401-0000-74010 10,433.38Construction07/22/19 STREET NAME SIGN BODIES ONLY106113JTB SUPPLY CO., INC.401-0000-60188 500.00Land Acquisition08/05/19 - PRELIM REPORT 492258106718STEWART TITLE OF CALIFORNI…401-0000-74010 270.00Land Acquisition08/09/19 - PRELIM REPORT 494785107918STEWART TITLE OF CALIFORNI…401-0000-74010 270.00Land Acquisition08/09/19 - PRELIM REPORT 494785107918STEWART TITLE OF CALIFORNI…401-0000-74010 7,631.00Construction07/25/19 - EISENHOWER MEDIAN CONDU…2179KRIBBS, BRUCE 401-0000-60188 -13,508.72Retention PayablePO 1819-0145-R1 RETENTION #22JACOBSSON ENGINEERING CO…401-0000-20600 270,174.50Construction07/31/19 PROG PMT 2 2009-04 DUNE PA…2JACOBSSON ENGINEERING CO…401-0000-60188 -728.17Retention PayablePO 1920-0075 RETENTION30360UNITED PAVING CO.401-0000-20600 14,563.45Construction2018-07 PMP FY 1819 AVE 52 REHAB AND…30360UNITED PAVING CO.401-0000-60188 4,148.75Technical07/01-07/12/19 EISENHOWER RET BASIN …4810CRM TECH 401-0000-60108 5,860.00Technical07/15-07/26/19 EISENHOWER RET BASIN …4827CRM TECH 401-0000-60108 150.78Construction07/25/19 - 2016-08 BID SET (SPECS)877238PLANIT REPROGRAPHICS SYST…401-0000-60188 3,288.28Construction07/29/19 - 2015-03 CONSTRUCTION SET877365PLANIT REPROGRAPHICS SYST…401-0000-60188 1,356.10Construction07/31/19 - 2016-08 BID SET (PLANS)877471PLANIT REPROGRAPHICS SYST…401-0000-60188 13.40Construction07/08-07/24/19 - CONDUIT EMT MADISO…JUL'1998001580913LOWE'S HOME IMPROVEMENT…401-0000-60188 2,268.00Technical07/11-07/24/19 EISENHOWER BASIN MAT…LP0819-11LANDMARK GEO-ENGINEERS &…401-0000-60108 1,717.99Construction07/26/19 - SOLAR BEACON AVE 60NEX19-215NEXTECH 401-0000-60188 1,180.00Construction08/08/19 - CONDUIT REPAIRSS113714023.001WALTERS WHOLESALE ELECTR…401-0000-60188 40.05Construction07/16/19 - EISENHOWER MEDIAN CONDU…S2657702.001DESERT ELECTRIC SUPPLY 401-0000-60188 2,090.69Construction07/22/19 - EISENHOWER MEDIAN CONDU…S2659377.001DESERT ELECTRIC SUPPLY 401-0000-60188 Fund 401 - CAPITAL IMPROVEMENT PROGRAMS Total:325,404.40 Fund: 501 - FACILITY & FLEET REPLACEMENT 543.00Car Washes06/21-06/22/19- VEHICLE'S WASH250RAN AUTO DETAIL 501-0000-60148 563.00Vehicle Repair & Maintenance08/02-08/03-19 R.A.N. AUTO WASH253RAN AUTO DETAIL 501-0000-60676 327.45Motorcycle Repair & Mainten…07/31/19 - POLICE MOTORCOP SERVICE6022406/1BMW MOTORCYCLES OF RIVE…501-0000-60679 15.63Street Sweeper07/08-07/24/19 - SWEEPER TRUCKJUL'1998001580913LOWE'S HOME IMPROVEMENT…501-0000-60678 16.39Street Sweeper07/08-07/24/19 - STREET SWEEPER MAINTJUL'1998001580913LOWE'S HOME IMPROVEMENT…501-0000-60678 1,105.86Fuel & Oil07/2019 - FUEL CHARGESNP56711745FUELMAN 501-0000-60674 Fund 501 - FACILITY & FLEET REPLACEMENT Total:2,571.33 Fund: 502 - INFORMATION TECHNOLOGY 2,492.40Telephone - Utilities07/23-08/22/19 - PHONE LINE SVC119143031-0TPX COMMUNICATIONS 502-0000-61300 140.16Cable - Utilities07/15-08/14/19 - WC CABLE SVC (8105)18105080319TIME WARNER CABLE 502-0000-61400 18,900.00Consultants08/2019 - ENTERPRISE SVC EQPT & 1 RES…2151141CONVERGEONE, INC 502-0000-60104 120,995.00D & D, Software Enhancements07/16/19 CENTRACS ATMS SOFTWARE28285ECONOLITE CONTROL PRODU…502-0000-71042 247.88Cable - Utilities07/24-08/23/19 0 WC CABLE (4601)504601072419TIME WARNER CABLE 502-0000-61400 25.91Consultants07/2019 MONOPRICE 7-PORT USB ADAPT…52154ACORN TECHNOLOGY SERVICES 502-0000-60104 30,050.00Consultants08/2019 IT SERVICES NETWORK ADMIN &…52165ACORN TECHNOLOGY SERVICES 502-0000-60104 8.83Cable - Utilities07/20-08/19/19 - WC CABLE (1909)61909072019TIME WARNER CABLE 502-0000-61400 1,694.81Comm. Resources, Software E…07/19/19 - WC EXTERNAL HARDWARE63379VERMONT SYSTEMS INC 502-0000-71043 11,058.41Comm. Resources, Software E…08/07/19 FY 1920 RECREATION SOFTWAR…63493VERMONT SYSTEMS INC 502-0000-71043 808.50Comm. Resources, Software E…08/07/19 - WC TOPAZ EXTERNAL HARDW…63494VERMONT SYSTEMS INC 502-0000-71043 95.01Cable - Utilities07/25-08/24/19 - CITY HALL INTERNETAUG'191693171FRONTIER COMMUNICATIONS…502-0000-61400 23.91Computers07/24-07/31/19 - IPAD CHARGING CORDJULY'191640WELLS FARGO BUSINESS CARD 502-0000-80103 242 Demand Register Packet: APPKT02094 - BC 08/16/19 8/16/2019 7:38:45 PM Page 7 of 11 AmountVendor Name Payable Number Description (Item)Account Name Account Number 200.00Consultants08/06/19 - COUNCIL MTG VIDEOPR646-0819DESERT C.A.M INC 502-0000-60104 Fund 502 - INFORMATION TECHNOLOGY Total:186,740.82 Fund: 601 - SILVERROCK RESORT 648.65Bank Fees08/2019 - SSR ARMORED SERVICES10503772GARDAWORLD 601-0000-60455 Fund 601 - SILVERROCK RESORT Total:648.65 Grand Total:773,450.89 243 Demand Register Packet: APPKT02094 - BC 08/16/19 8/16/2019 7:38:45 PM Page 8 of 11 Fund Summary Fund Expense Amount 101 - GENERAL FUND 153,050.65 201 - GAS TAX FUND 2,034.45 202 - LIBRARY & MUSEUM FUND 1,382.17 215 - LIGHTING & LANDSCAPING FUND 81,449.11 221 - AB 939 - CALRECYCLE FUND 2,200.00 225 - INFRASTRUCTURE FUND 667.82 227 - STATE HOMELAND SECURITY PROGRAMS (SHSP)3,018.43 237 - SUCCESSOR AGCY PA 1 ADMIN 1,650.00 241 - HOUSING AUTHORITY 7,289.89 250 - TRANSPORTATION DIF FUND 667.82 251 - PARKS & REC DIF FUND 667.82 252 - CIVIC CENTER DIF FUND 668.43 253 - LIBRARY DEVELOPMENT DIF 667.82 254 - COMMUNITY CENTER DIF 667.82 255 - STREET FACILITY DIF FUND 667.82 256 - PARK FACILITY DIF FUND 667.82 257 - FIRE PROTECTION DIF 667.82 401 - CAPITAL IMPROVEMENT PROGRAMS 325,404.40 501 - FACILITY & FLEET REPLACEMENT 2,571.33 502 - INFORMATION TECHNOLOGY 186,740.82 601 - SILVERROCK RESORT 648.65 Grand Total:773,450.89 Account Summary Account Number Account Name Expense Amount 101-0000-20304 Sales Taxes Payable -58.89 101-0000-20305 Due to SunLine 771.50 101-0000-20306 BSAS SB 1473 Fees 1,670.00 101-0000-20330 Over Payments, AR Policy 45.00 101-0000-20943 Dental Insurance Pay 8,631.95 101-0000-20947 Life Insurance Pay 313.20 101-0000-20948 Add'l Life Insurance Pay 464.05 101-0000-20955 Disability Insurance Pay 2,723.82 101-0000-42300 Cash Over/Short 40.00 101-0000-42301 Miscellaneous Revenue -40.75 101-0000-42615 CBSC Administrative Fees -167.00 101-0000-42700 Administrative Citations 800.00 101-0000-42706 Parking Violations 470.00 101-1001-60320 Travel & Training 415.40 101-1001-60420 Operating Supplies 32.61 101-1002-60320 Travel & Training 121.86 101-1004-50244 State Unemployment Insu…3,150.00 101-1004-60104 Consultants 580.00 101-1004-60129 Recruiting/Pre-Employme…1,274.97 101-1004-60320 Travel & Training 55.00 101-1004-60322 Training & Education/MOU 282.25 101-1004-60340 Employee Recognition Ev…25.60 101-1005-60400 Office Supplies 60.30 101-1005-60420 Operating Supplies 22.42 101-1006-60102 Administration -68.94 101-1006-60103 Professional Services 2,503.12 101-1006-60106 Auditors 1,000.00 101-1006-60320 Travel & Training 213.57 101-1006-60351 Membership Dues 95.00 101-1006-60352 Subscriptions & Publicati…645.00 101-1006-60400 Office Supplies 38.05 101-1007-60403 Citywide Conf Room Suppl…448.98 101-1007-60661 Postage Machine 15.22 101-1007-74010 Land Acquisition 2,400.00 244 Demand Register Packet: APPKT02094 - BC 08/16/19 8/16/2019 7:38:45 PM Page 9 of 11 Account Summary Account Number Account Name Expense Amount 101-2001-60109 LQ Police Volunteers 179.61 101-2001-60165 Special Enforcement/Hu…2,202.56 101-2001-60168 School Officer 10,460.48 101-2001-60174 Blood/Alcohol Testing 75.00 101-2001-60175 Special Enforcement Funds 812.03 101-2002-60110 Volunteers - Fire 13.99 101-2002-60112 Landscape Contract 1,461.00 101-2002-60320 Travel & Training 738.39 101-2002-60400 Office Supplies 136.70 101-2002-60670 Fire Station 526.30 101-2002-60691 Maintenance/Services 575.00 101-2002-61100 Gas - Utilities 30.14 101-2002-61200 Water - Utilities 681.89 101-2002-61300 Telephone - Utilities 1,298.48 101-2002-61400 Cable - Utilities 278.92 101-3001-60420 Operating Supplies 15.23 101-3002-60107 Instructors 2,582.88 101-3002-60400 Office Supplies -104.38 101-3002-60420 Operating Supplies 1,151.71 101-3003-60122 Credit Card Fees 20.00 101-3003-60149 Community Experiences 2,670.03 101-3005-60117 Civic Center Lake Mainten…2,700.00 101-3005-60184 Fritz Burns Pool 3,682.58 101-3005-60400 Office Supplies 35.29 101-3005-60423 Supplies-Graffiti and Van…2,882.99 101-3005-60431 Materials/Supplies 2,121.79 101-3005-60554 LQ Park Water Feature 1,402.26 101-3005-60690 Uniforms 357.64 101-3005-60691 Maintenance/Services 1,519.00 101-3005-61201 Water -Monticello Park - …2,981.77 101-3005-61204 Water -Fritz Burns Park - …2,477.31 101-3005-61206 Water -Desert Pride - Utili…566.81 101-3005-61207 Water -Pioneer Park - Utili…857.21 101-3005-61208 Water -Seasons Park - Util…19.05 101-3005-61209 Water -Community Park -…205.65 101-3005-61300 Telephone - Utilities 82.80 101-3007-60320 Travel & Training 273.78 101-3007-60461 Marketing & Tourism Pro…6,453.33 101-3008-60123 Security & Alarm 510.00 101-3008-60427 Safety Gear 206.61 101-3008-60431 Materials/Supplies 1,124.51 101-3008-60432 Tools/Equipment 93.45 101-3008-60667 HVAC 2,752.00 101-3008-60690 Uniforms 338.72 101-3008-60691 Maintenance/Services 2,280.00 101-3008-61100 Gas - Utilities 115.72 101-3008-61200 Water - Utilities 755.75 101-6001-60102 Administration 20.00 101-6001-60320 Travel & Training 33.00 101-6001-60420 Operating Supplies 39.97 101-6002-60103 Professional Services 30,375.00 101-6002-60320 Travel & Training 33.00 101-6003-60425 Supplies - Field 655.44 101-6004-60111 Administrative Citation Se…1,215.70 101-6004-60120 Lot Cleaning/Gravel Progr…300.00 101-6004-60125 Temporary Agency Servic…762.24 101-6004-60400 Office Supplies 191.96 101-6006-60125 Temporary Agency Servic…1,072.86 245 Demand Register Packet: APPKT02094 - BC 08/16/19 8/16/2019 7:38:45 PM Page 10 of 11 Account Summary Account Number Account Name Expense Amount 101-6006-60420 Operating Supplies 348.00 101-7002-60420 Operating Supplies 72.80 101-7003-60420 Operating Supplies 113.45 101-7003-60432 Tools/Equipment 66.11 101-7006-60144 Contract Traffic Engineer 25,504.00 101-7006-60146 PM 10 - Dust Control 172.92 101-7006-60320 Travel & Training 254.90 101-7006-60420 Operating Supplies 145.61 101-7006-60427 Safety Gear 98.42 201-7003-60427 Safety Gear 386.04 201-7003-60431 Materials/Supplies 160.25 201-7003-60690 Uniforms 1,295.85 201-7003-61701 Equipment Rental 192.31 202-3004-60123 Security & Alarm 255.00 202-3004-60420 Operating Supplies 404.86 202-3004-60667 HVAC 250.00 202-3004-61100 Gas - Utilities 15.78 202-3006-60123 Security & Alarm 255.00 202-3006-61200 Water - Utilities 201.53 215-7004-60104 Consultants 6,349.83 215-7004-60112 Landscape Contract 55,793.00 215-7004-60423 Supplies-Graffiti and Van…76.11 215-7004-60427 Safety Gear 431.49 215-7004-60431 Materials/Supplies 1,382.11 215-7004-60690 Uniforms 338.72 215-7004-61116 Electric - Utilities 505.72 215-7004-61117 Electric - Medians - Utiliti…232.08 215-7004-61211 Water - Medians - Utilities 16,340.05 221-0000-60127 AB 939 Recycling Solutions 2,200.00 225-0000-60104 Consultants, Fee Study 667.82 227-0000-43120 SHSP Grant 3,018.43 237-9001-60104 Consultants 1,650.00 241-9101-60103 Professional Services 7,248.50 241-9101-60320 Travel & Training 41.39 250-0000-60104 Consultants, Fee Study 667.82 251-0000-60104 Consultants, Fee Study 667.82 252-0000-60104 Consultants, Fee Study 668.43 253-0000-60104 Consultants, Fee Study 667.82 254-0000-60104 Consultants, Fee Study 667.82 255-0000-60104 Consultants, Fee Study 667.82 256-0000-60104 Consultants, Fee Study 667.82 257-0000-60104 Consultants, Fee Study 667.82 401-0000-20600 Retention Payable -14,236.89 401-0000-60108 Technical 12,276.75 401-0000-60185 Design 8,284.92 401-0000-60188 Construction 316,239.62 401-0000-74010 Land Acquisition 2,840.00 501-0000-60148 Car Washes 543.00 501-0000-60674 Fuel & Oil 1,105.86 501-0000-60676 Vehicle Repair & Mainte…563.00 501-0000-60678 Street Sweeper 32.02 501-0000-60679 Motorcycle Repair & Main…327.45 502-0000-60104 Consultants 49,175.91 502-0000-61300 Telephone - Utilities 2,492.40 502-0000-61400 Cable - Utilities 491.88 502-0000-71042 D & D, Software Enhance…120,995.00 502-0000-71043 Comm. Resources, Softwa…13,561.72 502-0000-80103 Computers 23.91 246 Demand Register Packet: APPKT02094 - BC 08/16/19 8/16/2019 7:38:45 PM Page 11 of 11 Account Summary Account Number Account Name Expense Amount 601-0000-60455 Bank Fees 648.65 Grand Total:773,450.89 Project Account Summary Project Account Key Expense Amount **None**414,969.44 091004CT 270,174.50 091004RP -13,508.72 141513D 6,284.92 151603CT 6,888.28 151609L 270.00 151612CT 10,941.74 151612L 270.00 151612T 12,276.75 1920PMPCT 14,563.45 1920PMPRP -728.17 1920TMICT 12,164.77 201608CT 1,506.88 201608D 2,000.00 201701L 2,300.00 201823E 30,375.00 CSA152E 32.02 GOLFE 2,670.03 Grand Total:773,450.89 247 8/22/2019 11:18:35 AM Page 1 of 5 Demand Register City of La Quinta Packet: APPKT02103 - BC 08/23/19 AmountVendor Name Payable Number Description (Item)Account Name Account Number Fund: 101 - GENERAL FUND 162.00Garnishments PayableGARNISHMENT0002001-2RIVERSIDE COUNTY SHERIFF'S …101-0000-20985 349.31Garnishments PayableGARNISHMENT0002002-2EMPLOYMENT DEVELOPMENT…101-0000-20985 196.05LT Care Insurance PayLONG TERM CARE0002012CALPERS LONG-TERM CARE P…101-0000-20949 92.00United Way DeductionsCONTRIBUTION0002013UNITED WAY OF THE DESERT 101-0000-20981 162.00Garnishments PayableGARNISHMENT0002014RIVERSIDE COUNTY SHERIFF'S …101-0000-20985 310.97Garnishments PayableGARNISHMENT0002015EMPLOYMENT DEVELOPMENT…101-0000-20985 3,800.00Maintenance/Services08/19/19 - SPORTS COMPLEX PAINT EXTER…081919NAVA, FRANCISCO JIMENEZ 101-3008-60691 42,000.00Buildings08/20/19 - CUBE DESIGN & ENG INTERIOR…082019ALONGI EBENISTERIE ET GC INC 101-1007-71050 546.33Administrative Citation Services07/2019 - POLICE CITATION PROCESSING103580DATA TICKET, INC.101-6004-60111 895.00Marketing & Tourism Promoti…08/14-09/10/19 PS AIRPORT ADVERTISING110555304THE LAMAR COMPANIES 101-3007-60461 84.22Citywide Conf Room Supplies08/09/19 - CITY WIDE DRINKING WATER15369616080919SPARKLETTS 101-1007-60403 6,360.84LQ Park Water Feature08/15/19 - LQ PARK WF PUMP REPLACEM…18SHARK POOLS INC 101-3005-60554 550.00Subscriptions & Publications08/13/19 - CAFR 1819 STATS PACKAGE19081304CALIFORNIA MUNICIPAL STATI…101-1006-60352 760.61Printing07/12/19 - FY19/20 BUDGET PRINTING19-32451XPRESS GRAPHICS 101-1006-60410 227.79Printing07/15/19 - FY 19/20 BUDGET PRINTING19-32474XPRESS GRAPHICS 101-1006-60410 448.71Safety Gear08/07/19 - TRAFFIC SHIRTS241172BSUMMIT SAFETY LLC 101-7006-60427 955.42Advertising06/26-7/26/19 - MFS PUBLIC HEARING #4…2676616DESERT SUN PUBLISHING, LLC 101-1005-60450 462.00Advertising06/26-7/26/19 - CC PHN APPEAL 2019-00…2676616DESERT SUN PUBLISHING, LLC 101-6002-60450 1,500.00Veterinary Service08/10/19 - SNIP CLINIC3299SPAY NEUTER IMPERATIVE PR…101-6004-60194 190.53Uniforms08/06/19 - UNIFORMS TRAFFIC33653937SERVICE WEAR APPAREL 101-7006-60690 374.01Forms, Copier Paper08/09/19 - CITY WIDE COPY PAPER 8 1/2 X…3421776117STAPLES ADVANTAGE 101-1007-60402 95.50Operating Supplies08/17/19 - OFFICE SUPPLIES3422545465STAPLES ADVANTAGE 101-6001-60420 18.53Office Supplies08/14/19 - OFFICE SUPPLIES361848712001OFFICE DEPOT 101-1005-60400 125.66Maintenance/Services07/16/19 - FIRE SUPPRESSION SYS SVC - …5201855DESERT FIRE EXTINGUISHER C…101-3008-60691 993.46Temporary Agency Services05/24/19 - HR TEMP SVCS A LISTON53518660AOFFICE TEAM 101-1004-60125 875.20Temporary Agency Services05/24/19 - CITY CLERK TEMP SVCS A FELIX53518753AOFFICE TEAM 101-1005-60125 1,174.03Temporary Agency Services05/24/19 - HB TEMP SVCS M GONZALEZ53536436AROBERT HALF TECHNOLOGY 101-6006-60125 952.80Temporary Agency Services05/24/19 - CODE TEMP SVCS C HARGENS53541989AOFFICE TEAM 101-6004-60125 386.24Temporary Agency Services05/31/19 - FINANCE TEMP SVCS A CAMA…53556996AACCOUNTEMPS 101-1006-60125 100.00Sheriff - Other08/12/19 - POLICE TOW LA19212005054361CLASSIC AUTO TRANSPORT 101-2001-60176 630.00Plan Checks04/2019 ON CALL BUILDING PLAN CHECK …57776-INESGIL CORPORATION 101-6003-60118 28.24Postage08/09/19 - OVERNIGHT MAIL6-701-86941FEDEX 101-1007-60470 9,292.20Marketing & Tourism Promoti…JULY-AUG 2019 DIGITAL7028JNS MEDIA SPECIALISTS 101-3007-60461 55.00Blood/Alcohol Testing07/15/19 - BLOOD/ALCOHOL ANALYSIS72374AMERICAN FORENSIC NURSES …101-2001-60174 3,000.00Professional Services07/2019 STVRP COMPLIANCE SERVICES759VACATION RENTAL COMPLIAN…101-6006-60103 238.06Uniforms08/12/19 - SILK SCREEN SAFETY VEST801CLQSV-FAPALMS TO PINES PRINTING 101-6003-60690 746.48Marketing & Tourism Promoti…08/19/19 - 9/11 EVENT PROMO819CLQP-FAPALMS TO PINES PRINTING 101-3007-60461 12.31Postage08/03/19 - OVERNIGHT MAIL8959452ONTRAC 101-1007-60470 284.62Citywide Conf Room Supplies08/12/19 - CITY WIDE COFFEE951399DAIOHS FIRST CHOICE SERVICES 101-1007-60403 1,603.33Marketing & Tourism Promoti…08/16-09/12/19 IN-THEATER ADVERTISINGINV-185061NATIONAL CINEMEDIA LLC 101-3007-60461 45.00Sales Taxes Payable07/2019 SALES/USE TAXJUL'19SILVERROCK RESORT 101-0000-20304 8.00Technical07/2019 - RECORD FEES CODE 2019-0262…JUL'19RIVERSIDE ASSESSOR 101-6004-60108 8.00Technical07/2019 - RECORD FEES CODE 2019-0277…JUL'19RIVERSIDE ASSESSOR 101-6004-60108 584.63Maintenance/Services06/28-07/25/19 - COMPRESSOR FS #70JUL'198768HOME DEPOT CREDIT SERVICES 101-2002-60691 21.08Maintenance/Services06/28-07/25/19 - FS #70 MATERIALSJUL'198768HOME DEPOT CREDIT SERVICES 101-2002-60691 64.95Supplies-Graffiti and Vandalism06/28-07/25/19 - GRAFFITI SUPPLIESJUL'198768HOME DEPOT CREDIT SERVICES 101-3005-60423 37.91Materials/Supplies06/28-07/25/19 - LIGHT FIXTURE MAT'LSJUL'198768HOME DEPOT CREDIT SERVICES 101-3005-60431 85.44Materials/Supplies06/28-07/25/19 - CLEAN LIGHTS PEDESTA…JUL'198768HOME DEPOT CREDIT SERVICES 101-3005-60431 7.14Materials/Supplies06/28-07/25/19 - KEYS PUMP HOUSE CIV …JUL'198768HOME DEPOT CREDIT SERVICES 101-3005-60431 11.35Materials/Supplies06/28-07/25/19 - CITY HALL MATERIALSJUL'198768HOME DEPOT CREDIT SERVICES 101-3008-60431 17.70Materials/Supplies06/28-07/25/19 - WC MATERIALSJUL'198768HOME DEPOT CREDIT SERVICES 101-3008-60431 27.14Materials/Supplies06/28-07/25/19 - CITY HALL MAT'LSJUL'198768HOME DEPOT CREDIT SERVICES 101-3008-60431 71.62Materials/Supplies06/28-07/25/19 - LQ PARK MAT'LSJUL'198768HOME DEPOT CREDIT SERVICES 101-3008-60431 248 Demand Register Packet: APPKT02103 - BC 08/23/19 8/22/2019 11:18:35 AM Page 2 of 5 AmountVendor Name Payable Number Description (Item)Account Name Account Number 2,440.24Materials/Supplies06/28-07/25/19 - LQ PARK PARTITIONSJUL'198768HOME DEPOT CREDIT SERVICES 101-3008-60431 91.15Materials/Supplies06/28-07/25/19 - MATERIALSJUL'198768HOME DEPOT CREDIT SERVICES 101-3008-60431 432.83Tools/Equipment06/28-07/25/19 - MILWAUKEE M12 DRILL …JUL'198768HOME DEPOT CREDIT SERVICES 101-3008-60432 56.44Tools/Equipment06/28-07/25/19 - HEAVY DUTY RATCHETJUL'198768HOME DEPOT CREDIT SERVICES 101-3008-60432 416.55Tools/Equipment06/28-07/25/19 - TOOLSJUL'198768HOME DEPOT CREDIT SERVICES 101-3008-60432 78.09Operating Supplies06/28-07/25/19 - MAINTENANCE OPSJUL'198768HOME DEPOT CREDIT SERVICES 101-7003-60420 6.06Operating Supplies06/28-07/25/19 - MATERIALS OPSJUL'198768HOME DEPOT CREDIT SERVICES 101-7003-60420 20.61Operating Supplies06/28-07/25/19 - BOLTS SLEEVE MAT'LSJUL'198768HOME DEPOT CREDIT SERVICES 101-7003-60420 32.59Operating Supplies06/28-07/25/19 - MAINTENANCE OPSJUL'198768HOME DEPOT CREDIT SERVICES 101-7003-60420 87.28Operating Supplies06/28-07/25/19 - WELDING SUPPLIESJUL'198768HOME DEPOT CREDIT SERVICES 101-7003-60420 63.52Subscriptions & Publications09/2019 - CITY HALL NEWSPAPERSEP'19DS0155030DESERT SUN, THE 101-6001-60352 3,000.00Technical03/13/20 - SIA AWARDS/SPONSORSHIPSIA2020-006RAP FOUNDATION/SENIOR IN…101-3002-60108 Fund 101 - GENERAL FUND Total:88,754.77 Fund: 201 - GAS TAX FUND 21.86Materials/Supplies06/28-07/25/19 - CONCRETE MATERIALSJUL'198768HOME DEPOT CREDIT SERVICES 201-7003-60431 7.29Materials/Supplies06/28-07/25/19 - SIDEWALK CONCRETE …JUL'198768HOME DEPOT CREDIT SERVICES 201-7003-60431 7.40Materials/Supplies06/28-07/25/19 - SIDEWALK CONCRETE …JUL'198768HOME DEPOT CREDIT SERVICES 201-7003-60431 54.31Materials/Supplies06/28-07/25/19 - CONCRETE ADHESIVEJUL'198768HOME DEPOT CREDIT SERVICES 201-7003-60431 33.41Materials/Supplies06/28-07/25/19 - SIDEWALK REPAIR MAT'…JUL'198768HOME DEPOT CREDIT SERVICES 201-7003-60431 266.48Materials/Supplies06/28-07/25/19 - CONCRETEJUL'198768HOME DEPOT CREDIT SERVICES 201-7003-60431 Fund 201 - GAS TAX FUND Total:390.75 Fund: 215 - LIGHTING & LANDSCAPING FUND 28.71Supplies-Graffiti and Vandalism06/28-07/25/19 - GRAFFITI SUPPLIESJUL'198768HOME DEPOT CREDIT SERVICES 215-7004-60423 87.77Materials/Supplies06/28-07/25/19 - MAT'LS EISENHOWER & …JUL'198768HOME DEPOT CREDIT SERVICES 215-7004-60431 Fund 215 - LIGHTING & LANDSCAPING FUND Total:116.48 Fund: 248 - SA 2004 LO/MOD BOND FUND (Refinanced in 2014) 387.02Relocation Benefits07/30/19 - FINAL WSA PROP MGR UNIT 1…073019MEDITERRA APARTMENT HO…248-9102-60159 Fund 248 - SA 2004 LO/MOD BOND FUND (Refinanced in 2014) Total:387.02 Fund: 250 - TRANSPORTATION DIF FUND 33,268.00Developer Reimbursements08/20/19 - DIF REIMB PMT #3 RAISED LA…082019WALMART STORES, INC C/O B…250-0000-80105 30,356.00Developer Reimbursements08/20/19 - DIF REIMB FINAL MEDIAN IMPR…082019LENNAR HOMES OF CALIFORN…250-0000-80105 51,750.00Developer Reimbursements08/20/19 - DIF REIMB PMT#3 AVE 52 TO 5…082019AEAST OF MADISON LLC 250-0000-80105 25,875.00Developer Reimbursements08/20/19 - DIF REIMB PMT #3 MEDIAN IM…082019ATOLL BROS., INC.250-0000-80105 40,661.00Developer Reimbursements08/20/19 - DIF REIMB PMT #3 AVE 52 TO …082019AND LA QUINTA PARTNERS LLC 250-0000-80105 48,054.00Developer Reimbursements08/20/19 - DIF REIMB PMT #3 MEDIAN IM…082019BTOLL BROS., INC.250-0000-80105 40,661.00Developer Reimbursements08/20/19 - DIF REIMB PMT#3 ST IMPROV …082019BEAST OF MADISON LLC 250-0000-80105 66,536.00Developer Reimbursements08/20/19 - DIF REIMB PMT#3 AVE 52 RAIS…082019BND LA QUINTA PARTNERS LLC 250-0000-80105 62,839.00Developer Reimbursements08/20/19 - DIF REIMB PMT #3 RAISED ME…082019CEAST OF MADISON LLC 250-0000-80105 Fund 250 - TRANSPORTATION DIF FUND Total:400,000.00 Fund: 401 - CAPITAL IMPROVEMENT PROGRAMS 1,252.50Land Acquisition08/20/19 - RELOC MOVING FUNDS PYMT …082019ROBLES, HILDA 401-0000-74010 1,252.50Land Acquisition08/20/19 - RELOC MOVING FUNDS PYMT …082019AROBLES, HILDA 401-0000-74010 26,783.65Design11/2018-04/2019 SRR PHASE II INFRASTR …1049513MICHAEL BAKER INTERNATIO…401-0000-60185 1,660.56Construction08/15/19 - SPARE POWER PEDESTAL106189JTB SUPPLY CO., INC.401-0000-60188 1,625.80Construction06/26-7/26/19 - 2016-02 BID AD #36450102676616DESERT SUN PUBLISHING, LLC 401-0000-60188 1,256.20Construction06/26-7/26/19 - 2016-08 BID AD #36692882676616DESERT SUN PUBLISHING, LLC 401-0000-60188 1,300.20Construction06/26-7/26/19 - 2018-03 BID AD #36514992676616DESERT SUN PUBLISHING, LLC 401-0000-60188 4,809.30Design08/14/19 - OVERHEAD LINE PROTECTION …4027760IMPERIAL IRRIGATION DIST 401-0000-60185 2,755.00Technical06/04-06/20/19 EISENHOWER RET BASIC …4796CRM TECH 401-0000-60108 3,582.50Technical06/27-07/10/19 EISENHOWER BASIN MAT…LP0719-48LANDMARK GEO-ENGINEERS &…401-0000-60108 1,233.00Technical07/25-08/07/19 DUNE PALMS WIDENING…LP0819-42LANDMARK GEO-ENGINEERS &…401-0000-60108 Fund 401 - CAPITAL IMPROVEMENT PROGRAMS Total:47,511.21 Fund: 501 - FACILITY & FLEET REPLACEMENT 83.72Vehicle Repair & Maintenance07/10/19 - TRAILER CONSTRUCTION MAT'…16686DESERT STEEL SUPPLY 501-0000-60676 201.19Vehicle Repair & Maintenance07/18/19 - TRAILER CONSTRUCTION MAT'…16742DESERT STEEL SUPPLY 501-0000-60676 32.63Vehicle Repair & Maintenance08/14/19 - TRAILER GATE LATCHES16909DESERT STEEL SUPPLY 501-0000-60676 675.00Parts & Maintenance Supplies08/06/19 - SIGN STORAGE ORGANIZER FO…2019-24JCW CUSTOM CABINETRY 501-0000-60675 Fund 501 - FACILITY & FLEET REPLACEMENT Total:992.54 249 Demand Register Packet: APPKT02103 - BC 08/23/19 8/22/2019 11:18:35 AM Page 3 of 5 AmountVendor Name Payable Number Description (Item)Account Name Account Number Fund: 502 - INFORMATION TECHNOLOGY 4,102.58Software Licenses07/10-08/09/19 - MS AZURE ONLINE SVCSE03008UJH4MICROSOFT CORPORATION 502-0000-60301 Fund 502 - INFORMATION TECHNOLOGY Total:4,102.58 Fund: 504 - INSURANCE FUND 142.10Travel & Training08/15/19 - TRAVEL 2019 CJPIA WC SYMPO…082019NIETO, PAM 504-1010-60320 Fund 504 - INSURANCE FUND Total:142.10 Fund: 601 - SILVERROCK RESORT 40.17Repair & Maintenance06/28-07/25/19 - SILVERROCK MATERALSJUL'198768HOME DEPOT CREDIT SERVICES 601-0000-60660 10.83Repair & Maintenance06/28-07/25/19 - SILVERROCK MAT'LSJUL'198768HOME DEPOT CREDIT SERVICES 601-0000-60660 Fund 601 - SILVERROCK RESORT Total:51.00 Grand Total:542,448.45 250 Demand Register Packet: APPKT02103 - BC 08/23/19 8/22/2019 11:18:35 AM Page 4 of 5 Fund Summary Fund Expense Amount 101 - GENERAL FUND 88,754.77 201 - GAS TAX FUND 390.75 215 - LIGHTING & LANDSCAPING FUND 116.48 248 - SA 2004 LO/MOD BOND FUND (Refinanced in 2014)387.02 250 - TRANSPORTATION DIF FUND 400,000.00 401 - CAPITAL IMPROVEMENT PROGRAMS 47,511.21 501 - FACILITY & FLEET REPLACEMENT 992.54 502 - INFORMATION TECHNOLOGY 4,102.58 504 - INSURANCE FUND 142.10 601 - SILVERROCK RESORT 51.00 Grand Total:542,448.45 Account Summary Account Number Account Name Expense Amount 101-0000-20304 Sales Taxes Payable 45.00 101-0000-20949 LT Care Insurance Pay 196.05 101-0000-20981 United Way Deductions 92.00 101-0000-20985 Garnishments Payable 984.28 101-1004-60125 Temporary Agency Servic…993.46 101-1005-60125 Temporary Agency Servic…875.20 101-1005-60400 Office Supplies 18.53 101-1005-60450 Advertising 955.42 101-1006-60125 Temporary Agency Servic…386.24 101-1006-60352 Subscriptions & Publicati…550.00 101-1006-60410 Printing 988.40 101-1007-60402 Forms, Copier Paper 374.01 101-1007-60403 Citywide Conf Room Suppl…368.84 101-1007-60470 Postage 40.55 101-1007-71050 Buildings 42,000.00 101-2001-60174 Blood/Alcohol Testing 55.00 101-2001-60176 Sheriff - Other 100.00 101-2002-60691 Maintenance/Services 605.71 101-3002-60108 Technical 3,000.00 101-3005-60423 Supplies-Graffiti and Van…64.95 101-3005-60431 Materials/Supplies 130.49 101-3005-60554 LQ Park Water Feature 6,360.84 101-3007-60461 Marketing & Tourism Pro…12,537.01 101-3008-60431 Materials/Supplies 2,659.20 101-3008-60432 Tools/Equipment 905.82 101-3008-60691 Maintenance/Services 3,925.66 101-6001-60352 Subscriptions & Publicati…63.52 101-6001-60420 Operating Supplies 95.50 101-6002-60450 Advertising 462.00 101-6003-60118 Plan Checks 630.00 101-6003-60690 Uniforms 238.06 101-6004-60108 Technical 16.00 101-6004-60111 Administrative Citation Se…546.33 101-6004-60125 Temporary Agency Servic…952.80 101-6004-60194 Veterinary Service 1,500.00 101-6006-60103 Professional Services 3,000.00 101-6006-60125 Temporary Agency Servic…1,174.03 101-7003-60420 Operating Supplies 224.63 101-7006-60427 Safety Gear 448.71 101-7006-60690 Uniforms 190.53 201-7003-60431 Materials/Supplies 390.75 215-7004-60423 Supplies-Graffiti and Van…28.71 215-7004-60431 Materials/Supplies 87.77 248-9102-60159 Relocation Benefits 387.02 250-0000-80105 Developer Reimbursemen…400,000.00 251 Demand Register Packet: APPKT02103 - BC 08/23/19 8/22/2019 11:18:35 AM Page 5 of 5 Account Summary Account Number Account Name Expense Amount 401-0000-60108 Technical 7,570.50 401-0000-60185 Design 31,592.95 401-0000-60188 Construction 5,842.76 401-0000-74010 Land Acquisition 2,505.00 501-0000-60675 Parts & Maintenance Supp…675.00 501-0000-60676 Vehicle Repair & Mainte…317.54 502-0000-60301 Software Licenses 4,102.58 504-1010-60320 Travel & Training 142.10 601-0000-60660 Repair & Maintenance 51.00 Grand Total:542,448.45 Project Account Summary Project Account Key Expense Amount **None**94,937.24 091004T 1,233.00 111205L 2,505.00 141513D 26,783.65 151612T 6,337.50 1920TMICT 1,660.56 201602CT 1,625.80 201603D 4,809.30 201608CT 1,256.20 201702DEV 400,000.00 201803CT 1,300.20 Grand Total:542,448.45 252 8/30/2019 6:06:20 PM Page 1 of 8 Demand Register City of La Quinta Packet: APPKT02113 - BC 08/30/19 AmountVendor Name Payable Number Description (Item)Account Name Account Number Fund: 101 - GENERAL FUND 500.00Administrative Citations06/28/19 - LQ162057 REFUND CITATION062819VANHULZEN, JEFFREY B.101-0000-42700 500.00Administrative Citations06/28/19 - LQ162054 REFUND CITATION062819WAMPOLE, SPENCER 101-0000-42700 119.00Membership Dues06/28/19 - REIMB NOTARY APP & LIVE SC…062819FLORES, TANIA 101-1005-60351 224.00Instructors08/26/19 - SUNSET YOGA082619TRUE, ARTHUR ALLEN 101-3002-60107 89.67Instructors08/26/19 - ZUMBA082619MISELL, STACY 101-3002-60107 216.86Instructors08/26/19 - SUN STYLE TAI CHI082619COHEN, ANN MARIE 101-3002-60107 302.12Instructors08/26/19 - BALLROOM DANCING082619SHIRY, TERESA 101-3002-60107 25.60Instructors08/26/19 - PERSONAL TRAINER082619FARKAS, LORETTA ANN ROSE 101-3002-60107 502.25Instructors08/26/19 - TAEKWONDO082619ROJAS, MIGUEL ANGEL 101-3002-60107 131.04Instructors08/26/19 - EVENING & GENTLE YOGA082619WILSON, ALBA 101-3002-60107 85.68Instructors08/26/19 - TAI CHI CHUAN082619MEDEIROS, JOYCELEEN 101-3002-60107 182.82Travel & Training08/13/19 - TRAVEL REIMB PRESS CONF SA…082719PENA, JOHN 101-1001-60320 2,958.75Employee Recognition Events08/27/19 - EMPLOYEE RECOG DINNER DEP…082719LA QUINTA RESORT & CLUB 101-1004-60340 110.00Membership Dues08/27/19 - MEMBERSHIP N COUSINS082719IIMC 101-1005-60351 95.00Membership Dues07/01/19-06/30/20 - MEMBERSHIP ANNU…082719CALIFORNIA MUNICIPAL TREA…101-1006-60351 146.49Travel & Training08/20/19 - TRAVEL REIMB PRESS CONF SA…082719APENA, JOHN 101-1001-60320 150.00Membership Dues08/27/19 - MEMBERSHIP N ROMANE082719AIIMC 101-1005-60351 50.00Materials/Supplies08/28/19 - CEQA FILING SDP 2019-0005 C…082819COUNTY OF RIVERSIDE 101-3005-60431 542.86Due to Other Agencies08/30/19 - FUND 740/710 LIQUIDATED S…083019COACHELLA VALLEY WATER DI…101-0000-20300 16,303.00MSHCP Mitigation Fee07/2019 - MSHCP FEES083019COACHELLA VALLEY CONSERV…101-0000-20310 -163.03CVMSHCP Admin Fee07/2019 - MSHCP FEES083019COACHELLA VALLEY CONSERV…101-0000-43631 310.00Materials/Supplies07/2019 CALLE TECATE PARKING LOT1 JOB 2019-08NAI CONSULTING INC 101-3005-60431 2,785.00Consultants07/2019 MISCELLANEOUS DUTIES1 JOB 2019-08NAI CONSULTING INC 101-7006-60104 626.12Maintenance/Services08/05/19 - SPORTS COMPLEX100661LOCK SHOP INC, THE 101-3008-60691 520.00Plan Checks07/2019 ON-CALL BUILDING PLAN REVIEW…128492HR GREEN PACIFIC INC 101-6003-60118 273.81Operating Supplies08/09/19 - DRINKING WATER12852924080919SPARKLETTS 101-7003-60420 203.73Operating Supplies08/01-08/15/19 - WC JANITORIAL SUPPLIES1402164944AMERIPRIDE SERVICES INC 101-3002-60420 5,000.00Marketing & Tourism Promoti…07/01/19 MODERNISM WEEK GOLD SPON…1407-MLOCALE MAGAZINE 101-3007-60461 620.64Community Experiences07/12/19 - GOLF TOUR TROPHIES144445POWERS AWARDS INC 101-3003-60149 2,577.55Professional Services07/01-08/31/19 - STVRP HOTLINE14-641-991CENTRAL COMMUNICATIONS 101-6004-60103 5,625.00Travel & Training07/01/19-06/30/20 LCW CONSORTIUM E…1479201LIEBERT CASSIDY WHITMORE 101-1004-60320 664.18Materials/Supplies08/09/19 - INDIAN RED155785SOUTHWEST BOULDER & STO…101-3005-60431 519.72Materials/Supplies08/09/19 - INDIAN RED CA GOLD155788SOUTHWEST BOULDER & STO…101-3005-60431 778.39Materials/Supplies08/09/19 - CA GOLD SOIL BOND155848SOUTHWEST BOULDER & STO…101-3005-60431 222.81Materials/Supplies08/10/19 - CALIF GOLD155981SOUTHWEST BOULDER & STO…101-3005-60431 4,000.00Marketing & Tourism Promoti…09/2019 GRAPHIC DESIGN1696ARK CONNECTS LLC 101-3007-60461 225.00Maintenance/Services08/20/19 - LOCK INSTALLATION17794SAM'S FENCE COMPANY 101-3005-60691 415.00HVAC08/07/19 - CITY HALL HVAC SVC18781850HYDE'S AC 101-3008-60667 3,195.00HVAC08/09/19 - CITY HALL HVAC SVC18782675HYDE'S AC 101-3008-60667 1,500.00Maintenance/Services08/08/19 - FS #93 HVAC SVC18782732HYDE'S AC 101-2002-60691 859.00HVAC08/08/19 - CITY HALL HVAC SVC18791393HYDE'S AC 101-3008-60667 335.00Maintenance/Services08/12/19 - FS #32 HVAC SVC18819562HYDE'S AC 101-2002-60691 19.87Operating Supplies08/12/19 - CREDIT CARD REFUND STAMP19-100191RIVERSIDE RUBBER STAMP & …101-3002-60420 525.00Travel & Training07/29/19-08/02/19 - TRAINING SALAS200010338CACEO 101-3001-60320 233.81LQ Police Volunteers08/06/19 - LQPD RECOGNITION PLAQUES2018-4597MCDOWELL AWARDS 101-2001-60109 41,890.00Landscape Contract08/2019 PARKS MAINT213206VINTAGE ASSOCIATES 101-3005-60112 1,065.00Maintenance/Services08/12/19 - REPAIR IRRIGATION PRE-EXIST…213264VINTAGE ASSOCIATES 101-3005-60691 80.09Cable - Utilities08/16-09/15/19 - FS #32 CABLE (8152)218152081619TIME WARNER CABLE 101-2002-61400 300.00Maintenance/Services08/13/19 - FS #93 ROOF REPAIR22618WESTERN PACIFIC ROOFING C…101-2002-60691 10.50Cable - Utilities08/05-09/04/19 - FS #32 CABLE (1841)231841080519TIME WARNER CABLE 101-2002-61400 35.00Travel & Training01/14/19 - RIVCO DIV MTG S SANCHEZ2387LEAGUE OF CALIFORNIA CITIES 101-1001-60320 4,562.50Consultants07/01-09/30/19 PROPERTY TAX MGMT A…26903-INHDL COREN & CONE 101-1006-60104 27.50Membership Dues07/01-12/31/19 - CCAC MEMBER N COUS…2716CITY CLERK ASSOCIATION OF C…101-1005-60351 253 Demand Register Packet: APPKT02113 - BC 08/30/19 8/30/2019 6:06:20 PM Page 2 of 8 AmountVendor Name Payable Number Description (Item)Account Name Account Number 5,707.00Fritz Burns Pool07/2019 FRITZ BURNS POOL OPERATIONS2737DESERT RECREATION DISTRICT 101-3005-60184 41.69Cable - Utilities08/16-09/15/19 - FS #70 CABLE (1860)31860081619TIME WARNER CABLE 101-2002-61400 4.77Office Supplies07/29/19 - OFFICE SUPPLIES FIRE3421495891STAPLES ADVANTAGE 101-2002-60400 -4.77Office Supplies08/08/19 - OFFICE SUPPLIES FIRE RETURN3421701979STAPLES ADVANTAGE 101-2002-60400 106.05Office Supplies08/17/19 - OFFICE SUPPLIES3422545464STAPLES ADVANTAGE 101-6001-60400 16.30Office Supplies08/21/19 - OFFICE SUPPLIES3422719140STAPLES ADVANTAGE 101-6001-60400 -95.88Office Supplies08/06/19 - FIRE FOLDERS RETURN354286977001OFFICE DEPOT 101-2002-60400 66.00Blood/Alcohol Testing08/15/19 - BLOOD ANALYSIS38469BIO-TOX LABORATORIES 101-2001-60174 683.00Blood/Alcohol Testing08/15/19 - BLOOD ANALYSIS38470BIO-TOX LABORATORIES 101-2001-60174 35.00Blood/Alcohol Testing08/07/19 - BLOOD ALCOHOL TESTING398951DEPARTMENT OF JUSTICE 101-2001-60174 596.55Maintenance/Services06/26/19 - FS #93 SERVICE44658AIR EXCHANGE 101-2002-60691 1,522.50Materials/Supplies08/08/19 - MATERIALS5026W.D. YOUNG & SONS 101-3005-60431 390.00Uniforms08/13/19 - UNIFORMS510544983MISSION LINEN SUPPLY 101-3005-60690 390.00Uniforms08/13/19 - UNIFORMS510544983MISSION LINEN SUPPLY 101-3008-60690 300.00Map/Plan Checking07/22/19 PARCEL MERGER PM2019-00035301RASA/ERIC NELSON 101-7002-60183 370.00Map/Plan Checking07/22/19 LOT LINE ADJ LLA 2019-00035302RASA/ERIC NELSON 101-7002-60183 370.00Map/Plan Checking07/22/19 LOT LINE ADJ LLA 2019-00045303RASA/ERIC NELSON 101-7002-60183 157.00Map/Plan Checking08/20/19 MARSLAND LLA 2019-00015310RASA/ERIC NELSON 101-7002-60183 1,560.00Map/Plan Checking08/23/19 FAMILY HERITAGE CHURCH FPM…5312RASA/ERIC NELSON 101-7002-60183 11,091.38Janitorial08/2019 JANITORIAL SERVICES CH WC PA…538241MERCHANTS BUILDING MAINT…101-3008-60115 1,173.63Temporary Agency Services08/09/19 - HUB TEMP SVCS M GONZALEZ54059009ROBERT HALF TECHNOLOGY 101-6006-60125 1,177.27Temporary Agency Services08/16/19 - HUB TEMP SVCS M GONZALEZ54105245ROBERT HALF TECHNOLOGY 101-6006-60125 1,170.00Plan Checks07/2019 ON-CALL BUILDING PLAN REVIEW…59422-INESGIL CORPORATION 101-6003-60118 13,844.00Contract Traffic Engineer07/01-07/26/19 ON-CALL TRAFFIC ENGIN…617894WILLDAN 101-7006-60144 61.00Pest Control07/03/19 - LQ PARK PEST CONTROL660209582TRULY NOLEN INC 101-3008-60116 70.00Pest Control07/05/19 - WC PEST CONTROL660209727TRULY NOLEN INC 101-3008-60116 61.00Pest Control08/12/19 - LQ PARK PEST CONTROL660211306TRULY NOLEN INC 101-3008-60116 70.00Pest Control08/14/19 - WC PEST CONTROL660211442TRULY NOLEN INC 101-3008-60116 40.00Pest Control08/02/19 - FRITZ BURNS PEST CONTROL660212507TRULY NOLEN INC 101-3008-60116 385.00Blood/Alcohol Testing07/31/19 - BLOOD ANALYSIS72418AMERICAN FORENSIC NURSES …101-2001-60174 2,501.84Supplies-Graffiti and Vandalism08/20/19 - SPORTS COMPLEX VANDALISM…73084VINTAGE E & S INC 101-3005-60423 450.00Maintenance/Services08/08/19 - FS #70 DOOR REPAIR73898PATTON DOOR & GATE 101-2002-60691 295.00Maintenance/Services05/09/19 - CITY HALL SIGNS7518TOP OF THE LINE SIGNS 101-3008-60691 4,704.21Materials/Supplies08/19/19 - LQ PARK LAVATORY & URINAL7692902FERGUSON ENTERPRISES, INC 101-3008-60431 123.46Materials/Supplies08/19/19 - CITY HALL MATERIALS7901355FERGUSON ENTERPRISES, INC 101-3008-60431 19.25LQ Police Volunteers08/15/19 - POLICE SHREDDING8127929631SHRED-IT USA - SAN BERNADI…101-2001-60109 460.57Materials/Supplies08/10/19 - MATERIALS84502CALIFORNIA DESERT NURSERY,…101-3005-60431 77.37Mobile/Cell Phones/Satellites07/2019 - SATELLITE PHONES9071309576NI GOVERNMENT SERVICES INC 101-2002-61304 303.00Materials/Supplies08/15/19 - PAINT CIVIC CTR CAMPUS9116-7THE SHERWIN-WILLIAMS CO.101-3005-60431 4,980.00Maintenance/Services08/13/19 - LANDSCAPE IMPROVEMENT91611PWLC II, INC 101-3005-60691 95.00Community Experiences09/11/19 - CHAIRS FOR 911 EVENT933ESPINOZA, DAVID C.101-3003-60149 15.60Citywide Conf Room Supplies08/23/19 - WC COFFEE SUPPLIES951412DAIOHS FIRST CHOICE SERVICES 101-1007-60403 985.23Telephone - Utilities06/26-07-25/19 - LQPD CELL SVC (6852)9834816952VERIZON WIRELESS 101-2001-61300 44.92Telephone - Utilities07/11-08/10/19 - LQ TICKET WRITERS (59…9835810451VERIZON WIRELESS 101-2001-61300 17.82Mobile/Cell Phones/Satellites07/14-08/13/19 - EOC CELL PHONES (7813)9836077065VERIZON WIRELESS 101-2002-61304 76.29Materials/Supplies08/08/19 - CITY HALL KEYSBB0533584LOCK SHOP INC, THE 101-3008-60431 1,981.14Electricity - Utilities08/27/19 - ELECTRICITY SERVICECSE162IMPERIAL IRRIGATION DIST 101-2002-61101 13.49Electric - Monticello Park - Utili…08/27/19 - ELECTRICITY SERVICECSE162IMPERIAL IRRIGATION DIST 101-3005-61102 1,910.49Electric - Civic Center Park - Uti…08/27/19 - ELECTRICITY SERVICECSE162IMPERIAL IRRIGATION DIST 101-3005-61103 1,077.10Electric - Fritz Burns Park - Utili…08/27/19 - ELECTRICITY SERVICECSE162IMPERIAL IRRIGATION DIST 101-3005-61105 1,248.63Electric - Community Park - Util…08/27/19 - ELECTRICITY SERVICECSE162IMPERIAL IRRIGATION DIST 101-3005-61109 13.39Electric - Velasco Park - Utilities08/27/19 - ELECTRICITY SERVICECSE162IMPERIAL IRRIGATION DIST 101-3005-61111 20.46Electric - Eisenhower Park - Util…08/27/19 - ELECTRICITY SERVICECSE162IMPERIAL IRRIGATION DIST 101-3005-61113 13.03Electric - Desert Pride - Utilities08/27/19 - ELECTRICITY SERVICECSE162IMPERIAL IRRIGATION DIST 101-3005-61114 14,363.98Electricity - Utilities08/27/19 - ELECTRICITY SERVICECSE162IMPERIAL IRRIGATION DIST 101-3008-61101 3,588.73Water - Civic Center Park - Utili…08/26/19 - WATER SERVICECSW222COACHELLA VALLEY WATER DI…101-3005-61202 9,420.25Water -Community Park - Utilit…08/26/19 - WATER SERVICECSW222COACHELLA VALLEY WATER DI…101-3005-61209 185.28PM 10 - Dust Control08/26/19 - WATER SERVICECSW222COACHELLA VALLEY WATER DI…101-7006-60146 550.02Operating Supplies07/2019 - RADIO MAINT-IT0000003298RIVERSIDE COUNTY INFORMAT…101-2001-60420 85.52Gas - Utilities06/27-07/29/19 - FS #93 GAS SVCJUL'1916568248591GAS COMPANY, THE 101-2002-61100 254 Demand Register Packet: APPKT02113 - BC 08/30/19 8/30/2019 6:06:20 PM Page 3 of 8 AmountVendor Name Payable Number Description (Item)Account Name Account Number 441.06Operating Supplies07/18-08/13/19 - B & G CLUB BACK TO SC…JUL'194593WALMART COMMUNITY 101-3002-60420 27.98Operating Supplies07/18-08/13/19 - B & G CLUB LUNCHEONJUL'194593WALMART COMMUNITY 101-3002-60420 3,200.00Blood/Alcohol Testing07/05-07/25/19 LA191860023 LA1920300…JUL'19700000132EISENHOWER MEDICAL CENTER 101-2001-60174 150.00Travel & Training09/01/19-08/31/20 - MEMBER R ALVARA…MAY'19122887CALIFORNIA PARK & RECREAT…101-3008-60320 150.00Membership Dues09/01/19-08/31/20 - MEMBER A RODRIG…MAY'19134333CALIFORNIA PARK & RECREAT…101-3005-60351 255.56Water - Utilities08/26/19 - WATER SERVICEPWW204COACHELLA VALLEY WATER DI…101-2002-61200 236.34Water -Eisenhower Park - Utilit…08/26/19 - WATER SERVICEPWW204COACHELLA VALLEY WATER DI…101-3005-61203 2,319.99Water -Fritz Burns Park - Utiliti…08/26/19 - WATER SERVICEPWW204COACHELLA VALLEY WATER DI…101-3005-61204 72.73Water -Velasco Park - Utilities08/26/19 - WATER SERVICEPWW204COACHELLA VALLEY WATER DI…101-3005-61205 746.75Water - Utilities08/26/19 - WATER SERVICEPWW204COACHELLA VALLEY WATER DI…101-3008-61200 125.00Cash Over/Short08/26/19 - BRES2019-0258 REFUND DEPR52945DISCOVERY BUILDERS CALIFO…101-0000-42300 186.00Cash Over/Short08/27/19 - LIC-0103550 REFUND INCORRE…R52958MAXIM HEALTHCARE SERVICES 101-0000-42300 30.64Materials/Supplies08/22/19 - PLANTS SPORTS COMPLEXREG001-12256VINTAGE ASSOCIATES 101-3005-60431 175.56Mobile/Cell Phones/Satellites08/23-09/22/19 - ECO SATELLITE PHONESRU08205890ROADPOST USA INC.101-2002-61304 4,794.75Supplies-Graffiti and Vandalism08/15/19 - MATERIALS VANDALISMS113766744.001WALTERS WHOLESALE ELECTR…101-3005-60423 7.95HVAC08/09/19 - CITY HALL HVAC FILTERSS3018297.001JOHNSTONE SUPPLY 101-3008-60667 345.70Sheriff - Other06/24-07/24/19 - COPS FUELSH0000035888RIVERSIDE COUNTY SHERIFF D…101-2001-60176 Fund 101 - GENERAL FUND Total:207,322.90 Fund: 201 - GAS TAX FUND 102.66Materials/Supplies07/29/19 - URETHANE SEALANT10010936544HD SUPPLY CONSTRUCTION S…201-7003-60431 4.56Materials/Supplies07/30/19 - FOAM BACKER ROD10010941109HD SUPPLY CONSTRUCTION S…201-7003-60431 31.54Traffic Control Signs05/30/19 - TRAFFIC CONTROL SIGNS1075362TOPS'N BARRICADES INC 201-7003-60429 82.98Traffic Control Signs05/30/19 - TRAFFIC CONTROL SIGNS1075363TOPS'N BARRICADES INC 201-7003-60429 184.22Traffic Control Signs05/31/19 - TRAFFIC CONTROL SIGNS1075393TOPS'N BARRICADES INC 201-7003-60429 188.15Traffic Control Signs06/05/19 - TRAFFIC CONTROL SIGNS1075485TOPS'N BARRICADES INC 201-7003-60429 171.61Traffic Control Signs07/31/19 - TRAFFIC CONTROL SIGNS1076562TOPS'N BARRICADES INC 201-7003-60429 157.58Traffic Control Signs08/06/19 - TRAFFIC CONTROL SIGNS1076668TOPS'N BARRICADES INC 201-7003-60429 569.14Traffic Control Signs08/08/19 - TRAFFIC CONTROL SIGNS1076723TOPS'N BARRICADES INC 201-7003-60429 177.15Traffic Control Signs08/13/19 - TRAFFIC CONTROL SIGNS1076793TOPS'N BARRICADES INC 201-7003-60429 301.02Traffic Control Signs08/13/19 - TRAFFIC CONTROL SIGNS1076794TOPS'N BARRICADES INC 201-7003-60429 202.30Asphalt07/18/19 - ASPHALT COLD MIX2030519CALIFORNIA COMMERCIAL AS…201-7003-60430 199.55Asphalt08/05/19 - ASPHALT COLD MIX2036909CALIFORNIA COMMERCIAL AS…201-7003-60430 50.05Materials/Supplies07/26/19 - SNAP CONNECTOR336597-0HUB CONSTRUCTION SPECIALT…201-7003-60431 317.07Materials/Supplies07/30/19 - POLYURETHANE SEALANT50010895367HD SUPPLY CONSTRUCTION S…201-7003-60431 1,925.85Uniforms08/13/19 - UNIFORMS510544983MISSION LINEN SUPPLY 201-7003-60690 29.35Materials/Supplies07/31/19 - ACETYLENE90993864PRAXAIR INC 201-7003-60431 960.78Electricity - Utilities08/27/19 - ELECTRICITY SERVICEPW220IMPERIAL IRRIGATION DIST 201-7003-61101 Fund 201 - GAS TAX FUND Total:5,655.56 Fund: 202 - LIBRARY & MUSEUM FUND 910.00Landscape Contract08/2019 LIBRARY MAINT213206VINTAGE ASSOCIATES 202-3004-60112 190.00Landscape Contract08/2019 MUSEUM MAINT213206VINTAGE ASSOCIATES 202-3006-60112 2,644.42Janitorial08/2019 JANITORIAL SERVICES LIBRARY538241MERCHANTS BUILDING MAINT…202-3004-60115 698.50Janitorial08/2019 JANITORIAL SERVICES MUSEUM538241MERCHANTS BUILDING MAINT…202-3006-60115 130.24Telephone - Utilities08/13-09/12/19 - MUSEUM PHONEAUG'197710105FRONTIER COMMUNICATIONS…202-3006-61300 5,093.54Electricity - Utilities08/27/19 - ELECTRICITY SERVICECSE162IMPERIAL IRRIGATION DIST 202-3004-61101 1,384.63Electricity - Utilities08/27/19 - ELECTRICITY SERVICECSE162IMPERIAL IRRIGATION DIST 202-3006-61101 250.00HVAC08/2019 - LIBRARY WATER TREATMENTI31165PACIFIC WEST AIR CONDITION…202-3004-60667 Fund 202 - LIBRARY & MUSEUM FUND Total:11,301.33 Fund: 215 - LIGHTING & LANDSCAPING FUND 11,865.00Landscape Contract08/2019 LIGHTING & LANDSCAPING MAINT213206VINTAGE ASSOCIATES 215-7004-60112 1,172.60Materials/Supplies08/14/19 - IRRIGATION MATERIALS597344HIGH TECH IRRIGATION INC 215-7004-60431 5,328.00Maintenance/Services08/01/19 - LANDSCAPE MAINT JEFF MEDI…65956CITY OF INDIO 215-7004-60691 2,048.00Maintenance/Services08/13/19 - DEBRIS REMOVAL91610PWLC II, INC 215-7004-60691 158.09Electric - Utilities08/07-09/06/19 - PHONE SERVICEAUG'193453493FRONTIER COMMUNICATIONS…215-7004-61116 49.04Electric - Utilities08/10-09/09/19 - PHONE SERVICEAUG'195646974FRONTIER COMMUNICATIONS…215-7004-61116 3,672.73Electric - Utilities08/27/19 - ELECTRICITY SERVICEPW220IMPERIAL IRRIGATION DIST 215-7004-61116 1,926.87Electric - Medians - Utilities08/27/19 - ELECTRICITY SERVICEPW220IMPERIAL IRRIGATION DIST 215-7004-61117 20,854.61Water - Medians - Utilities08/26/19 - WATER SERVICEPWW204COACHELLA VALLEY WATER DI…215-7004-61211 51.11Materials/Supplies08/09/19 - MATERIALSs113722872.001WALTERS WHOLESALE ELECTR…215-7004-60431 255 Demand Register Packet: APPKT02113 - BC 08/30/19 8/30/2019 6:06:20 PM Page 4 of 8 AmountVendor Name Payable Number Description (Item)Account Name Account Number 132.89Materials/Supplies08/09/19 - MATERIALSS113722996.001WALTERS WHOLESALE ELECTR…215-7004-60431 102.23Materials/Supplies08/09/19 - MATERIALSS113723035.001WALTERS WHOLESALE ELECTR…215-7004-60431 28.55Materials/Supplies08/09/19 - MATERIALSS113723646.001WALTERS WHOLESALE ELECTR…215-7004-60431 196.08Materials/Supplies08/09/19 - MATERIALSS113723722.001WALTERS WHOLESALE ELECTR…215-7004-60431 29.69Materials/Supplies08/09/19 - MATERIALSS113723777.001WALTERS WHOLESALE ELECTR…215-7004-60431 9.90Materials/Supplies08/09/19 - MATERIALSS113723814.001WALTERS WHOLESALE ELECTR…215-7004-60431 78.84Materials/Supplies08/09/19 - MATERIALSS113723924.001WALTERS WHOLESALE ELECTR…215-7004-60431 51.11Materials/Supplies08/09/19 - MATERIALSS113723974.001WALTERS WHOLESALE ELECTR…215-7004-60431 61.34Materials/Supplies08/20/19 - MATERIALSS113723974.002WALTERS WHOLESALE ELECTR…215-7004-60431 143.12Materials/Supplies08/20/19 - MATERIALSS113724044.001WALTERS WHOLESALE ELECTR…215-7004-60431 4.08Materials/Supplies08/20/19 - MATERIALSS113783849.001WALTERS WHOLESALE ELECTR…215-7004-60431 184.01Materials/Supplies08/20/19 - MATERIALSS113783885.001WALTERS WHOLESALE ELECTR…215-7004-60431 Fund 215 - LIGHTING & LANDSCAPING FUND Total:48,147.89 Fund: 224 - TUMF FUND 32,340.00TUMF Payable to CVAG07/2019 - TUMF FEE083019COACHELLA VALLEY ASSOC OF…224-0000-20320 Fund 224 - TUMF FUND Total:32,340.00 Fund: 235 - SO COAST AIR QUALITY FUND 246.21Electricity - Utilities08/27/19 - ELECTRICITY SERVICEPW220IMPERIAL IRRIGATION DIST 235-0000-61101 Fund 235 - SO COAST AIR QUALITY FUND Total:246.21 Fund: 241 - HOUSING AUTHORITY 103.70Travel & Training08/06/19 - MILEAGE MANAGING MULT PR…082719CAMARENA, REYNA 241-9101-60320 147.89Operating Supplies07/16/19 - HEADSET K ROMERO342339773001OFFICE DEPOT 241-9101-60420 -147.89Operating Supplies08/01/19 - HEADSET K ROMERO RETURN349494429001OFFICE DEPOT 241-9101-60420 108.74Operating Supplies08/09/19 - KEYBOARD TERESA359270773001OFFICE DEPOT 241-9101-60420 Fund 241 - HOUSING AUTHORITY Total:212.44 Fund: 248 - SA 2004 LO/MOD BOND FUND (Refinanced in 2014) 89.88Relocation Benefits06/28/19 - FINAL WSA REIMB CLAIM062819AMARTINEZ, LINDA 248-9102-60159 Fund 248 - SA 2004 LO/MOD BOND FUND (Refinanced in 2014) Total:89.88 Fund: 270 - ART IN PUBLIC PLACES FUND 100.00APP Maintenance08/30/19 - REPAIR REPLACE GLASS "GALA…083019OSBORNE, JANICE 270-0000-60683 9,200.00Art Purchases06/2019 ART CONSULTANT SERVICESLQ2260LEBASSE PROJECTS INTERNATI…270-0000-74800 Fund 270 - ART IN PUBLIC PLACES FUND Total:9,300.00 Fund: 401 - CAPITAL IMPROVEMENT PROGRAMS 1,215.00Land Acquisition08/28/19 - RELOC MOVING FUNDS PYMT …082819TRUJILLO, JUAN PEDRO AND I…401-0000-74010 1,000.00Land Acquisition08/28/19 - RELOC MOVING FUNDS PYMT …082819ATRUJILLO, JUAN PEDRO AND I…401-0000-74010 1,650.00Professional Services07/2019 CALLE TAMPICO DRAINAGE IMP…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 795.00Professional Services07/2019 WASHINGTON ST AT FRED WARI…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 1,157.50Professional Services07/2019 EISENHOWER DRAINAGE IMPRO…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 310.00Professional Services07/2019 FY 1920 CITYWIDE SIDEWALK IM…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 155.00Professional Services07/2019 JEFFERSON STREET AT AVENUE 5…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 2,480.00Professional Services07/2019 HIGHWAY 111 SIDEWALK IMPRO…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 372.50Professional Services07/2019 DUNE PALMS ROAD STREET IMP…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 465.00Professional Services07/2019 COVE PUBLIC RESTROOM1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 8,422.50Professional Services07/2019 SILVERROCK PARK VENUE SITE1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 212.50Professional Services07/2019 SB821 JEFFERSON STREET SIDEW…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 1,550.00Professional Services07/2019 HSIP INTERSECTION IMPROVEM…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 3,997.50Professional Services07/2019 DUNE PALMS BRIDGE IMPROVE…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 8,037.50Professional Services07/2019 VILLAGE COMPLETE STREETS1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 805.00Professional Services07/2019 RETENTION BASIN (DPLM AT W…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 1,942.50Professional Services07/2019 WASHINGTON DRAINAGE IMPR…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 1,402.50Professional Services07/2019 HSIP TRAFFIC SIGNAL INTERCON…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 972.50Professional Services07/2019 NORTH LA QUINTA PARKWAY TU…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 4,435.00Professional Services07/2019 SILVERROCK RESORT INFRASTRU…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 2,455.00Professional Services07/2019 CORPORATE YARD1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 310.00Professional Services07/2019 EISENHOWER RETENTION BASIN …1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 1,860.00Professional Services07/2019 REGIONAL SKATE AND BMX PARK1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 2,635.00Professional Services07/2019 FY 1920 PAVEMENT MANAGEM…1 JOB 2019-08NAI CONSULTING INC 401-0000-60103 3,342.48Technical07/15-07/21/19 EISENHOWER RET BASIN …1348AGUA CALIENTE BAND OF CA…401-0000-60108 256 Demand Register Packet: APPKT02113 - BC 08/30/19 8/30/2019 6:06:20 PM Page 5 of 8 AmountVendor Name Payable Number Description (Item)Account Name Account Number 421.00Construction07/03/19 - MMU REPAIR150534ECONOLITE SYSTEMS INC.401-0000-60188 8,119.91Construction06/28/19 CITY HALL ENTRY DOORS18487ALARM MONITORING SERVICE…401-0000-60188 300.00Design07/2019 ON-CALL LANDSCAPE DESIGN SE…19081303HERMANN DESIGN GROUP INC 401-0000-60185 51,273.96Construction08/16/19 - IRRIGATION METERS 2015-0319-10261COACHELLA VALLEY WATER DI…401-0000-60188 1,361.88Technical04/27-05/31/19 - EISENHOWER DRAINAGE…20194119DUDEK & ASSOCIATES INC 401-0000-60108 3,322.46Technical06/01-06/28/19 - EISENHOWER DRAINAGE…20194629DUDEK & ASSOCIATES INC 401-0000-60108 15,704.16DesignDUNE PALMS BRIDGE LOW WATER CROSS…3789BENGAL ENGINEERING INC 401-0000-60185 31,471.44Construction07/2019 LQ VILLAGE COMPLETE STREETS …LQ002SOUTHSTAR ENGINEERING & …401-0000-60188 101.30Construction06/26/19 - POP-UP BLADES113416290.001WALTERS WHOLESALE ELECTR…401-0000-60188 -101.30Construction06/28/19 - POP-UP BLADE RETURNS113416290.002WALTERS WHOLESALE ELECTR…401-0000-60188 Fund 401 - CAPITAL IMPROVEMENT PROGRAMS Total:163,954.79 Fund: 501 - FACILITY & FLEET REPLACEMENT 3,062.02Fuel & Oil08/01-08/15/19 - VEHICLE FUEL1320TOWER ENERGY GROUP 501-0000-60674 93.72Parts & Maintenance Supplies08/21/19 - REPLACE TIRE TRAILER136644MOUNTAIN VIEW TIRE 501-0000-60675 511.00Vehicle Repair & Maintenance08/16-08/17/19 R.A.N. AUTO WASH254RAN AUTO DETAIL 501-0000-60676 Fund 501 - FACILITY & FLEET REPLACEMENT Total:3,666.74 Fund: 502 - INFORMATION TECHNOLOGY 3,925.27Copiers08/2019 CITY PRINTERS20433368CANON FINANCIAL SERVICES, …502-0000-60662 18,900.00Consultants07/2019 - ENTERPRISE SVC EQPT & 1 RES…2136374CONVERGEONE, INC 502-0000-60104 161.27Cable - Utilities08/2019 - CITY HALL CABLE (4625)34625080119TIME WARNER CABLE 502-0000-61400 2,079.00Cable - Utilities08/10-09/09/19 - CITY HALL FIBER (2546)452546081019TIME WARNER CABLE 502-0000-61400 76.86Cable - Utilities08/12-09/11/19 - CITY YARD CABLE (4080)504080081219TIME WARNER CABLE 502-0000-61400 17.66Cable - Utilities08/20-09/19/19 - WC CABLE (1909)61909082019TIME WARNER CABLE 502-0000-61400 6,992.00Comm. Resources, Software E…07/01/19-06/30/20 RECREATION SOFTWA…63035VERMONT SYSTEMS INC 502-0000-71043 66.52Cable - Utilities07/02-08/01/19 - BACKUP SERVER (2183)9835187205VERIZON WIRELESS 502-0000-61400 1,080.07Cell/Mobile Phones07/02-08/01/19 - CITY CELL SVC IPADS (55…9835187305VERIZON WIRELESS 502-0000-61301 1,761.30Cell/Mobile Phones07/02-08/01/19 - CITY CELL SVC (5496)9835224240VERIZON WIRELESS 502-0000-61301 105.01Cable - Utilities08/10-09/09/19 - CITY HALL INTERNETAUG'191712626FRONTIER COMMUNICATIONS…502-0000-61400 60.01Cable - Utilities07/27-08/26/19 - BLACKHAWK/LQ PARK D…AUG'193604861FRONTIER COMMUNICATIONS…502-0000-61400 65.01Cable - Utilities07/26-08/25/19 - CITY HALL DSLAUG'197712842FRONTIER COMMUNICATIONS…502-0000-61400 213.81Cable - Utilities08/04-09/03/19 - DSL SERVICEAUG'197771222FRONTIER COMMUNICATIONS…502-0000-61400 Fund 502 - INFORMATION TECHNOLOGY Total:35,503.79 Fund: 503 - PARK EQUIP & FACILITY FUND 4,800.00Parks08/12/19 DEPOSIT ESTIMATE 14264 & 14…16297L.O. LYNCH QUALITY WELLS & …503-0000-71060 24,200.00Parks08/20/19 SPORTS COMPLEX FIELD SMOO…213291VINTAGE ASSOCIATES 503-0000-71060 Fund 503 - PARK EQUIP & FACILITY FUND Total:29,000.00 Fund: 504 - INSURANCE FUND 6.16Operating Supplies08/15/19 - FIRE EVAC FOR WC363145077001OFFICE DEPOT 504-1010-60420 Fund 504 - INSURANCE FUND Total:6.16 Fund: 601 - SILVERROCK RESORT 59.16Bank Fees07/2019 - SRR ARMORED SERVICES70092404GARDAWORLD 601-0000-60455 Fund 601 - SILVERROCK RESORT Total:59.16 Grand Total:546,806.85 257 Demand Register Packet: APPKT02113 - BC 08/30/19 8/30/2019 6:06:20 PM Page 6 of 8 Fund Summary Fund Expense Amount 101 - GENERAL FUND 207,322.90 201 - GAS TAX FUND 5,655.56 202 - LIBRARY & MUSEUM FUND 11,301.33 215 - LIGHTING & LANDSCAPING FUND 48,147.89 224 - TUMF FUND 32,340.00 235 - SO COAST AIR QUALITY FUND 246.21 241 - HOUSING AUTHORITY 212.44 248 - SA 2004 LO/MOD BOND FUND (Refinanced in 2014)89.88 270 - ART IN PUBLIC PLACES FUND 9,300.00 401 - CAPITAL IMPROVEMENT PROGRAMS 163,954.79 501 - FACILITY & FLEET REPLACEMENT 3,666.74 502 - INFORMATION TECHNOLOGY 35,503.79 503 - PARK EQUIP & FACILITY FUND 29,000.00 504 - INSURANCE FUND 6.16 601 - SILVERROCK RESORT 59.16 Grand Total:546,806.85 Account Summary Account Number Account Name Expense Amount 101-0000-20300 Due to Other Agencies 542.86 101-0000-20310 MSHCP Mitigation Fee 16,303.00 101-0000-42300 Cash Over/Short 311.00 101-0000-42700 Administrative Citations 1,000.00 101-0000-43631 CVMSHCP Admin Fee -163.03 101-1001-60320 Travel & Training 364.31 101-1004-60320 Travel & Training 5,625.00 101-1004-60340 Employee Recognition Ev…2,958.75 101-1005-60351 Membership Dues 406.50 101-1006-60104 Consultants 4,562.50 101-1006-60351 Membership Dues 95.00 101-1007-60403 Citywide Conf Room Suppl…15.60 101-2001-60109 LQ Police Volunteers 253.06 101-2001-60174 Blood/Alcohol Testing 4,369.00 101-2001-60176 Sheriff - Other 345.70 101-2001-60420 Operating Supplies 550.02 101-2001-61300 Telephone - Utilities 1,030.15 101-2002-60400 Office Supplies -95.88 101-2002-60691 Maintenance/Services 3,181.55 101-2002-61100 Gas - Utilities 85.52 101-2002-61101 Electricity - Utilities 1,981.14 101-2002-61200 Water - Utilities 255.56 101-2002-61304 Mobile/Cell Phones/Satell…270.75 101-2002-61400 Cable - Utilities 132.28 101-3001-60320 Travel & Training 525.00 101-3002-60107 Instructors 1,577.22 101-3002-60420 Operating Supplies 692.64 101-3003-60149 Community Experiences 715.64 101-3005-60112 Landscape Contract 41,890.00 101-3005-60184 Fritz Burns Pool 5,707.00 101-3005-60351 Membership Dues 150.00 101-3005-60423 Supplies-Graffiti and Van…7,296.59 101-3005-60431 Materials/Supplies 4,861.81 101-3005-60690 Uniforms 390.00 101-3005-60691 Maintenance/Services 6,270.00 101-3005-61102 Electric - Monticello Park -…13.49 101-3005-61103 Electric - Civic Center Park…1,910.49 101-3005-61105 Electric - Fritz Burns Park -…1,077.10 101-3005-61109 Electric - Community Park …1,248.63 101-3005-61111 Electric - Velasco Park - Uti…13.39 258 Demand Register Packet: APPKT02113 - BC 08/30/19 8/30/2019 6:06:20 PM Page 7 of 8 Account Summary Account Number Account Name Expense Amount 101-3005-61113 Electric - Eisenhower Park …20.46 101-3005-61114 Electric - Desert Pride - Uti…13.03 101-3005-61202 Water - Civic Center Park -…3,588.73 101-3005-61203 Water -Eisenhower Park -…236.34 101-3005-61204 Water -Fritz Burns Park - …2,319.99 101-3005-61205 Water -Velasco Park - Utili…72.73 101-3005-61209 Water -Community Park -…9,420.25 101-3007-60461 Marketing & Tourism Pro…9,000.00 101-3008-60115 Janitorial 11,091.38 101-3008-60116 Pest Control 302.00 101-3008-60320 Travel & Training 150.00 101-3008-60431 Materials/Supplies 4,903.96 101-3008-60667 HVAC 4,476.95 101-3008-60690 Uniforms 390.00 101-3008-60691 Maintenance/Services 921.12 101-3008-61101 Electricity - Utilities 14,363.98 101-3008-61200 Water - Utilities 746.75 101-6001-60400 Office Supplies 122.35 101-6003-60118 Plan Checks 1,690.00 101-6004-60103 Professional Services 2,577.55 101-6006-60125 Temporary Agency Servic…2,350.90 101-7002-60183 Map/Plan Checking 2,757.00 101-7003-60420 Operating Supplies 273.81 101-7006-60104 Consultants 2,785.00 101-7006-60144 Contract Traffic Engineer 13,844.00 101-7006-60146 PM 10 - Dust Control 185.28 201-7003-60429 Traffic Control Signs 1,863.39 201-7003-60430 Asphalt 401.85 201-7003-60431 Materials/Supplies 503.69 201-7003-60690 Uniforms 1,925.85 201-7003-61101 Electricity - Utilities 960.78 202-3004-60112 Landscape Contract 910.00 202-3004-60115 Janitorial 2,644.42 202-3004-60667 HVAC 250.00 202-3004-61101 Electricity - Utilities 5,093.54 202-3006-60112 Landscape Contract 190.00 202-3006-60115 Janitorial 698.50 202-3006-61101 Electricity - Utilities 1,384.63 202-3006-61300 Telephone - Utilities 130.24 215-7004-60112 Landscape Contract 11,865.00 215-7004-60431 Materials/Supplies 2,245.55 215-7004-60691 Maintenance/Services 7,376.00 215-7004-61116 Electric - Utilities 3,879.86 215-7004-61117 Electric - Medians - Utiliti…1,926.87 215-7004-61211 Water - Medians - Utilities 20,854.61 224-0000-20320 TUMF Payable to CVAG 32,340.00 235-0000-61101 Electricity - Utilities 246.21 241-9101-60320 Travel & Training 103.70 241-9101-60420 Operating Supplies 108.74 248-9102-60159 Relocation Benefits 89.88 270-0000-60683 APP Maintenance 100.00 270-0000-74800 Art Purchases 9,200.00 401-0000-60103 Professional Services 46,422.50 401-0000-60108 Technical 8,026.82 401-0000-60185 Design 16,004.16 401-0000-60188 Construction 91,286.31 401-0000-74010 Land Acquisition 2,215.00 501-0000-60674 Fuel & Oil 3,062.02 259 Demand Register Packet: APPKT02113 - BC 08/30/19 8/30/2019 6:06:20 PM Page 8 of 8 Account Summary Account Number Account Name Expense Amount 501-0000-60675 Parts & Maintenance Supp…93.72 501-0000-60676 Vehicle Repair & Mainte…511.00 502-0000-60104 Consultants 18,900.00 502-0000-60662 Copiers 3,925.27 502-0000-61301 Cell/Mobile Phones 2,841.37 502-0000-61400 Cable - Utilities 2,845.15 502-0000-71043 Comm. Resources, Softwa…6,992.00 503-0000-71060 Parks 29,000.00 504-1010-60420 Operating Supplies 6.16 601-0000-60455 Bank Fees 59.16 Grand Total:546,806.85 Project Account Summary Project Account Key Expense Amount **None**376,119.42 091004P 372.50 111205D 15,704.16 111205L 2,215.00 111205P 3,997.50 141513P 4,435.00 151603CT 82,745.40 151603P 8,037.50 151609P 1,860.00 151612P 5,555.00 151612T 8,026.82 1819TMICT 0.00 1920CPMCT 8,119.91 1920PMPP 2,635.00 1920STIP 310.00 1920TMICT 421.00 201601P 1,550.00 201602P 1,402.50 201603D 300.00 201603P 972.50 201608P 8,422.50 201701P 795.00 201704P 310.00 201706P 212.50 201709P 155.00 201801P 465.00 201803P 2,480.00 201805P 2,455.00 201913P 310.00 9/11E 95.00 FBPOPSE 5,707.00 GOLFE 620.64 Grand Total:546,806.85 260 9/10/2019 12:16:59 PM Page 1 of 3 Payment Reversal Register City of La Quinta APPKT02100 - BC 08/21/2019 Canceled Payables Vendor Set:01 - Vendor Set 01 Bank:APBNK - APBNK 01290 Vendor Number RIVERSIDE COUNTY SHERIFF'S DEPT-GARNISHMENTS Total Vendor Amount -511.31 Vendor Name Check 123457 08/21/2019 -511.3108/09/2019 08/21/2019 Payment Type Payment Number Original Payment Date Reversal Date Cancel Date Payment Amount Payable Number:Description Payable AmountDue DatePayable Date 0002001-R 08/09/2019GARNISHMENT 162.0008/09/2019 0002002-R 08/09/2019GARNISHMENT 349.3108/09/2019 01367 Vendor Number OFFICE TEAM Total Vendor Amount -2,821.46 Vendor Name Check 122734 08/21/2019 -2,821.4606/07/2019 08/21/2019 Payment Type Payment Number Original Payment Date Reversal Date Cancel Date Payment Amount Payable Number:Description Payable AmountDue DatePayable Date 53518660-R 06/07/201905/24/19 - HR TEMP SVCS A LISTON 993.4605/27/2019 53518753-R 06/07/201905/24/19 - CITY CLERK TEMP SVCS A FELIX 875.2005/27/2019 53541989-R 06/07/201905/24/19 - CODE TEMP SVCS C HARGENS 952.8005/29/2019 08213 Vendor Number ROBERT HALF TECHNOLOGY Total Vendor Amount -1,174.03 Vendor Name Check 122741 08/21/2019 -1,174.0306/07/2019 08/21/2019 Payment Type Payment Number Original Payment Date Reversal Date Cancel Date Payment Amount Payable Number:Description Payable AmountDue DatePayable Date 53536436-R 06/07/201905/24/19 - HUB TEMP SVCS M GONZALEZ 1,174.0305/29/2019 08234 Vendor Number ACCOUNTEMPS Total Vendor Amount -386.24 Vendor Name Check 122698 08/21/2019 -386.2406/07/2019 08/21/2019 Payment Type Payment Number Original Payment Date Reversal Date Cancel Date Payment Amount Payable Number:Description Payable AmountDue DatePayable Date 53556996-R 06/07/201905/31/19 - FINANCE TEMP SVCS A CAMACHO 386.2406/03/2019 08445 Vendor Number STEVE ZABALA Total Vendor Amount -106.60 Vendor Name Check 112584 08/21/2019 -106.6009/30/2016 08/21/2019 Payment Type Payment Number Original Payment Date Reversal Date Cancel Date Payment Amount Payable Number:Description Payable AmountDue DatePayable Date R16251-R 09/30/201606/13/16- REFUND BUSINESS LICENSE 106.6006/13/2016 08507 Vendor Number MAURICIO DURAN Total Vendor Amount -121.00 Vendor Name Check 113106 08/21/2019 -121.0011/18/2016 08/21/2019 Payment Type Payment Number Original Payment Date Reversal Date Cancel Date Payment Amount Payable Number:Description Payable AmountDue DatePayable Date R19854-R 11/18/201611/07/16- REFUND OVERPAYMENT 121.0011/07/2016 261 Payment Reversal Register Packet: APPKT02100 - BC 08/21/2019 9/10/2019 12:16:59 PM Page 2 of 3 08546 Vendor Number WYNDHAM VACATION RENTALS Total Vendor Amount -25.00 Vendor Name Check 113562 08/21/2019 -25.0012/30/2016 08/21/2019 Payment Type Payment Number Original Payment Date Reversal Date Cancel Date Payment Amount Payable Number:Description Payable AmountDue DatePayable Date R20860-R 12/30/201612/19/16- STVR REFUND OVERPAYMENT 25.0012/19/2016 08694 Vendor Number LE, ANH VIET Total Vendor Amount -9.00 Vendor Name Check 115094 08/21/2019 -9.0005/26/2017 08/21/2019 Payment Type Payment Number Original Payment Date Reversal Date Cancel Date Payment Amount Payable Number:Description Payable AmountDue DatePayable Date R24073-R 05/26/201704/17/17- BUSINESS LIC OVERPAYMENT 9.0004/17/2017 08783 Vendor Number SAN'S AIR CONDITIONING & HEATING Total Vendor Amount -216.27 Vendor Name Check 115999 08/21/2019 -216.2708/25/2017 08/21/2019 Payment Type Payment Number Original Payment Date Reversal Date Cancel Date Payment Amount Payable Number:Description Payable AmountDue DatePayable Date R27047-R 08/25/201708/07/17- REFUND OVERPAYMENT 216.2708/07/2017 08875 Vendor Number CASTRO, LARRY Total Vendor Amount -12.00 Vendor Name Check 116950 08/21/2019 -12.0012/08/2017 08/21/2019 Payment Type Payment Number Original Payment Date Reversal Date Cancel Date Payment Amount Payable Number:Description Payable AmountDue DatePayable Date R29822-R 12/08/201711/29/17- REFUND OVERPAYMENT 12.0011/29/2017 262 Payment Reversal Register Packet: APPKT02100 - BC 08/21/2019 9/10/2019 12:16:59 PM Page 3 of 3 Bank Code Summary Canceled Payables Payables Left To Pay AgainBank Code Total APBNK -5,382.91 0.00 -5,382.91 -5,382.91 0.00Report Total:-5,382.91 263 City of La Quinta Bank Transactions 07/27/19 – 08/30/19 Wire Transaction Listed below are the wire transfers from 07/27/19 – 08/30/19 Wire Transfers: 07/30/2019 - WIRE TRANSFER - TASC 1,782.99$ 07/30/2019 - WIRE TRANSFER - PERS 164.17$ 08/07/2019 - WIRE TRANSFER - LANDMARK 206,256.77$ 08/09/2019 - WIRE TRANSFER - ICMA 9,589.89$ 08/09/2019 - WIRE TRANSFER - LQCEA 459.00$ 08/12/2019 - WIRE TRANSFER - PERS 117,835.26$ 08/12/2019 - WIRE TRANSFER - PERS 45,416.83$ 08/12/2019 - WIRE TRANSFER - PERS 20,000.00$ 08/12/2019 - WIRE TRANSFER - PERS 10,000.00$ 08/13/2019 - WIRE TRANSFER - TASC 1,782.99$ 08/15/2019 - WIRE TRANSFER - US BANK 13,118,685.03$ 08/15/2019 - WIRE TRANSFER - STIFEL 1,242,000.00$ 08/20/2019 - WIRE TRANSFER - CITY NATIONAL BANK 37,410.00$ 08/20/2019 - WIRE TRANSFER - LAWYERS TITLE 34,431.96$ 08/22/2019 - WIRE TRANSFER - LANDMARK 161,556.73$ 08/23/2019 - WIRE TRANSFER - ICMA 4,724.22$ 08/23/2019 - WIRE TRANSFER - LQCEA 459.00$ 08/23/2019 - WIRE TRANSFER - PERS 43,650.82$ 08/26/2019 - WIRE TRANSFER - PARS 6,540,000.00$ 08/26/2019 - WIRE TRANSFER - STIFEL 488,986.13$ 08/26/2019 - WIRE TRANSFER - TASC 1,782.97$ 08/27/2019 - WIRE TRANSFER - STIFEL 249,000.00$ 08/28/2019 - WIRE TRANSFER - LAWYERS TITLE 45,310.00$ 08/28/2019 - WIRE TRANSFER - FIRST AMERICAN 30,255.26$ 08/28/2019 - WIRE TRANSFER - PERS 1,050.00$ 08/28/2019 - WIRE TRANSFER - PERS 122.74$ TOTAL WIRE TRANSFERS OUT 22,412,712.76$ Attachment 2 264 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: RECEIVE AND FILE FOURTH QUARTER 2018/19 TREASURY REPORTS FOR APRIL, MAY, AND JUNE 2019 WITH FISCAL YEAR-END SUMMARY RECOMMENDATION Receive and file the fourth quarter fiscal year 2018/19 Treasury Reports for April, May, and June 2019 with fiscal year-end summary. BACKGROUND/ANALYSIS Commentary and Summary of Significant Activity The total book value of the portfolio increased $22.60 million, from $140.80 million at the end of March to $163.40 million at the end of June. An increase of $13.12 million was due to a Redevelopment Property Tax Trust Fund (RPTTF) pass-through apportionment payment which funds debt service obligations that are paid in August. The remainder of the increase reflects revenue, expenditure, and investment activities during the quarter. The portfolio is within policy limits for investment types and total allocation by type (see chart below), and is also within policy guidelines for investment ratings. Investment Type April May June Allowed Bank Accounts 3.11% 2.26% 2.81% 85% Local Agency Investment Fund (LAIF) Housing 11.31% 11.07% 10.01% (1)(2) Local Agency Investment Fund (LAIF) City 34.22% 33.49% 35.19% (1) Federal Agency Coupons 15.43% 14.76% 13.36% 30% Treasury Coupons 10.28% 10.06% 9.10% 100% Certificates of Deposit (CD's)14.33% 13.88% 13.62% 30% Corporate Notes 2.31% 2.26% 2.35% 10% Money Market Pool Accounts-CAMP (new)7.93% 11.16% 12.57% 20% Money Market with Fiscal Agent 0.00% 0.00% 0.00% (2) Managed Pool Accounts-OPEB Trust 1.09% 1.07% 1.00% (3) Total 100% 100% 100% (2) Funds held by fiscal agent and the LAIF Housing funds are governed by bond indentures and not subject to City Investment Policy (3) OPEB trust is a fiduciary account and not subject to City Investment Policy Portfolio Allocations (1) LAIF is subject to maximum dollar amount not a percentage of the portfolio CONSENT CALENDAR ITEM NO. 15 265 The market continued to react to the political climate and economic news, and staff worked with the City’s broker to capitalize on market conditions. The fiscal year annual effective rate of return is 2.04% as of June, a 7 basis point (bps) increase since March (Q3). Throughout the quarter, nine CDs, two agency bonds, and one treasury matured, and one agency bond was called for a total PAR value of $5,176,000. This money, along with an additional $1.5 million was used to purchase 21 new investments, which are listed in detail in the attached reports. Year-End Summary Rising interest rates during the first half of the fiscal year continued to be of benefit to the City; as investments matured they were replaced at rates as much as 100-175 bps higher. The City worked throughout 2018-19 to increase holdings, particularly in negotiable CDs, to capitalize on the climbing rates. Also, the City opened a local government investment pool (LGIP) account with the California Asset Management Program (CAMP) in order to take advantage of slightly higher yields than the state-run local agency investment fund (LAIF), while maintaining the liquidity required for operations. Overall, the average effective rate of return for the entire portfolio increased 73 bps from fiscal 2017-18 to 2018-19. However, during the second half of the fiscal year treasury rates have dropped considerably. Going forward, we anticipate the drop will affect new investments, as well as holdings in government pools (CAMP/LAIF) and could negatively impact the effective rate of return by as much as 40 bps in 2019- 20. Total Earnings Average Days to Maturity Effective Rate of Return YTD April 252,987$ 336 1.99% May 269,361$ 327 2.01% June 296,405$ 313 2.04% Quarter 818,753$ 325 2.01% 2016-17 2017-18 2018-19 Average Daily Balance 125,445,981$ 131,713,765$ 141,628,303$ Total Earnings 963,022$ 1,730,509$ 2,894,323$ Effective Rate of Return 0.77%1.31%2.04% 266 Other Notes Money market funds with the fiscal agent are bond proceeds subject to bond indentures, not the City’s investment policy. Successor Agency (SA) funds cannot be invested long-term; therefore SA funds are only invested in LAIF. Looking Ahead The Treasurer follows a “buy and hold” Investment Policy, unless it is fiscally advantageous to actively trade outside of maturity dates. In the short term, the Treasurer will invest in CAMP and LAIF as needed. Longer term investments may include Government Sponsored Enterprise (agencies) securities, U.S. Treasuries, Corporate Notes, and Negotiable Certificates of Deposits. All investments recognize both immediate and long-term cash flow needs, and there is sufficient liquidity in the portfolio to meet expenditure requirements for the next six months. ALTERNATIVES - None Prepared by: Rosemary Hallick, Financial Services Analyst Approved by: Karla Romero, Finance Director/City Treasurer Attachment: 1. Treasurer’s Report for April 1, 2019 to June 30, 2019 267 268 ATTACHMENT 1ATTACHMENT 1 269 Days to Maturity Page 1 Par Value Book Value Maturity Date Stated RateMarket Value April 30, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date Bank Accounts 1City Petty Cash1059 3,300.00 3,300.0007/01/2016 3,300.00 1SYS1059 0.000 1First Empire Bank1060 0.00 0.0007/01/2016 0.00 1SYS1060 0.000 1La Quinta Palms Realty1062 249,851.30 249,851.3007/01/2016 249,851.30 1SYS1062 0.000 1Stifel, Nicolaus & Company1183 -248,000.00 -248,000.0003/18/2019 -248,000.00 1SYS1183 0.000 1Wells Fargo1057 4,489,649.56 4,489,649.5607/01/2016 4,489,649.56 14159282482 0.000 4,494,800.86 14,494,800.864,494,800.862,669,284.32Subtotal and Average 1 0.000 Local Agency Invstmnt Fund-Housing 1Local Agency Inv Fund1113 16,363,851.43 16,363,851.43 2.44516,319,382.05 125-33-005 2.445 16,363,851.43 116,319,382.0516,363,851.4316,316,247.84Subtotal and Average 1 2.445 Local Agency Investment Fund-City 1Local Agency Inv Fund1055 49,505,436.60 49,505,436.60 2.44549,412,935.65 198-33-434 2.445 49,505,436.60 149,412,935.6549,505,436.6049,359,960.35Subtotal and Average 1 2.445 Federal Agency Coupon Securities 72Federal Farm Credit Bank1092 1,000,000.00 992,600.00 07/12/20191.08007/10/2017 997,340.00 7323133EGLC7 1.456 854Federal Farm Credit Bank1105 1,000,000.00 992,200.00 09/01/20211.70011/09/2017 985,670.00 1,3923133EHWM1 1.913 50Federal Farm Credit Bank1141 500,000.00 494,750.00 06/20/20191.21005/31/2018 499,165.00 3853133EGFU4 2.224 373Federal Farm Credit Bank1142 500,000.00 491,750.00 05/08/20201.55005/31/2018 495,915.00 7083133EHJA2 2.427 1,588Federal Farm Credit Bank1158 250,000.00 247,275.00 09/05/20232.80010/15/2018 254,112.50 1,7863133EJYL7 3.041 728Federal Home Loan Bank1053 2,500,000.00 2,491,250.00 04/28/20211.35004/28/2016 2,453,725.00 1,8263130A7QZ1 1.423 544Federal Home Loan Bank1064 2,500,000.00 2,500,000.00 10/26/20201.37510/26/2016 2,463,750.00 1,4613130A9UQ2 1.375 499Federal Home Loan Bank1104 1,000,000.00 996,800.00 09/11/20201.62511/09/2017 990,090.00 1,0373130A66T9 1.741 1,399Federal Home Loan Bank1121 1,000,000.00 999,000.00 02/28/20232.62504/02/2018 1,000,210.00 1,7933130ADMF6 2.596 1,749Federal Home Loan Bank1177 500,000.00 498,550.00 02/13/20242.50003/01/2019 503,550.00 1,8103130AFW94 2.563 728Federal Home Loan Mtg Corp1054 2,500,000.00 2,500,000.00 04/28/20211.50004/28/2016 2,488,925.00 1,8263134G8Y37 1.400 1,063Federal Home Loan Mtg Corp1073 2,000,000.00 1,990,000.00 03/29/20222.00003/29/2017 1,982,380.00 1,8263134GBAE2 2.106 973Federal Home Loan Mtg Corp1084 1,000,000.00 999,500.00 12/29/20212.00007/06/2017 990,590.00 1,6373134GBXF4 2.012 1,183Federal Home Loan Mtg Corp1090 1,000,000.00 1,000,000.00 07/27/20222.15007/27/2017 994,240.00 1,8263134GBWG3 2.150 1,370Federal Home Loan Mtg Corp1116 1,000,000.00 1,000,000.00 01/30/20232.55001/30/2018 1,000,010.00 1,8263134GSCD5 2.550 1,394Federal Home Loan Mtg Corp1122 750,000.00 746,625.00 02/23/20232.75004/02/2018 750,127.50 1,7883134GSCQ6 2.849 1,245Federal Home Loan Mtg Corp1156 400,000.00 398,800.00 09/27/20223.00010/15/2018 400,892.00 1,4433134GSWS0 3.081 271Federal National Mtg Assn1072 2,000,000.00 2,000,000.00 01/27/20201.70003/27/2017 1,988,680.00 1,0363135G0S53 1.700 134Federal National Mtg Assn1139 500,000.00 496,700.00 09/12/20191.75005/31/2018 498,655.00 4693135G0ZG1 2.275 93Federal National Mtg Assn1140 500,000.00 492,000.00 08/02/20190.87505/31/2018 497,950.00 4283135G0N33 2.269 Portfolio CITY CP Run Date: 08/28/2019 - 12:45 PM (PRF_PM2) 7.3.0 Report Ver. 7.3.6.1 ATTACHMENT 1 270 Days to Maturity Page 2 Par Value Book Value Maturity Date Stated RateMarket Value April 30, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date 22,327,800.00 1,47522,235,977.0022,400,000.0022,558,916.67Subtotal and Average 766 1.898 Treasury Coupon Securities 791U.S. Treasury1045 5,000,000.00 5,000,000.00 06/30/20211.12507/18/2016 4,881,450.00 1,808912828S27 1.125 335U.S. Treasury1068 2,500,000.00 2,483,250.00 03/31/20201.37503/20/2017 2,476,475.00 1,107912828J84 1.602 228U.S. Treasury1069 2,500,000.00 2,490,750.00 12/15/20191.37503/20/2017 2,483,500.00 1,000912828U73 1.513 914U.S. Treasury1070 2,000,000.00 1,942,800.00 10/31/20211.25003/27/2017 1,951,480.00 1,679912828T67 1.903 472U.S. Treasury1117 1,000,000.00 985,800.00 08/15/20201.50001/22/2018 989,340.00 9369128282Q2 2.071 30U.S. Treasury1130 1,000,000.00 992,600.00 05/31/20191.50005/10/2018 999,240.00 386912828WL0 2.211 365U.S. Treasury1138 500,000.00 488,250.00 04/30/20201.12505/31/2018 493,790.00 700912828VA5 2.387 1,248U.S. Treasury1178 500,000.00 489,687.50 09/30/20221.87503/01/2019 493,965.00 1,3099128282W9 2.480 14,873,137.50 1,33314,769,240.0015,000,000.0014,873,137.50Subtotal and Average 566 1.593 Certificate of Deposits 19First Business Bank1019 240,000.00 240,000.00 05/20/20191.75005/20/2014 239,930.40 1,82631938QH72 1.751 204First Farmers Bank &Trust Co.1091 240,000.00 240,000.00 11/21/20191.65007/21/2017 239,008.80 853320165HX4 1.653 1,541First National Bank of America1147 245,000.00 245,000.00 07/20/20233.15007/20/2018 248,650.50 1,82632110YLK9 3.152 1,465First National Bank1179 248,000.00 248,000.00 05/05/20232.80003/05/2019 248,367.04 1,52232117BCX4 2.802 931First Source Bank1168 245,000.00 245,000.00 11/17/20213.15012/17/2018 248,618.65 1,06633646CKP8 3.153 537First Tech Federal Credit Unio1124 245,000.00 245,000.00 10/19/20202.70004/18/2018 245,850.15 91533715LBJ8 2.623 1,006Third Federal Savings and Loan1112 245,000.00 245,000.00 01/31/20222.50001/30/2018 244,480.60 1,46288413QBY3 2.502 1,139Allegiance Bank1143 245,000.00 245,000.00 06/13/20223.10006/13/2018 248,407.95 1,46101748DBE5 3.102 1,261Alliance Credit Union1095 245,000.00 245,000.00 10/13/20222.25010/13/2017 241,530.80 1,82601859BAA3 2.251 677Ally Bank Midvale1176 245,000.00 245,000.00 03/08/20212.50003/07/2019 245,142.10 73202007GHX4 2.016 719Amex Centurion1077 240,000.00 240,000.00 04/19/20212.25004/19/2017 238,322.40 1,46102587DP85 2.252 1,216American Express Fed Savings B1096 240,000.00 240,000.00 08/29/20222.40008/29/2017 236,599.20 1,82602587CFU9 2.402 1,421Aneca Federal Credit Union1119 245,000.00 245,000.00 03/22/20232.80003/22/2018 245,494.90 1,826034577AH9 2.802 1,273Barclays Bank1097 240,000.00 240,000.00 10/25/20222.30010/25/2017 236,930.40 1,82606740KLJ4 2.291 1,703Bar Harbor Bank and Trust1172 248,000.00 248,000.00 12/29/20233.35012/31/2018 253,887.52 1,824066851WJ1 3.352 936Belmont Savings Bank1102 245,000.00 245,000.00 11/22/20212.10011/21/2017 242,258.45 1,462080515CD9 2.101 1,030BMW Bank1067 240,000.00 240,000.00 02/24/20222.20002/24/2017 237,470.40 1,82605580AGK4 2.201 624Bankers Bank1086 240,000.00 240,000.00 01/14/20211.80007/14/2017 237,340.80 1,28006610RAP4 1.804 768Capital One Natl Assn FDIC42971082 240,000.00 240,000.00 06/07/20212.25006/07/2017 238,845.60 1,46114042RGD7 2.252 406Capital One USA FDIC339541006 245,000.00 245,000.00 06/10/20201.90006/10/2015 243,652.50 1,827140420RX0 1.902 663Comenity Capital Bank1009 240,000.00 240,000.00 02/22/20211.70002/22/2016 236,745.60 1,82720033APG5 1.702 1,441Citibank NA1123 245,000.00 245,000.00 04/11/20232.90004/11/2018 246,342.60 1,82617312QJ26 2.902 23City National Bank of Florida1132 240,000.00 240,000.00 05/24/20192.20005/24/2018 239,983.20 36517801DDT0 2.200 Portfolio CITY CP Run Date: 08/28/2019 - 12:45 PM (PRF_PM2) 7.3.0 271 Days to Maturity Page 3 Par Value Book Value Maturity Date Stated RateMarket Value April 30, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date Certificate of Deposits 805Central State Bank1085 240,000.00 240,000.00 07/14/20211.85007/14/2017 236,656.80 1,46115523RBJ4 1.851 1,659Commercial Bank1162 248,000.00 248,000.00 11/15/20233.40011/15/2018 254,358.72 1,82620143PDV9 3.402 1,458Congressional Bank1189 248,000.00 248,000.00 04/28/20232.50004/30/2019 245,569.60 1,45920726ABA5 2.502 35Connect One1011 248,000.00 248,000.00 06/05/20191.50006/05/2015 247,848.72 1,46120786ABD6 1.501 1,297CrossFirst Bank1106 245,000.00 245,000.00 11/18/20222.20011/20/2017 240,893.80 1,82422766ACB9 2.201 1,007Discover Bank Greenwood DE CF1066 240,000.00 240,000.00 02/01/20222.25002/01/2017 237,900.00 1,8262546722U1 2.251 265Douglas National Bank1093 240,000.00 240,000.00 01/21/20201.65007/19/2017 238,668.00 916259744DS6 1.655 630Eagle Bank1146 245,000.00 245,000.00 01/20/20212.85007/20/2018 246,590.05 91527002YDV5 2.858 1,458EnerBank USA1125 240,000.00 240,000.00 04/28/20232.95004/30/2018 241,730.40 1,82429278TAY6 2.952 1,307Enterprise Bank, NA1107 245,000.00 245,000.00 11/28/20222.15011/28/2017 240,416.05 1,82629367QCP1 2.151 401EverBank1017248,000.00 248,000.00 06/05/20201.70006/05/2015 245,986.24 1,82729976DXX3 1.702 628Farm Bureau Bank1165 248,000.00 248,000.00 01/18/20213.00012/17/2018 250,229.52 763307660LC2 2.898 1,094Farmers Insurance Group FCU1126 240,000.00 240,000.00 04/29/20222.80004/30/2018 241,281.60 1,46030960QAG2 2.802 601Freedom Credit Union1111 245,000.00 245,000.00 12/22/20202.05012/22/2017 243,373.20 1,09635638BAA9 2.052 19Gulf Coast Bank1024 240,000.00 240,000.00 05/20/20191.75005/19/2014 239,932.80 1,827402194EB6 1.724 838General Electric Credit Union1150 240,000.00 240,000.00 08/16/20213.10008/15/2018 243,139.20 1,097369674AV8 3.100 1,091Goldman Sachs1078 240,000.00 240,000.00 04/26/20222.40004/26/2017 238,531.20 1,82638148PJK4 2.401 439First Bank of Highland1094 240,000.00 240,000.00 07/13/20201.75007/13/2017 238,000.80 1,096319141GT8 1.752 1,170HSBC Bank USA, National Associ1088 240,000.00 240,000.00 07/14/20222.30007/14/2017 237,477.60 1,82640434YLE5 2.301 1,632Jefferson Financial CU1154 245,000.00 245,000.00 10/19/20233.35010/19/2018 250,703.60 1,826474067AQ8 3.352 377Jefferson Bank & Trust1100 245,000.00 245,000.00 05/12/20201.75011/09/2017 243,253.15 915472376AC6 1.751 1,112Kansas State Bank1101 245,000.00 245,000.00 05/17/20222.10011/17/2017 241,261.30 1,64250116CBE8 2.099 1,338Knoxville TVA Credit Union1110 245,000.00 245,000.00 12/29/20222.40012/29/2017 242,341.75 1,826499724AB8 2.401 1,034Maine Savings FCU1171 248,000.00 248,000.00 02/28/20223.30012/28/2018 252,791.36 1,158560507AK1 3.306 1,822Main Street Bank1188 248,000.00 248,000.00 04/26/20242.60004/26/2019 245,358.80 1,82756065GAG3 2.603 1,630Marlin Business Bank1155 248,000.00 248,000.00 10/17/20233.30010/17/2018 253,274.96 1,82657116ARV2 3.302 1,316Medallion Bank1169 248,000.00 248,000.00 12/07/20223.40012/07/2018 253,929.68 1,46158404DCX7 3.402 433Mercantile Bank of Michigan1087 240,000.00 240,000.00 07/07/20201.75007/07/2017 238,029.60 1,09658740XZL7 1.752 408Bank Midwest1002 248,000.00 248,000.00 06/12/20201.65006/12/2015 245,810.16 1,827063615AVO 1.652 201Morgan Stanley Bank1109 245,000.00 245,000.00 11/18/20191.80011/16/2017 244,208.65 73261747MA92 1.800 1,511Morton Community1173 248,000.00 248,000.00 06/20/20232.75003/20/2019 247,809.04 1,553619165JD6 2.753 1,276Merrick Bank1163 248,000.00 248,000.00 10/28/20223.25010/30/2018 252,657.44 1,45959013J4K2 3.252 201Morgan Stanley Private Bk, NA1108 245,000.00 245,000.00 11/18/20191.75011/16/2017 244,142.50 73261760AEP0 1.750 1,287Mountain America Federal CU1099 245,000.00 245,000.00 11/08/20222.30011/08/2017 241,783.15 1,82662384RAC0 2.301 1,630Municipal Trust and Savings1160 245,000.00 245,000.00 10/17/20233.20010/17/2018 249,184.60 1,826625925AR3 3.202 965Neighbors FCU1167 245,000.00 245,000.00 12/21/20213.20012/21/2018 248,959.20 1,09664017AAQ7 3.203 Portfolio CITY CP Run Date: 08/28/2019 - 12:45 PM (PRF_PM2) 7.3.0 272 Days to Maturity Page 4 Par Value Book Value Maturity Date Stated RateMarket Value April 30, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date Certificate of Deposits 1,695National Cooperative Bank, N.A1170 245,000.00 245,000.00 12/21/20233.40012/21/2018 251,298.95 1,826635573AL2 3.402 1,672Numerica Credit Union1164 248,000.00 248,000.00 11/28/20233.55011/28/2018 255,975.68 1,82667054NAN3 3.552 909Northpointe Bank1127 240,000.00 240,000.00 10/26/20212.70004/26/2018 240,919.20 1,279666613GV0 2.703 1,749Northwest Bank1181 248,000.00 248,000.00 02/13/20242.95002/13/2019 249,492.96 1,82666736ABP3 2.951 1,552Bank of New England1151 249,000.00 249,000.00 07/31/20233.25007/31/2018 253,713.57 1,82606426KAN8 3.252 994The Ohio Valley Bank1089 240,000.00 240,000.00 01/19/20221.90007/19/2017 235,749.60 1,645677721CN0 1.903 1,134PCSB Bank1149 245,000.00 245,000.00 06/08/20223.00006/08/2018 247,697.45 1,46169324MAD7 3.002 27Peapack-Gladstone Bank1031 240,000.00 240,000.00 05/28/20191.80005/28/2014 239,952.00 1,826704692AL6 1.801 756PrivateBank & Trust1032 240,000.00 240,000.00 05/26/20211.50005/26/2016 235,752.00 1,82674267GVG9 1.501 1,511RCB Bank1144 245,000.00 245,000.00 06/20/20233.15006/20/2018 248,638.25 1,82674934YAH4 3.152 1,316Red Rocks Credit Union1166 248,000.00 248,000.00 12/07/20223.35012/07/2018 253,503.12 1,46175701LAB3 3.352 572First Bank Richmond1081 245,000.00 245,000.00 11/23/20201.80006/21/2017 242,510.80 1,251319267GC8 1.802 127Riverwood1034248,000.00 248,000.00 09/05/20191.40006/05/2015 247,444.48 1,55376951DAL4 1.402 1,147Sallie Mae Bank Salt Lake CIty1083 240,000.00 240,000.00 06/21/20222.35006/21/2017 237,940.80 1,826795450A70 2.351 34Solomon State1035 248,000.00 248,000.00 06/04/20191.40006/04/2015 247,853.68 1,46183427LAX2 1.401 356Stearnes Bank, N.A.1076 240,000.00 240,000.00 04/21/20201.60004/21/2017 238,041.60 1,096857894TC3 1.588 1,128Synchrony Bank Retail1080 240,000.00 240,000.00 06/02/20222.40006/02/2017 238,382.40 1,82687164XQV1 2.401 730Towne Bank1128 240,000.00 240,000.00 04/30/20212.80004/30/2018 241,543.20 1,09689214PBL2 2.803 1,195Traditions Bank1148 245,000.00 245,000.00 08/08/20223.00006/08/2018 247,648.45 1,52289269CBX9 3.002 1,630UBS Bank USA1161 245,000.00 245,000.00 10/17/20233.35010/17/2018 250,725.65 1,82690348JEJ5 3.352 15Union BankNA1136 240,000.00 240,000.00 05/16/20192.20005/16/2018 239,988.00 36590521AQW1 2.200 685Unity Bank1120 245,000.00 245,000.00 03/16/20212.55003/16/2018 245,369.95 1,09691330ABN6 2.552 1,475University of Iowa Comm. CU1134 240,000.00 240,000.00 05/15/20233.05005/14/2018 242,632.80 1,82791435LAG2 3.052 1,399Verus Bank of Commerce1180 248,000.00 248,000.00 02/28/20232.70002/28/2019 247,677.60 1,46192535LCD4 2.700 1,763Wells Fargo1174 248,000.00 248,000.00 02/27/20243.00002/27/2019 249,557.44 1,826949763XY7 3.001 411Wex Bank1145 245,000.00 245,000.00 06/15/20202.75006/13/2018 245,801.15 73392937CHG6 2.754 20,737,000.00 1,48620,763,754.5820,737,000.0020,682,066.67Subtotal and Average 960 2.474 Corporate Notes 826Apple Inc1079 500,000.00 493,050.00 08/04/20211.55006/12/2017 489,490.00 1,514037833CC2 1.900 1,372Colgate-Palmolive1175 500,000.00 485,250.00 02/01/20231.95003/04/2019 491,075.00 1,43019416QEA4 2.751 281Microsoft Corporation1118 500,000.00 497,700.00 02/06/20201.85001/22/2018 497,440.00 745594918BV5 2.081 1,560Microsoft Corporation1157 400,000.00 378,360.00 08/08/20232.00010/15/2018 390,640.00 1,758594918BQ6 3.222 1,012Proctor and Gamble1159 500,000.00 487,950.00 02/06/20222.30010/15/2018 497,585.00 1,210742718DY2 3.071 170Toyota Motor Credit Corp1098 500,000.00 498,750.00 10/18/20191.55011/07/2017 497,380.00 71089236TDH5 1.681 1,324Wal-Mart Stores, Inc1190 500,000.00 496,650.00 12/15/20222.35004/16/2019 496,120.00 1,339931142DU4 2.799 Portfolio CITY CP Run Date: 08/28/2019 - 12:45 PM (PRF_PM2) 7.3.0 273 Days to Maturity Page 5 Par Value Book Value Maturity Date Stated RateMarket Value April 30, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date 3,337,710.00 1,2243,359,730.003,400,000.003,089,385.00Subtotal and Average 911 2.473 Money Market Accounts 1California Asset Management Pr1153 11,466,785.63 11,466,785.6309/26/2018 11,466,785.63 1SYS1153 0.000 11,466,785.63 111,466,785.6311,466,785.639,780,307.32Subtotal and Average 1 0.000 Money Market with Fiscal Agent 1US Bank1058 1,668.83 1,668.8307/01/2016 1,668.83 1SYS1058 0.000 1,668.83 11,668.831,668.831,666.66Subtotal and Average 1 0.000 Managed Pool Accounts-OPEB Trust 1CalPERS CERBT Plan1114 1,574,839.50 1,574,839.5007/01/2018 1,574,839.50 1SYS1114 0.000 1,574,839.50 11,574,839.501,574,839.501,574,839.50Subtotal and Average 1 0.000 607140,905,811.82 144,944,382.85 336 1.981144,399,114.10 144,683,030.35Total and Average Portfolio CITY CP Run Date: 08/28/2019 - 12:45 PM (PRF_PM2) 7.3.0 274 275 Days to Maturity Page 1 Par Value Book Value Maturity Date Stated RateMarket Value May 31, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date Bank Accounts 1City Petty Cash1059 3,300.00 3,300.0007/01/2016 3,300.00 1SYS1059 0.000 1First Empire Bank1060 0.00 0.0007/01/2016 0.00 1SYS1060 0.000 1La Quinta Palms Realty1062 248,920.45 248,920.4507/01/2016 248,920.45 1SYS1062 0.000 1Stifel, Nicolaus & Company1183 0.00 0.0003/18/2019 0.00 1SYS1183 0.000 1Wells Fargo1057 3,090,085.49 3,090,085.4907/01/2016 3,090,085.49 14159282482 0.000 3,342,305.94 13,342,305.943,342,305.944,304,683.81Subtotal and Average 1 0.000 Local Agency Invstmnt Fund-Housing 1Local Agency Inv Fund1113 16,363,851.43 16,363,851.43 2.44916,319,382.05 125-33-005 2.449 16,363,851.43 116,319,382.0516,363,851.4316,363,851.43Subtotal and Average 1 2.449 Local Agency Investment Fund-City 1Local Agency Inv Fund1055 49,505,436.60 49,505,436.60 2.44949,412,935.65 198-33-434 2.449 49,505,436.60 149,412,935.6549,505,436.6049,505,436.60Subtotal and Average 1 2.449 Federal Agency Coupon Securities 41Federal Farm Credit Bank1092 1,000,000.00 992,600.00 07/12/20191.08007/10/2017 998,650.00 7323133EGLC7 1.456 823Federal Farm Credit Bank1105 1,000,000.00 992,200.00 09/01/20211.70011/09/2017 993,400.00 1,3923133EHWM1 1.913 19Federal Farm Credit Bank1141 500,000.00 494,750.00 06/20/20191.21005/31/2018 499,730.00 3853133EGFU4 2.224 342Federal Farm Credit Bank1142 500,000.00 491,750.00 05/08/20201.55005/31/2018 496,555.00 7083133EHJA2 2.427 1,557Federal Farm Credit Bank1158 250,000.00 247,275.00 09/05/20232.80010/15/2018 258,335.00 1,7863133EJYL7 3.041 1,249Federal Farm Credit Bank1191 500,000.00 492,100.00 11/01/20221.70005/28/2019 494,850.00 1,2533133EGD28 2.181 697Federal Home Loan Bank1053 2,500,000.00 2,491,250.00 04/28/20211.35004/28/2016 2,470,350.00 1,8263130A7QZ1 1.423 513Federal Home Loan Bank1064 2,500,000.00 2,500,000.00 10/26/20201.37510/26/2016 2,475,850.00 1,4613130A9UQ2 1.375 468Federal Home Loan Bank1104 1,000,000.00 996,800.00 09/11/20201.62511/09/2017 994,150.00 1,0373130A66T9 1.741 1,718Federal Home Loan Bank1177 500,000.00 498,550.00 02/13/20242.50003/01/2019 511,360.00 1,8103130AFW94 2.563 697Federal Home Loan Mtg Corp1054 2,500,000.00 2,500,000.00 04/28/20211.50004/28/2016 2,495,975.00 1,8263134G8Y37 1.400 1,032Federal Home Loan Mtg Corp1073 2,000,000.00 1,990,000.00 03/29/20222.00003/29/2017 1,999,780.00 1,8263134GBAE2 2.106 942Federal Home Loan Mtg Corp1084 1,000,000.00 999,500.00 12/29/20212.00007/06/2017 998,970.00 1,6373134GBXF4 2.012 1,152Federal Home Loan Mtg Corp1090 1,000,000.00 1,000,000.00 07/27/20222.15007/27/2017 1,000,130.00 1,8263134GBWG3 2.150 1,339Federal Home Loan Mtg Corp1116 1,000,000.00 1,000,000.00 01/30/20232.55001/30/2018 1,000,280.00 1,8263134GSCD5 2.550 1,363Federal Home Loan Mtg Corp1122 750,000.00 746,625.00 02/23/20232.75004/02/2018 751,005.00 1,7883134GSCQ6 2.849 1,214Federal Home Loan Mtg Corp1156 400,000.00 398,800.00 09/27/20223.00010/15/2018 400,944.00 1,4433134GSWS0 3.081 240Federal National Mtg Assn1072 2,000,000.00 2,000,000.00 01/27/20201.70003/27/2017 1,991,400.00 1,0363135G0S53 1.700 103Federal National Mtg Assn1139 500,000.00 496,700.00 09/12/20191.75005/31/2018 499,035.00 4693135G0ZG1 2.275 62Federal National Mtg Assn1140 500,000.00 492,000.00 08/02/20190.87505/31/2018 498,695.00 4283135G0N33 2.269 Portfolio CITY CP Run Date: 08/28/2019 - 12:57 PM (PRF_PM2) 7.3.0 Report Ver. 7.3.6.1 276 Days to Maturity Page 2 Par Value Book Value Maturity Date Stated RateMarket Value May 31, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date 21,820,900.00 1,45521,829,444.0021,900,000.0022,262,393.55Subtotal and Average 718 1.873 Treasury Coupon Securities 760U.S. Treasury1045 5,000,000.00 5,000,000.00 06/30/20211.12507/18/2016 4,918,950.00 1,808912828S27 1.125 304U.S. Treasury1068 2,500,000.00 2,483,250.00 03/31/20201.37503/20/2017 2,481,250.00 1,107912828J84 1.602 197U.S. Treasury1069 2,500,000.00 2,490,750.00 12/15/20191.37503/20/2017 2,487,025.00 1,000912828U73 1.513 883U.S. Treasury1070 2,000,000.00 1,942,800.00 10/31/20211.25003/27/2017 1,968,280.00 1,679912828T67 1.903 441U.S. Treasury1117 1,000,000.00 985,800.00 08/15/20201.50001/22/2018 992,310.00 9369128282Q2 2.071 334U.S. Treasury1138 500,000.00 488,250.00 04/30/20201.12505/31/2018 494,905.00 700912828VA5 2.387 1,217U.S. Treasury1178 500,000.00 489,687.50 09/30/20221.87503/01/2019 499,630.00 1,3099128282W9 2.480 1,079U.S. Treasury1192 500,000.00 496,650.00 05/15/20221.75005/31/2019 497,715.00 1,080912828SV3 1.984 730U.S. Treasury1193 500,000.00 493,610.00 05/31/20211.37505/31/2019 494,260.00 731912828R77 2.030 14,870,797.50 1,36814,834,325.0015,000,000.0014,873,062.02Subtotal and Average 595 1.579 Certificate of Deposits 173First Farmers Bank &Trust Co.1091 240,000.00 240,000.00 11/21/20191.65007/21/2017 239,138.40 853320165HX4 1.653 1,510First National Bank of America1147 245,000.00 245,000.00 07/20/20233.15007/20/2018 249,429.60 1,82632110YLK9 3.152 1,434First National Bank1179 248,000.00 248,000.00 05/05/20232.80003/05/2019 249,284.64 1,52232117BCX4 2.802 900First Source Bank1168 245,000.00 245,000.00 11/17/20213.15012/17/2018 248,675.00 1,06633646CKP8 3.153 506First Tech Federal Credit Unio1124 245,000.00 245,000.00 10/19/20202.70004/18/2018 245,764.40 91533715LBJ8 2.623 975Third Federal Savings and Loan1112 245,000.00 245,000.00 01/31/20222.50001/30/2018 244,811.35 1,46288413QBY3 2.502 1,108Allegiance Bank1143 245,000.00 245,000.00 06/13/20223.10006/13/2018 248,922.45 1,46101748DBE5 3.102 1,230Alliance Credit Union1095 245,000.00 245,000.00 10/13/20222.25010/13/2017 242,317.25 1,82601859BAA3 2.251 646Ally Bank Midvale1176 245,000.00 245,000.00 03/08/20212.50003/07/2019 245,041.65 73202007GHX4 2.016 688Amex Centurion1077 240,000.00 240,000.00 04/19/20212.25004/19/2017 238,336.80 1,46102587DP85 2.252 1,185American Express Fed Savings B1096 240,000.00 240,000.00 08/29/20222.40008/29/2017 237,393.60 1,82602587CFU9 2.402 1,390Aneca Federal Credit Union1119 245,000.00 245,000.00 03/22/20232.80003/22/2018 246,357.30 1,826034577AH9 2.802 1,242Barclays Bank1097 240,000.00 240,000.00 10/25/20222.30010/25/2017 237,703.20 1,82606740KLJ4 2.291 1,672Bar Harbor Bank and Trust1172 248,000.00 248,000.00 12/29/20233.35012/31/2018 254,445.52 1,824066851WJ1 3.352 905Belmont Savings Bank1102 245,000.00 245,000.00 11/22/20212.10011/21/2017 242,525.50 1,462080515CD9 2.101 999BMW Bank1067 240,000.00 240,000.00 02/24/20222.20002/24/2017 237,900.00 1,82605580AGK4 2.201 593Bankers Bank1086 240,000.00 240,000.00 01/14/20211.80007/14/2017 237,400.80 1,28006610RAP4 1.804 737Capital One Natl Assn FDIC42971082 240,000.00 240,000.00 06/07/20212.25006/07/2017 238,821.60 1,46114042RGD7 2.252 375Capital One USA FDIC339541006 245,000.00 245,000.00 06/10/20201.90006/10/2015 243,755.40 1,827140420RX0 1.902 632Comenity Capital Bank1009 240,000.00 240,000.00 02/22/20211.70002/22/2016 236,808.00 1,82720033APG5 1.702 1,811Century Next Bank1184 248,000.00 248,000.00 05/16/20242.50005/29/2019 244,542.88 1,814156634AK3 2.503 1,410Citibank NA1123 245,000.00 245,000.00 04/11/20232.90004/11/2018 247,209.90 1,82617312QJ26 2.902 Portfolio CITY CP Run Date: 08/28/2019 - 12:57 PM (PRF_PM2) 7.3.0 277 Days to Maturity Page 3 Par Value Book Value Maturity Date Stated RateMarket Value May 31, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date Certificate of Deposits 774Central State Bank1085 240,000.00 240,000.00 07/14/20211.85007/14/2017 236,752.80 1,46115523RBJ4 1.851 1,628Commercial Bank1162 248,000.00 248,000.00 11/15/20233.40011/15/2018 254,968.80 1,82620143PDV9 3.402 1,427Congressional Bank1189 248,000.00 248,000.00 04/28/20232.50004/30/2019 246,541.76 1,45920726ABA5 2.502 4Connect One1011 248,000.00 248,000.00 06/05/20191.50006/05/2015 247,977.68 1,46120786ABD6 1.501 1,266CrossFirst Bank1106 245,000.00 245,000.00 11/18/20222.20011/20/2017 241,726.80 1,82422766ACB9 2.201 976Discover Bank Greenwood DE CF1066 240,000.00 240,000.00 02/01/20222.25002/01/2017 238,272.00 1,8262546722U1 2.251 234Douglas National Bank1093 240,000.00 240,000.00 01/21/20201.65007/19/2017 238,819.20 916259744DS6 1.655 599Eagle Bank1146 245,000.00 245,000.00 01/20/20212.85007/20/2018 246,443.05 91527002YDV5 2.858 1,427EnerBank USA1125 240,000.00 240,000.00 04/28/20232.95004/30/2018 242,594.40 1,82429278TAY6 2.952 1,276Enterprise Bank, NA1107 245,000.00 245,000.00 11/28/20222.15011/28/2017 241,268.65 1,82629367QCP1 2.151 370EverBank1017248,000.00 248,000.00 06/05/20201.70006/05/2015 246,142.48 1,82729976DXX3 1.702 597Farm Bureau Bank1165 248,000.00 248,000.00 01/18/20213.00012/17/2018 250,053.44 763307660LC2 2.898 1,063Farmers Insurance Group FCU1126 240,000.00 240,000.00 04/29/20222.80004/30/2018 241,749.60 1,46030960QAG2 2.802 570Freedom Credit Union1111 245,000.00 245,000.00 12/22/20202.05012/22/2017 243,400.15 1,09635638BAA9 2.052 807General Electric Credit Union1150 240,000.00 240,000.00 08/16/20213.10008/15/2018 243,045.60 1,097369674AV8 3.100 1,060Goldman Sachs1078 240,000.00 240,000.00 04/26/20222.40004/26/2017 239,061.60 1,82638148PJK4 2.401 408First Bank of Highland1094 240,000.00 240,000.00 07/13/20201.75007/13/2017 238,132.80 1,096319141GT8 1.752 1,139HSBC Bank USA, National Associ1088 240,000.00 240,000.00 07/14/20222.30007/14/2017 238,152.00 1,82640434YLE5 2.301 1,818Iowa State Bank1186 245,000.00 245,000.00 05/23/20242.40005/23/2019 240,496.90 1,82746256YAZ2 2.403 1,601Jefferson Financial CU1154 245,000.00 245,000.00 10/19/20233.35010/19/2018 251,340.60 1,826474067AQ8 3.352 346Jefferson Bank & Trust1100 245,000.00 245,000.00 05/12/20201.75011/09/2017 243,395.25 915472376AC6 1.751 1,811JP Morgan Chase1185 245,000.00 245,000.00 05/16/20243.25005/16/2019 244,804.00 1,82748128HXU7 3.254 1,081Kansas State Bank1101 245,000.00 245,000.00 05/17/20222.10011/17/2017 241,908.10 1,64250116CBE8 2.099 1,307Knoxville TVA Credit Union1110 245,000.00 245,000.00 12/29/20222.40012/29/2017 243,184.55 1,826499724AB8 2.401 1,003Maine Savings FCU1171 248,000.00 248,000.00 02/28/20223.30012/28/2018 253,039.36 1,158560507AK1 3.306 1,791Main Street Bank1188 248,000.00 248,000.00 04/26/20242.60004/26/2019 245,869.68 1,82756065GAG3 2.603 1,599Marlin Business Bank1155 248,000.00 248,000.00 10/17/20233.30010/17/2018 253,939.60 1,82657116ARV2 3.302 1,285Medallion Bank1169 248,000.00 248,000.00 12/07/20223.40012/07/2018 254,584.40 1,46158404DCX7 3.402 402Mercantile Bank of Michigan1087 240,000.00 240,000.00 07/07/20201.75007/07/2017 238,164.00 1,09658740XZL7 1.752 377Bank Midwest1002 248,000.00 248,000.00 06/12/20201.65006/12/2015 245,968.88 1,827063615AVO 1.652 170Morgan Stanley Bank1109 245,000.00 245,000.00 11/18/20191.80011/16/2017 244,296.85 73261747MA92 1.800 1,480Morton Community1173 248,000.00 248,000.00 06/20/20232.75003/20/2019 248,694.40 1,553619165JD6 2.753 1,245Merrick Bank1163 248,000.00 248,000.00 10/28/20223.25010/30/2018 253,292.32 1,45959013J4K2 3.252 170Morgan Stanley Private Bk, NA1108 245,000.00 245,000.00 11/18/20191.75011/16/2017 244,238.05 73261760AEP0 1.750 1,256Mountain America Federal CU1099 245,000.00 245,000.00 11/08/20222.30011/08/2017 242,589.20 1,82662384RAC0 2.301 1,599Municipal Trust and Savings1160 245,000.00 245,000.00 10/17/20233.20010/17/2018 249,855.90 1,826625925AR3 3.202 Portfolio CITY CP Run Date: 08/28/2019 - 12:57 PM (PRF_PM2) 7.3.0 278 Days to Maturity Page 4 Par Value Book Value Maturity Date Stated RateMarket Value May 31, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date Certificate of Deposits 934Neighbors FCU1167 245,000.00 245,000.00 12/21/20213.20012/21/2018 249,071.90 1,09664017AAQ7 3.203 1,664National Cooperative Bank, N.A1170 245,000.00 245,000.00 12/21/20233.40012/21/2018 251,855.10 1,826635573AL2 3.402 1,641Numerica Credit Union1164 248,000.00 248,000.00 11/28/20233.55011/28/2018 256,543.60 1,82667054NAN3 3.552 878Northpointe Bank1127 240,000.00 240,000.00 10/26/20212.70004/26/2018 241,020.00 1,279666613GV0 2.703 1,718Northwest Bank1181 248,000.00 248,000.00 02/13/20242.95002/13/2019 250,055.92 1,82666736ABP3 2.951 1,521Bank of New England1151 249,000.00 249,000.00 07/31/20233.25007/31/2018 254,473.02 1,82606426KAN8 3.252 963The Ohio Valley Bank1089 240,000.00 240,000.00 01/19/20221.90007/19/2017 236,160.00 1,645677721CN0 1.903 1,103PCSB Bank1149 245,000.00 245,000.00 06/08/20223.00006/08/2018 248,226.65 1,46169324MAD7 3.002 725PrivateBank & Trust1032 240,000.00 240,000.00 05/26/20211.50005/26/2016 235,814.40 1,82674267GVG9 1.501 1,480RCB Bank1144 245,000.00 245,000.00 06/20/20233.15006/20/2018 249,446.75 1,82674934YAH4 3.152 1,285Red Rocks Credit Union1166 248,000.00 248,000.00 12/07/20223.35012/07/2018 254,167.76 1,46175701LAB3 3.352 541First Bank Richmond1081 245,000.00 245,000.00 11/23/20201.80006/21/2017 242,596.55 1,251319267GC8 1.802 96Riverwood1034248,000.00 248,000.00 09/05/20191.40006/05/2015 247,561.04 1,55376951DAL4 1.402 1,116Sallie Mae Bank Salt Lake CIty1083 240,000.00 240,000.00 06/21/20222.35006/21/2017 238,586.40 1,826795450A70 2.351 3Solomon State1035 248,000.00 248,000.00 06/04/20191.40006/04/2015 247,982.64 1,46183427LAX2 1.401 325Stearnes Bank, N.A.1076 240,000.00 240,000.00 04/21/20201.60004/21/2017 238,216.80 1,096857894TC3 1.588 1,097Synchrony Bank Retail1080 240,000.00 240,000.00 06/02/20222.40006/02/2017 239,001.60 1,82687164XQV1 2.401 699Towne Bank1128 240,000.00 240,000.00 04/30/20212.80004/30/2018 241,358.40 1,09689214PBL2 2.803 1,164Traditions Bank1148 245,000.00 245,000.00 08/08/20223.00006/08/2018 248,238.90 1,52289269CBX9 3.002 905TNB Bank1187 248,000.00 248,000.00 11/22/20212.40005/22/2019 247,278.32 91587266AAA1 2.407 1,599UBS Bank USA1161 245,000.00 245,000.00 10/17/20233.35010/17/2018 251,372.45 1,82690348JEJ5 3.352 654Unity Bank1120 245,000.00 245,000.00 03/16/20212.55003/16/2018 245,257.25 1,09691330ABN6 2.552 1,444University of Iowa Comm. CU1134 240,000.00 240,000.00 05/15/20233.05005/14/2018 243,472.80 1,82791435LAG2 3.052 1,368Verus Bank of Commerce1180 248,000.00 248,000.00 02/28/20232.70002/28/2019 248,545.60 1,46192535LCD4 2.700 1,732Wells Fargo1174 248,000.00 248,000.00 02/27/20243.00002/27/2019 249,862.48 1,826949763XY7 3.001 380Wex Bank1145 245,000.00 245,000.00 06/15/20202.75006/13/2018 245,739.90 73392937CHG6 2.754 20,523,000.00 1,50620,573,256.3220,523,000.0020,612,096.77Subtotal and Average 1,015 2.514 Corporate Notes 795Apple Inc1079 500,000.00 493,050.00 08/04/20211.55006/12/2017 492,460.00 1,514037833CC2 1.900 1,341Colgate-Palmolive1175 500,000.00 485,250.00 02/01/20231.95003/04/2019 495,560.00 1,43019416QEA4 2.751 250Microsoft Corporation1118 500,000.00 497,700.00 02/06/20201.85001/22/2018 498,310.00 745594918BV5 2.081 1,529Microsoft Corporation1157 400,000.00 378,360.00 08/08/20232.00010/15/2018 394,724.00 1,758594918BQ6 3.222 981Proctor and Gamble1159 500,000.00 487,950.00 02/06/20222.30010/15/2018 501,435.00 1,210742718DY2 3.071 139Toyota Motor Credit Corp1098 500,000.00 498,750.00 10/18/20191.55011/07/2017 498,235.00 71089236TDH5 1.681 1,293Wal-Mart Stores, Inc1190 500,000.00 496,650.00 12/15/20222.35004/16/2019 499,535.00 1,339931142DU4 2.799 Portfolio CITY CP Run Date: 08/28/2019 - 12:57 PM (PRF_PM2) 7.3.0 279 Days to Maturity Page 5 Par Value Book Value Maturity Date Stated RateMarket Value May 31, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date 3,337,710.00 1,2243,380,259.003,400,000.003,337,710.00Subtotal and Average 880 2.473 Money Market Accounts 1California Asset Management Pr1153 16,492,314.73 16,492,314.7309/26/2018 16,492,314.73 1SYS1153 0.000 16,492,314.73 116,492,314.7316,492,314.7311,951,480.12Subtotal and Average 1 0.000 Money Market with Fiscal Agent 1US Bank1058 1,671.27 1,671.2707/01/2016 1,671.27 1SYS1058 0.000 1,671.27 11,671.271,671.271,668.91Subtotal and Average 1 0.000 Managed Pool Accounts-OPEB Trust 1CalPERS CERBT Plan1114 1,574,839.50 1,574,839.5007/01/2018 1,574,839.50 1SYS1114 0.000 1,574,839.50 11,574,839.501,574,839.501,574,839.50Subtotal and Average 1 0.000 590144,787,222.70 148,103,419.47 327 1.931147,760,733.46 147,832,826.97Total and Average Portfolio CITY CP Run Date: 08/28/2019 - 12:57 PM (PRF_PM2) 7.3.0 280 281 Days to Maturity Page 1 Par Value Book Value Maturity Date Stated RateMarket Value June 30, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date Bank Accounts 1City Petty Cash1059 3,300.00 3,300.0007/01/2016 3,300.00 1SYS1059 0.000 1First Empire Bank1060 0.00 0.0007/01/2016 0.00 1SYS1060 0.000 1La Quinta Palms Realty1062 242,947.26 242,947.2607/01/2016 242,947.26 1SYS1062 0.000 1Stifel, Nicolaus & Company1183 100,115.92 100,115.9203/18/2019 100,115.92 1SYS1183 0.000 1Wells Fargo1057 4,240,622.94 4,240,622.9407/01/2016 4,240,622.94 14159282482 0.000 4,586,986.12 14,586,986.124,586,986.123,506,341.54Subtotal and Average 1 0.000 Local Agency Invstmnt Fund-Housing 1Local Agency Inv Fund1113 16,363,851.43 16,363,851.43 2.42816,319,382.05 125-33-005 2.428 16,363,851.43 116,319,382.0516,363,851.4316,363,851.43Subtotal and Average 1 2.428 Local Agency Investment Fund-City 1Local Agency Inv Fund1055 57,505,436.60 57,505,436.60 2.42857,412,935.65 198-33-434 2.428 57,505,436.60 157,412,935.6557,505,436.6057,172,103.27Subtotal and Average 1 2.428 Federal Agency Coupon Securities 11Federal Farm Credit Bank1092 1,000,000.00 992,600.00 07/12/20191.08007/10/2017 999,630.00 7323133EGLC7 1.456 793Federal Farm Credit Bank1105 1,000,000.00 992,200.00 09/01/20211.70011/09/2017 997,950.00 1,3923133EHWM1 1.913 312Federal Farm Credit Bank1142 500,000.00 491,750.00 05/08/20201.55005/31/2018 498,175.00 7083133EHJA2 2.427 1,527Federal Farm Credit Bank1158 250,000.00 247,275.00 09/05/20232.80010/15/2018 258,690.00 1,7863133EJYL7 3.041 1,219Federal Farm Credit Bank1191 500,000.00 492,100.00 11/01/20221.70005/28/2019 496,305.00 1,2533133EGD28 2.181 1,260Federal Farm Credit Bank1198 500,000.00 499,500.00 12/12/20221.87506/20/2019 500,855.00 1,2713133EKQP4 1.905 667Federal Home Loan Bank1053 2,500,000.00 2,491,250.00 04/28/20211.35004/28/2016 2,479,300.00 1,8263130A7QZ1 1.423 483Federal Home Loan Bank1064 2,500,000.00 2,500,000.00 10/26/20201.37510/26/2016 2,482,775.00 1,4613130A9UQ2 1.375 438Federal Home Loan Bank1104 1,000,000.00 996,800.00 09/11/20201.62511/09/2017 995,940.00 1,0373130A66T9 1.741 1,688Federal Home Loan Bank1177 500,000.00 498,550.00 02/13/20242.50003/01/2019 515,405.00 1,8103130AFW94 2.563 667Federal Home Loan Mtg Corp1054 2,500,000.00 2,500,000.00 04/28/20211.50004/28/2016 2,498,125.00 1,8263134G8Y37 1.400 1,002Federal Home Loan Mtg Corp1073 2,000,000.00 1,990,000.00 03/29/20222.00003/29/2017 2,000,840.00 1,8263134GBAE2 2.106 912Federal Home Loan Mtg Corp1084 1,000,000.00 999,500.00 12/29/20212.00007/06/2017 1,000,330.00 1,6373134GBXF4 2.012 1,122Federal Home Loan Mtg Corp1090 1,000,000.00 1,000,000.00 07/27/20222.15007/27/2017 1,000,200.00 1,8263134GBWG3 2.150 1,309Federal Home Loan Mtg Corp1116 1,000,000.00 1,000,000.00 01/30/20232.55001/30/2018 1,000,280.00 1,8263134GSCD5 2.550 1,333Federal Home Loan Mtg Corp1122 750,000.00 746,625.00 02/23/20232.75004/02/2018 750,862.50 1,7883134GSCQ6 2.849 1,184Federal Home Loan Mtg Corp1156 400,000.00 398,800.00 09/27/20223.00010/15/2018 400,888.00 1,4433134GSWS0 3.081 210Federal National Mtg Assn1072 2,000,000.00 2,000,000.00 01/27/20201.70003/27/2017 1,994,880.00 1,0363135G0S53 1.700 73Federal National Mtg Assn1139 500,000.00 496,700.00 09/12/20191.75005/31/2018 499,485.00 4693135G0ZG1 2.275 32Federal National Mtg Assn1140 500,000.00 492,000.00 08/02/20190.87505/31/2018 499,395.00 4283135G0N33 2.269 Portfolio CITY CP Run Date: 08/28/2019 - 14:05 PM (PRF_PM2) 7.3.0 Report Ver. 7.3.6.1 282 Days to Maturity Page 2 Par Value Book Value Maturity Date Stated RateMarket Value June 30, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date 21,825,650.00 1,47521,870,310.5021,900,000.0021,822,641.67Subtotal and Average 717 1.865 Treasury Coupon Securities 730U.S. Treasury1045 5,000,000.00 5,000,000.00 06/30/20211.12507/18/2016 4,938,650.00 1,808912828S27 1.125 274U.S. Treasury1068 2,500,000.00 2,483,250.00 03/31/20201.37503/20/2017 2,487,800.00 1,107912828J84 1.602 167U.S. Treasury1069 2,500,000.00 2,490,750.00 12/15/20191.37503/20/2017 2,492,100.00 1,000912828U73 1.513 853U.S. Treasury1070 2,000,000.00 1,942,800.00 10/31/20211.25003/27/2017 1,977,740.00 1,679912828T67 1.903 411U.S. Treasury1117 1,000,000.00 985,800.00 08/15/20201.50001/22/2018 995,390.00 9369128282Q2 2.071 304U.S. Treasury1138 500,000.00 488,250.00 04/30/20201.12505/31/2018 496,330.00 700912828VA5 2.387 1,187U.S. Treasury1178 500,000.00 489,687.50 09/30/20221.87503/01/2019 502,460.00 1,3099128282W9 2.480 1,049U.S. Treasury1192 500,000.00 496,650.00 05/15/20221.75005/31/2019 500,370.00 1,080912828SV3 1.984 700U.S. Treasury1193 500,000.00 493,610.00 05/31/20211.37505/31/2019 496,250.00 731912828R77 2.030 14,870,797.50 1,36814,887,090.0015,000,000.0014,870,797.50Subtotal and Average 565 1.579 Certificate of Deposits 143First Farmers Bank &Trust Co.1091 240,000.00 240,000.00 11/21/20191.65007/21/2017 239,527.20 853320165HX4 1.653 1,480First National Bank of America1147 245,000.00 245,000.00 07/20/20233.15007/20/2018 250,603.15 1,82632110YLK9 3.152 1,404First National Bank1179 248,000.00 248,000.00 05/05/20232.80003/05/2019 250,663.52 1,52232117BCX4 2.802 870First Source Bank1168 245,000.00 245,000.00 11/17/20213.15012/17/2018 250,269.95 1,06633646CKP8 3.153 476First Tech Federal Credit Unio1124 245,000.00 245,000.00 10/19/20202.70004/18/2018 246,629.25 91533715LBJ8 2.623 945Third Federal Savings and Loan1112 245,000.00 245,000.00 01/31/20222.50001/30/2018 246,604.75 1,46288413QBY3 2.502 1,078Allegiance Bank1143 245,000.00 245,000.00 06/13/20223.10006/13/2018 250,875.10 1,46101748DBE5 3.102 1,200Alliance Credit Union1095 245,000.00 245,000.00 10/13/20222.25010/13/2017 244,250.30 1,82601859BAA3 2.251 616Ally Bank Midvale1176 245,000.00 245,000.00 03/08/20212.50003/07/2019 246,239.70 73202007GHX4 2.016 1,093America's Credit Union1200 248,000.00 248,000.00 06/28/20222.30006/28/2019 248,000.00 1,09603065AAL7 2.302 658Amex Centurion1077 240,000.00 240,000.00 04/19/20212.25004/19/2017 239,704.80 1,46102587DP85 2.252 1,155American Express Fed Savings B1096 240,000.00 240,000.00 08/29/20222.40008/29/2017 239,426.40 1,82602587CFU9 2.402 1,360Aneca Federal Credit Union1119 245,000.00 245,000.00 03/22/20232.80003/22/2018 247,842.00 1,826034577AH9 2.802 1,212Barclays Bank1097 240,000.00 240,000.00 10/25/20222.30010/25/2017 239,568.00 1,82606740KLJ4 2.291 1,642Bar Harbor Bank and Trust1172 248,000.00 248,000.00 12/29/20233.35012/31/2018 255,836.80 1,824066851WJ1 3.352 875Belmont Savings Bank1102 245,000.00 245,000.00 11/22/20212.10011/21/2017 244,274.80 1,462080515CD9 2.101 969BMW Bank1067 240,000.00 240,000.00 02/24/20222.20002/24/2017 239,738.40 1,82605580AGK4 2.201 563Bankers Bank1086 240,000.00 240,000.00 01/14/20211.80007/14/2017 238,579.20 1,28006610RAP4 1.804 707Capital One Natl Assn FDIC42971082 240,000.00 240,000.00 06/07/20212.25006/07/2017 240,220.80 1,46114042RGD7 2.252 345Capital One USA FDIC339541006 245,000.00 245,000.00 06/10/20201.90006/10/2015 244,475.70 1,827140420RX0 1.902 602Comenity Capital Bank1009 240,000.00 240,000.00 02/22/20211.70002/22/2016 238,082.40 1,82720033APG5 1.702 1,781Century Next Bank1184 248,000.00 248,000.00 05/16/20242.50005/29/2019 246,273.92 1,814156634AK3 2.503 Portfolio CITY CP Run Date: 08/28/2019 - 14:05 PM (PRF_PM2) 7.3.0 283 Days to Maturity Page 3 Par Value Book Value Maturity Date Stated RateMarket Value June 30, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date Certificate of Deposits 1,380Citibank NA1123 245,000.00 245,000.00 04/11/20232.90004/11/2018 248,621.10 1,82617312QJ26 2.902 744Central State Bank1085 240,000.00 240,000.00 07/14/20211.85007/14/2017 238,296.00 1,46115523RBJ4 1.851 1,598Commercial Bank1162 248,000.00 248,000.00 11/15/20233.40011/15/2018 256,288.16 1,82620143PDV9 3.402 1,824Communitywide FCU1202 248,000.00 248,000.00 06/28/20242.25006/28/2019 243,268.16 1,82720416TAQ5 2.253 1,397Congressional Bank1189 248,000.00 248,000.00 04/28/20232.50004/30/2019 247,982.64 1,45920726ABA5 2.502 1,236CrossFirst Bank1106 245,000.00 245,000.00 11/18/20222.20011/20/2017 243,605.95 1,82422766ACB9 2.201 1,817Citizens State Bank1199 248,000.00 248,000.00 06/21/20242.40006/21/2019 245,019.04 1,827176688CP2 2.403 946Discover Bank Greenwood DE CF1066 240,000.00 240,000.00 02/01/20222.25002/01/2017 240,069.60 1,8262546722U1 2.251 204Douglas National Bank1093 240,000.00 240,000.00 01/21/20201.65007/19/2017 239,352.00 916259744DS6 1.655 569Eagle Bank1146 245,000.00 245,000.00 01/20/20212.85007/20/2018 247,476.95 91527002YDV5 2.858 1,397EnerBank USA1125 240,000.00 240,000.00 04/28/20232.95004/30/2018 243,926.40 1,82429278TAY6 2.952 1,246Enterprise Bank, NA1107 245,000.00 245,000.00 11/28/20222.15011/28/2017 243,130.65 1,82629367QCP1 2.151 1,808Evansville Teachers Credit FCU1196 248,000.00 248,000.00 06/12/20242.60006/12/2019 247,365.12 1,827299547AQ2 2.603 340EverBank1017248,000.00 248,000.00 06/05/20201.70006/05/2015 246,898.88 1,82729976DXX3 1.702 567Farm Bureau Bank1165 248,000.00 248,000.00 01/18/20213.00012/17/2018 251,067.76 763307660LC2 2.898 1,033Farmers Insurance Group FCU1126 240,000.00 240,000.00 04/29/20222.80004/30/2018 243,607.20 1,46030960QAG2 2.802 540Freedom Credit Union1111 245,000.00 245,000.00 12/22/20202.05012/22/2017 244,505.10 1,09635638BAA9 2.052 777General Electric Credit Union1150 240,000.00 240,000.00 08/16/20213.10008/15/2018 244,442.40 1,097369674AV8 3.100 1,030Goldman Sachs1078 240,000.00 240,000.00 04/26/20222.40004/26/2017 240,967.20 1,82638148PJK4 2.401 378First Bank of Highland1094 240,000.00 240,000.00 07/13/20201.75007/13/2017 238,951.20 1,096319141GT8 1.752 1,109HSBC Bank USA, National Associ1088 240,000.00 240,000.00 07/14/20222.30007/14/2017 239,983.20 1,82640434YLE5 2.301 1,788Iowa State Bank1186 245,000.00 245,000.00 05/23/20242.40005/23/2019 242,202.10 1,82746256YAZ2 2.403 1,571Jefferson Financial CU1154 245,000.00 245,000.00 10/19/20233.35010/19/2018 252,607.25 1,826474067AQ8 3.352 316Jefferson Bank & Trust1100 245,000.00 245,000.00 05/12/20201.75011/09/2017 244,091.05 915472376AC6 1.751 1,781JP Morgan Chase1185 245,000.00 245,000.00 05/16/20243.25005/16/2019 243,799.50 1,82748128HXU7 3.254 1,051Kansas State Bank1101 245,000.00 245,000.00 05/17/20222.10011/17/2017 243,939.15 1,64250116CBE8 2.099 1,277Knoxville TVA Credit Union1110 245,000.00 245,000.00 12/29/20222.40012/29/2017 244,941.20 1,826499724AB8 2.401 1,815Legacy Bank1197 248,000.00 248,000.00 06/19/20242.40006/19/2019 245,028.96 1,827524661CB9 2.403 973Maine Savings FCU1171 248,000.00 248,000.00 02/28/20223.30012/28/2018 254,782.80 1,158560507AK1 3.306 1,761Main Street Bank1188 248,000.00 248,000.00 04/26/20242.60004/26/2019 247,538.72 1,82756065GAG3 2.603 1,569Marlin Business Bank1155 248,000.00 248,000.00 10/17/20233.30010/17/2018 255,229.20 1,82657116ARV2 3.302 1,255Medallion Bank1169 248,000.00 248,000.00 12/07/20223.40012/07/2018 256,268.32 1,46158404DCX7 3.402 372Mercantile Bank of Michigan1087 240,000.00 240,000.00 07/07/20201.75007/07/2017 238,970.40 1,09658740XZL7 1.752 347Bank Midwest1002 248,000.00 248,000.00 06/12/20201.65006/12/2015 246,767.44 1,827063615AVO 1.652 140Morgan Stanley Bank1109 245,000.00 245,000.00 11/18/20191.80011/16/2017 244,659.45 73261747MA92 1.800 1,450Morton Community1173 248,000.00 248,000.00 06/20/20232.75003/20/2019 249,934.40 1,553619165JD6 2.753 Portfolio CITY CP Run Date: 08/28/2019 - 14:05 PM (PRF_PM2) 7.3.0 284 Days to Maturity Page 4 Par Value Book Value Maturity Date Stated RateMarket Value June 30, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date Certificate of Deposits 1,215Merrick Bank1163 248,000.00 248,000.00 10/28/20223.25010/30/2018 255,082.88 1,45959013J4K2 3.252 140Morgan Stanley Private Bk, NA1108 245,000.00 245,000.00 11/18/20191.75011/16/2017 244,610.45 73261760AEP0 1.750 1,226Mountain America Federal CU1099 245,000.00 245,000.00 11/08/20222.30011/08/2017 244,470.80 1,82662384RAC0 2.301 1,569Municipal Trust and Savings1160 245,000.00 245,000.00 10/17/20233.20010/17/2018 251,144.60 1,826625925AR3 3.202 904Neighbors FCU1167 245,000.00 245,000.00 12/21/20213.20012/21/2018 250,713.40 1,09664017AAQ7 3.203 1,634National Cooperative Bank, N.A1170 245,000.00 245,000.00 12/21/20233.40012/21/2018 253,219.75 1,826635573AL2 3.402 1,611Numerica Credit Union1164 248,000.00 248,000.00 11/28/20233.55011/28/2018 257,860.48 1,82667054NAN3 3.552 848Northpointe Bank1127 240,000.00 240,000.00 10/26/20212.70004/26/2018 242,599.20 1,279666613GV0 2.703 1,688Northwest Bank1181 248,000.00 248,000.00 02/13/20242.95002/13/2019 251,568.72 1,82666736ABP3 2.951 1,491Bank of New England1151 249,000.00 249,000.00 07/31/20233.25007/31/2018 255,663.24 1,82606426KAN8 3.252 933The Ohio Valley Bank1089 240,000.00 240,000.00 01/19/20221.90007/19/2017 237,996.00 1,645677721CN0 1.903 1,073PCSB Bank1149 245,000.00 245,000.00 06/08/20223.00006/08/2018 250,169.50 1,46169324MAD7 3.002 1,437Pittsfield Cooperative Bank1194 245,000.00 245,000.00 06/07/20232.50006/07/2019 244,691.30 1,461725404AB3 2.502 1,803Plains Commerce Bank1195 245,000.00 245,000.00 06/07/20242.55006/07/2019 243,826.45 1,82772651LCL6 2.553 695PrivateBank & Trust1032 240,000.00 240,000.00 05/26/20211.50005/26/2016 237,302.40 1,82674267GVG9 1.501 1,450RCB Bank1144 245,000.00 245,000.00 06/20/20233.15006/20/2018 250,612.95 1,82674934YAH4 3.152 1,255Red Rocks Credit Union1166 248,000.00 248,000.00 12/07/20223.35012/07/2018 255,859.12 1,46175701LAB3 3.352 1,824Revere Bank1203 247,000.00 247,000.00 06/28/20242.30006/28/2019 242,855.34 1,827761402BY1 2.303 511First Bank Richmond1081 245,000.00 245,000.00 11/23/20201.80006/21/2017 243,684.35 1,251319267GC8 1.802 66Riverwood1034248,000.00 248,000.00 09/05/20191.40006/05/2015 247,744.56 1,55376951DAL4 1.402 1,086Sallie Mae Bank Salt Lake CIty1083 240,000.00 240,000.00 06/21/20222.35006/21/2017 240,614.40 1,826795450A70 2.351 1,155Sterling Bank1201 245,000.00 245,000.00 08/29/20222.15006/28/2019 243,801.95 1,15885916VDC6 2.153 295Stearnes Bank, N.A.1076 240,000.00 240,000.00 04/21/20201.60004/21/2017 238,879.20 1,096857894TC3 1.588 1,067Synchrony Bank Retail1080 240,000.00 240,000.00 06/02/20222.40006/02/2017 240,962.40 1,82687164XQV1 2.401 669Towne Bank1128 240,000.00 240,000.00 04/30/20212.80004/30/2018 242,592.00 1,09689214PBL2 2.803 1,134Traditions Bank1148 245,000.00 245,000.00 08/08/20223.00006/08/2018 250,186.65 1,52289269CBX9 3.002 875TNB Bank1187 248,000.00 248,000.00 11/22/20212.40005/22/2019 249,004.40 91587266AAA1 2.407 1,569UBS Bank USA1161 245,000.00 245,000.00 10/17/20233.35010/17/2018 252,639.10 1,82690348JEJ5 3.352 624Unity Bank1120 245,000.00 245,000.00 03/16/20212.55003/16/2018 246,465.10 1,09691330ABN6 2.552 1,414University of Iowa Comm. CU1134 240,000.00 240,000.00 05/15/20233.05005/14/2018 244,740.00 1,82791435LAG2 3.052 1,338Verus Bank of Commerce1180 248,000.00 248,000.00 02/28/20232.70002/28/2019 250,125.36 1,46192535LCD4 2.700 1,702Wells Fargo1174 248,000.00 248,000.00 02/27/20243.00002/27/2019 251,186.80 1,826949763XY7 3.001 350Wex Bank1145 245,000.00 245,000.00 06/15/20202.75006/13/2018 246,345.05 73392937CHG6 2.754 22,249,000.00 1,51922,392,488.6922,249,000.0020,873,266.67Subtotal and Average 1,071 2.525 Portfolio CITY CP Run Date: 08/28/2019 - 14:05 PM (PRF_PM2) 7.3.0 285 Days to Maturity Page 5 Par Value Book Value Maturity Date Stated RateMarket Value June 30, 2019 Portfolio Details - Investments Average BalanceIssuer Portfolio Management City of La Quinta YTM 365TermCUSIPInvestment # Purchase Date Corporate Notes 765Apple Inc1079 500,000.00 493,050.00 08/04/20211.55006/12/2017 495,160.00 1,514037833CC2 1.900 1,311Colgate-Palmolive1175 500,000.00 485,250.00 02/01/20231.95003/04/2019 500,810.00 1,43019416QEA4 2.751 220Microsoft Corporation1118 500,000.00 497,700.00 02/06/20201.85001/22/2018 498,930.00 745594918BV5 2.081 1,499Microsoft Corporation1157 400,000.00 378,360.00 08/08/20232.00010/15/2018 399,288.00 1,758594918BQ6 3.222 951Proctor and Gamble1159 500,000.00 487,950.00 02/06/20222.30010/15/2018 503,955.00 1,210742718DY2 3.071 109Toyota Motor Credit Corp1098 500,000.00 498,750.00 10/18/20191.55011/07/2017 498,955.00 71089236TDH5 1.681 647Toyota Motor Credit Corp1204 500,000.00 499,750.00 04/08/20211.90006/24/2019 497,805.00 65489236TCZ6 1.928 1,263Wal-Mart Stores, Inc1190 500,000.00 496,650.00 12/15/20222.35004/16/2019 505,610.00 1,339931142DU4 2.799 3,837,460.00 1,1503,900,513.003,900,000.003,454,318.33Subtotal and Average 823 2.402 Money Market Accounts 1California Asset Management Pr1153 20,531,379.20 20,531,379.2009/26/2018 20,531,379.20 1SYS1153 0.000 20,531,379.20 120,531,379.2020,531,379.2019,160,283.55Subtotal and Average 1 0.000 Money Market with Fiscal Agent 1US Bank1058 1,673.76 1,673.7607/01/2016 1,673.76 1SYS1058 0.000 1,673.76 11,673.761,673.761,671.35Subtotal and Average 1 0.000 Managed Pool Accounts-OPEB Trust 1CalPERS CERBT Plan1114 1,627,510.76 1,627,510.7607/01/2018 1,627,510.76 1SYS1114 0.000 1,627,510.76 11,627,510.761,627,510.761,576,595.21Subtotal and Average 1 0.000 556158,801,870.51 163,665,837.87 313 1.891163,530,269.73 163,399,745.37Total and Average Portfolio CITY CP Run Date: 08/28/2019 - 14:05 PM (PRF_PM2) 7.3.0 286 City of La Quinta -City of La Quinta Purchases Report Sorted by Fund - Fund April 1, 2019 - June 30, 2019 Original Par Value Ending Book Value Sec. TypeFund Maturity YTM Accrued Interest at PurchasePayment Periods DateCUSIPInvestment #Issuer Purchase Date Principal Purchased Rate at Purchase General Fund 500,000.00 2.350 12/15/2022 496,650.00496,650.00 Received04/16/2019 2.79906/15 - 12/15WALMRT1190931142DU4MC2101 248,000.00 2.600 04/26/2024 248,000.00248,000.0004/26/2019 2.60305/26 - MonthlyMAINST118856065GAG3MC1101 248,000.00 2.500 04/28/2023 248,000.00248,000.0004/30/2019 2.50205/30 - MonthlyCONGRS118920726ABA5MC1101 245,000.00 3.250 05/16/2024 245,000.00245,000.0005/16/2019 3.25408/16 - QuarterlyJPMORG118548128HXU7MC1101 248,000.00 2.400 11/22/2021 248,000.00248,000.0005/22/2019 2.40706/22 - MonthlyTSCOLA118787266AAA1MC1101 245,000.00 2.400 05/23/2024 245,000.00245,000.0005/23/2019 2.40311/23 - 05/23IOWAST118646256YAZ2MC1101 500,000.00 1.700 11/01/2022 492,100.00492,100.00 Received05/28/2019 2.18111/01 - 05/01FFCB11913133EGD28FAC101 248,000.00 2.500 05/16/2024 248,000.00248,000.0005/29/2019 2.50306/29 - MonthlyCENTNX1184156634AK3MC1101 500,000.00 1.750 05/15/2022 496,650.00496,650.00 Received05/31/2019 1.98411/15 - 05/15USTR1192912828SV3TRC101 500,000.00 1.375 05/31/2021 493,610.00493,610.0005/31/2019 2.03011/30 - 05/31USTR1193912828R77TRC101 245,000.00 2.500 06/07/2023 245,000.00245,000.0006/07/2019 2.50212/07 - 06/07PITTS1194725404AB3MC1101 245,000.00 2.550 06/07/2024 245,000.00245,000.0006/07/2019 2.55312/07 - 06/07PLAINS119572651LCL6MC1101 248,000.00 2.600 06/12/2024 248,000.00248,000.0006/12/2019 2.60307/01 - MonthlyEVNSCU1196299547AQ2MC1101 248,000.00 2.400 06/19/2024 248,000.00248,000.0006/19/2019 2.40307/19 - MonthlyLEGCY1197524661CB9MC1101 500,000.00 1.875 12/12/2022 499,500.00499,500.00 Received06/20/2019 1.90512/12 - 06/12FFCB11983133EKQP4FAC101 248,000.00 2.400 06/21/2024 248,000.00248,000.0006/21/2019 2.40307/21 - MonthlyCTZNST1199176688CP2MC1101 500,000.00 1.900 04/08/2021 499,750.00499,750.00 Received06/24/2019 1.92810/08 - 04/08TOYOTA120489236TCZ6MC2101 248,000.00 2.300 06/28/2022 248,000.00248,000.0006/28/2019 2.30207/28 - MonthlyAMERCU120003065AAL7MC1101 248,000.00 2.250 06/28/2024 248,000.00248,000.0006/28/2019 2.25308/01 - MonthlyCOMMWD120220416TAQ5MC1101 247,000.00 2.300 06/28/2024 247,000.00247,000.0006/28/2019 2.30312/28 - 06/28REVER1203761402BY1MC1101 245,000.00 2.150 08/29/2022 245,000.00245,000.0006/28/2019 2.15312/28 - 06/28STRLNG120185916VDC6MC1101 Subtotal 6,682,260.006,682,260.00 0.006,704,000.00 6,682,260.00Total Purchases 6,704,000.00 0.00 6,682,260.00 Received = Accrued Interest at Purchase was received by report ending date. Portfolio CITY CP Run Date: 08/28/2019 - 16:38 PU (PRF_PU) 7.1.1 Report Ver. 7.3.6.1287 City of La Quinta -City of La Quinta Maturity Report Sorted by Maturity Date Received or due during April 1, 2019 - June 30, 2019 Rate at MaturityPar Value Sec. TypeFund Maturity Date Maturity ProceedsInterest Income Net CUSIP Investment #Issuer Purchase Date Book Value at Maturity 500,000.00 1.125 502,812.502,812.5005/10/2018FHLMC11293137EADZ9FAC10104/15/2019 7,562.50495,250.00 240,000.00 1.800 242,154.082,154.0804/23/2014WEB104294768NJQ8MC110104/23/2019 2,154.08240,000.00 240,000.00 1.650 241,963.731,963.7304/30/2014EPHRAT1016294209AQ4MC110104/30/2019 1,963.73240,000.00 240,000.00 2.200 245,280.005,280.0005/16/2018UNION113690521AQW1MC110105/16/2019 5,280.00240,000.00 240,000.00 1.750 242,082.742,082.7405/20/20141STBUS101931938QH72MC110105/20/2019 2,082.74240,000.00 240,000.00 1.750 240,011.5111.5105/19/2014GCB1024402194EB6MC110105/20/2019 11.51240,000.00 240,000.00 2.200 245,280.005,280.0005/24/2018CNBF113217801DDT0MC110105/24/2019 5,280.00240,000.00 240,000.00 1.800 240,355.07355.0705/28/2014PEAPAC1031704692AL6MC110105/28/2019 355.07240,000.00 1,000,000.00 1.500 1,007,500.007,500.0005/10/2018USTR1130912828WL0TRC10105/31/2019 14,900.00992,600.00 248,000.00 1.400 248,294.88294.8806/04/2015SOLOM103583427LAX2MC110106/04/2019 294.88248,000.00 248,000.00 1.500 248,315.95315.9506/05/2015CONNEC101120786ABD6MC110106/05/2019 315.95248,000.00 500,000.00 1.210 503,025.003,025.0005/31/2018FFCB11413133EGFU4FAC10106/20/2019 8,275.00494,750.00 4,207,075.46Total Maturities 4,176,000.00 31,075.464,158,600.00 48,475.46 Portfolio CITY CP Run Date: 08/28/2019 - 16:41 MA (PRF_MA) 7.1.1 Report Ver. 7.3.6.1288 City of La Quinta -City of La Quinta Sales/Call Report Sorted by Maturity Date - Fund April 1, 2019 - June 30, 2019 Redem. Date Redemption Principal Redemption Interest Book Value at Redem. Total Amount Net IncomeFundMatur. Date Rate at Redem. Par ValueSec. TypeCUSIPInvestment # Issuer Purchase Date 02/28/2023 1,000,000.00 999,000.00 1,000,000.00 6,562.5011213130ADMF605/28/2019 1,006,562.50 7,562.50101 FHLB FAC 02/28/2023 04/02/2018 2.625 V Call Subtotal 999,000.00 1,000,000.00 6,562.501,000,000.00 1,006,562.50 7,562.50 1,000,000.00Total Sales 1,000,000.00 6,562.50999,000.00 1,006,562.50 7,562.50 Portfolio CITY CP Run Date: 08/28/2019 - 16:42 SA (PRF_SA) 7.1.1 Report Ver. 7.3.6.1 V - Security with variable rate change. 289 US Treasury Rates https://www.treasury.gov/resource-center/data-chart-center/interest-rates/Pages/TextView.aspx?data=yieldYear&year=2019 Commercial Paper Rates https://www.federalreserve.gov/releases/cp/rates.htm 290 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: AWARD AGREEMENT FOR CONTRACT SERVICES TO DESERT LIMNOLOGISTS, INC. DBA SOUTHWEST AQUATICS FOR CIVIC CENTER CAMPUS LAKE MAINTENANCE SERVICES (PROJECT NO. 2019-11) RECOMMENDATION Award Agreement for Contract Services to Desert Limnologists, Inc. dba Southwest Aquatics, in the amount of $16,200 annually, for Civic Center Campus Lake Maintenance Services; and authorize the City Manager to execute the agreement. EXECUTIVE SUMMARY •The City contracts lake maintenance services for the Civic Center Campus lake. •On July 22, 2019, a request for qualifications and proposal (RFQ/RFP) was posted on the City website. Three responses were received. •After extensive review, the Selection Committee (Committee) recommended Desert Limnologists, Inc. dba Southwest Aquatics (SW Aquatics) based on their qualifications. FISCAL IMPACT The annual contract cost is $16,200 or $81,000 for the initial five-year term. Funds are available in the 2019/20 Parks Maintenance and Operations budget (101-3005-60117). Funding will be budgeted in subsequent fiscal years. BACKGROUND/ANALYSIS The City contracts for lake maintenance services at the Civic Center Campus. An RFQ/RFP for lake maintenance services was posted on the City’s website in July 2019. A mandatory pre-proposal meeting was held on July 31, 2019, three contractors attended. Three sealed RFQ/RFP’s were received from SW Aquatics, Diversified Waterscapes, Inc., and Marine Biochemists. The Committee reviewed each proposal submitted and selected SW Aquatics based on their work proposal qualifications, detailed schedule of work and strategies to improve the lake’s appearance. CONSENT CALENDAR ITEM NO. 16 291 The contract includes lake maintenance services twice per week and achieving a high level of water clarity. The rocks in the lake will be maintained at a higher level, and free of algae. The contractor possesses a working knowledge of the pumps and equipment. Weekly inspections will be performed and any equipment issues will be reported to City staff immediately. The contract agreement (Attachment 1) would be for a five-year initial term, October 1, 2019 through September 30, 2024, and would allow for a two -year extension, at the City’s discretion, if the contractor performs in a satisfactory manner. The City may terminate the contract prior to the expiration term with a thirty (30) day written notice to the Contracting Party. ALTERNATIVES Council may direct staff to prepare new specifications to re-advertise for Lake Maintenance Services. However, this may cause a disruption in services. Prepared by: Dianne Hansen, Interim Management Analyst Approved by: Gil Villalpando, Acting Facilities Director Attachment: 1. Agreement for Contract Services 292 AGREEMENT FOR CONTRACT SERVICES THIS AGREEMENT FOR CONTRACT SERVICES (the “Agreement”) is made and entered into by and between the CITY OF LA QUINTA, (“City”), a California municipal corporation, and Desert Limnologists, Inc. dba Southwest Aquatics (“Contracting Party”). The parties hereto agree as follows: 1.SERVICES OF CONTRACTING PARTY. 1.1 Scope of Services. In compliance with all terms and conditions of this Agreement, Contracting Party shall provide those services related to Civic Center Campus Lake Maintenance Services, Project No 2019-11 as specified in the “Scope of Services” attached hereto as “Exhibit A” and incorporated herein by this reference (the “Services”). Contracting Party represents and warrants that Contracting Party is a provider of first-class work and/or services and Contracting Party is experienced in performing the Services contemplated herein and, in light of such status and experience, Contracting Party covenants that it shall follow industry standards in performing the Services required hereunder, and that all materials, if any, will be of good quality, fit for the purpose intended. For purposes of this Agreement, the phrase “industry standards” shall mean those standards of practice recognized by one or more first-class firms performing similar services under similar circumstances. 1.2 Compliance with Law. All Services rendered hereunder shall be provided in accordance with all ordinances, resolutions, statutes, rules, regulations, and laws of the City and any Federal, State, or local governmental agency of competent jurisdiction. 1.3 Wage and Hour Compliance, Contracting Party shall comply with applicable Federal, State, and local wage and hour laws. 1.4 Licenses, Permits, Fees and Assessments. Except as otherwise specified herein, Contracting Party shall obtain at its sole cost and expense such licenses, permits, and approvals as may be required by law for the performance of the Services required by this Agreement, including a City of La Quinta business license. Contracting Party and its employees, agents, and subcontractors shall, at their sole cost and expense, keep in effect at all times during the term of this Agreement any licenses, permits, and approvals that are legally required for the performance of the Services required by this Agreement. Contracting Party shall have the sole obligation to pay for any fees, assessments, and taxes, plus applicable penalties and interest, which may be imposed by law and arise from or are necessary for the performance of the Services required by this Agreement, and shall indemnify, defend (with counsel selected by City), and hold City, its elected officials, officers, employees, and agents, free and harmless against any such fees, ATTACHMENT 1 293 -2- assessments, taxes, penalties, or interest levied, assessed, or imposed against City hereunder. Contracting Party shall be responsible for all subcontractors’ compliance with this Section. 1.5 Familiarity with Work. By executing this Agreement, Contracting Party warrants that (a) it has thoroughly investigated and considered the Services to be performed, (b) it has investigated the site where the Services are to be performed, if any, and fully acquainted itself with the conditions there existing, (c) it has carefully considered how the Services should be performed, and (d) it fully understands the facilities, difficulties, and restrictions attending performance of the Services under this Agreement. Should Contracting Party discover any latent or unknown conditions materially differing from those inherent in the Services or as represented by City, Contracting Party shall immediately inform City of such fact and shall not proceed except at Contracting Party’s risk until written instructions are received from the Contract Officer, or assigned designee (as defined in Section 4.2 hereof). 1.6 Standard of Care. Contracting Party acknowledges and understands that the Services contracted for under this Agreement require specialized skills and abilities and that, consistent with this understanding, Contracting Party’s work will be held to an industry standard of quality and workmanship. Consistent with Section 1.5 hereinabove, Contracting Party represents to City that it holds the necessary skills and abilities to satisfy the industry standard of quality as set forth in this Agreement. Contracting Party shall adopt reasonable methods during the life of this Agreement to furnish continuous protection to the Services performed by Contracting Party, and the equipment, materials, papers, and other components thereof to prevent losses or damages, and shall be responsible for all such damages, to persons or property, until acceptance of the Services by City, except such losses or damages as may be caused by City’s own negligence. The performance of Services by Contracting Party shall not relieve Contracting Party from any obligation to correct any incomplete, inaccurate, or defective work at no further cost to City, when such inaccuracies are due to the negligence of Contracting Party. 1.7 Additional Services. In accordance with the terms and conditions of this Agreement, Contracting Party shall perform services in addition to those specified in the Scope of Services (“Additional Services”) only when directed to do so by the Contract Officer, or assigned designee, provided that Contracting Party shall not be required to perform any Additional Services without compensation. Contracting Party shall not perform any Additional Services until receiving prior written authorization (in the form of a written change order if Contracting Party is a contractor performing the Services) from 294 -3- the Contract Officer, or assigned designee, incorporating therein any adjustment in (i) the Contract Sum, and/or (ii) the time to perform this Agreement, which said adjustments are subject to the written approval of Contracting Party. It is expressly understood by Contracting Party that the provisions of this Section shall not apply to the Services specifically set forth in the Scope of Services or reasonably contemplated therein. It is specifically understood and agreed that oral requests and/or approvals of Additional Services shall be barred and are unenforceable. Failure of Contracting Party to secure the Contract Officer’s, or assigned designee’s written authorization for Additional Services shall constitute a waiver of any and all right to adjustment of the Contract Sum or time to perform this Agreement, whether by way of compensation, restitution, quantum meruit, or the like, for Additional Services provided without the appropriate authorization from the Contract Officer, or assigned designee. Compensation for properly authorized Additional Services shall be made in accordance with Section 2.3 of this Agreement. 1.8 Special Requirements. Additional terms and conditions of this Agreement, if any, which are made a part hereof are set forth in “Exhibit D” (the “Special Requirements”), which is incorporated herein by this reference and expressly made a part hereof. In the event of a conflict between the provisions of the Special Requirements and any other provisions of this Agreement, the provisions of the Special Requirements shall govern. 2. COMPENSATION. 2.1 Contract Sum. For the Services rendered pursuant to this Agreement, Contracting Party shall be compensated in accordance with “Exhibit B” (the “Schedule of Compensation”) in an annual amount of (Total base proposal in words) Sixteen Thousand, Two Hundred Total base proposal in figures) ($16,200) (the “Contract Sum”), except as provided in Section 1.7. The method of compensation set forth in the Schedule of Compensation may include a lump sum payment upon completion, payment in accordance with the percentage of completion of the Services, payment for time and materials based upon Contracting Party’s rate schedule, but not exceeding the Contract Sum, or such other reasonable methods as may be specified in the Schedule of Compensation. The Contract Sum shall include the attendance of Contracting Party at all project meetings reasonably deemed necessary by City; Contracting Party shall not be entitled to any additional compensation for attending said meetings. Compensation may include reimbursement for actual and necessary expenditures for reproduction costs, transportation expense, telephone expense, and similar costs and expenses when and if specified in the Schedule of Compensation. Regardless of the method of compensation set forth in the Schedule of Compensation, Contracting Party’s 295 -4- overall compensation shall not exceed the Contract Sum, except as provided in Section 1.7 of this Agreement. 2.2 Method of Billing & Payment. Any month in which Contracting Party wishes to receive payment, Contracting Party shall submit to City no later than the tenth (10th) working day of such month, in the form approved by City’s Finance Director, an invoice for Services rendered prior to the date of the invoice. Such invoice shall (1) describe in detail the Services provided, including time and materials, and (2) specify each staff member who has provided Services and the number of hours assigned to each such staff member. Such invoice shall contain a certification by a principal member of Contracting Party specifying that the payment requested is for Services performed in accordance with the terms of this Agreement. Upon approval in writing by the Contract Officer, or assigned designee, and subject to retention pursuant to Section 8.3, City will pay Contracting Party for all items stated thereon which are approved by City pursuant to this Agreement no later than thirty (30) days after invoices are received by the City’s Finance Department. 2.3 Compensation for Additional Services. Additional Services approved in advance by the Contract Officer, or assigned designee, pursuant to Section 1.7 of this Agreement shall be paid for in an amount agreed to in writing by both City and Contracting Party in advance of the Additional Services being rendered by Contracting Party. Any compensation for Additional Services amounting to five percent (5%) or less of the Contract Sum may be approved by the Contract Officer, or assigned designee. Any greater amount of compensation for Additional Services must be approved by the La Quinta City Council, the City Manager, or Department Director, depending upon City laws, regulations, rules and procedures concerning public contracting. Under no circumstances shall Contracting Party receive compensation for any Additional Services unless prior written approval for the Additional Services is obtained from the Contract Officer , or assigned designee, pursuant to Section 1.7 of this Agreement. 3. PERFORMANCE SCHEDULE. 3.1 Time of Essence. Time is of the essence in the performance of this Agreement. If the Services not completed in accordance with the Schedule of Performance, as set forth in Section 3.2 and “Exhibit C”, it is understood that the City will suffer damage. 3.2 Schedule of Performance. All Services rendered pursuant to this Agreement shall be performed diligently and within the time period established in “Exhibit C” (the “Schedule of Performance”). Extensions to the 296 -5- time period specified in the Schedule of Performance may be approved in writing by the Contract Officer, or assigned designee. 3.3 Force Majeure. The time period specified in the Schedule of Performance for performance of the Services rendered pursuant to this Agreement shall be extended because of any delays due to unforeseeable causes beyond the control and without the fault or negligence of Contracting Party, including, but not restricted to, acts of God or of the public enemy, fires, earthquakes, floods, epidemic, quarantine restrictions, riots, stri kes, freight embargoes, acts of any governmental agency other than City, and unusually severe weather, if Contracting Party shall within ten (10) days of the commencement of such delay notify the Contract Officer, or assigned designee, in writing of the causes of the delay. The Contract Officer, or assigned designee, shall ascertain the facts and the extent of delay, and extend the time for performing the Services for the period of the forced delay when and if in the Contract Officer’s judgment such delay is justified, and the Contract Officer’s determination, or assigned designee, shall be final and conclusive upon the parties to this Agreement. Extensions to time period in the Schedule of Performance which are determined by the Contract Officer , or assigned designee, to be justified pursuant to this Section shall not entitle the Contracting Party to additional compensation in excess of the Contract Sum. 3.4 Term. Unless earlier terminated in accordance with the provisions in Article 8.0 of this Agreement, the term of this agreement shall commence on October 1, 2019 and terminate on September 30, 2024 (“Initial Term”). This Agreement may be extended for two (2) additional year(s) upon mutual agreement by both parties (“Extended Term”). 4.COORDINATION OF WORK. 4.1 Representative of Contracting Party. The following principals of Contracting Party (“Principals”) are hereby designated as being the principals and representatives of Contracting Party authorized to act in its behalf with respect to the Services specified herein and make all decisions in connection therewith: (a) Name: Chris Beaty Tel No. 760-568-5499 E-mail: cbeaty@swaquatics.com (b) Name: Raymond Lopez Tel No. 760-399-7816 Email: rlopez@swaquatics.com 297 -6- It is expressly understood that the experience, knowledge, capability, and reputation of the foregoing Principals were a substantial inducement for City to enter into this Agreement. Therefore, the foregoing Principals shall be responsible during the term of this Agreement for directing all activities of Contracting Party and devoting sufficient time to personally supervise the Services hereunder. For purposes of this Agreement, the foregoing Principals may not be changed by Contracting Party and no other personnel may be assigned to perform the Services required hereunder without the express written approval of City. 4.2 Contract Officer. The “Contract Officer”, otherwise known as Dianne Hansen, Interim Management Analyst, or assigned designee may be designated in writing by the City Manager of the City. It shall be Contracting Party’s responsibility to assure that the Contract Officer, or assigned designee, is kept informed of the progress of the performance of the Services, and Contracting Party shall refer any decisions, that must be made by City to the Contract Officer, or assigned designee. Unless otherwise specified herein, any approval of City required hereunder shall mean the approval of the Contract Officer, or assigned designee. The Contract Officer, or assigned designee, shall have authority to sign all documents on behalf of City required hereunder to carry out the terms of this Agreement. 4.3 Prohibition Against Subcontracting or Assignment. The experience, knowledge, capability, and reputation of Contracting Party, its principals, and its employees were a substantial inducement for City to enter into this Agreement. Except as set forth in this Agreement, Contracting Party shall not contract or subcontract with any other entity to perform in whole or in part the Services required hereunder without the express written approval of City. In addition, neither this Agreement nor any interest he rein may be transferred, assigned, conveyed, hypothecated, or encumbered, voluntarily or by operation of law, without the prior written approval of City. Transfers restricted hereunder shall include the transfer to any person or group of persons acting in concert of more than twenty five percent (25%) of the present ownership and/or control of Contracting Party, taking all transfers into account on a cumulative basis. Any attempted or purported assignment or contracting or subcontracting by Contracting Party without City’s express written approval shall be null, void, and of no effect. No approved transfer shall release Contracting Party of any liability hereunder without the express consent of City. 4.4 Independent Contractor. Neither City nor any of its employees shall have any control over the manner, mode, or means by which Contracting Party, its agents, or its employees, perform the Services required herein, except as otherwise set forth herein. City shall have no voice in the selection, 298 -7- discharge, supervision, or control of Contracting Party’s employees, servants, representatives, or agents, or in fixing their number or hours of service. Contracting Party shall perform all Services required herein as an independent contractor of City and shall remain at all times as to City a wholly independent contractor with only such obligations as are consistent with that role. Contracting Party shall not at any time or in any manner represent that it or any of its agents or employees are agents or employees of City. City shall not in any way or for any purpose become or be deemed to be a partner of Contracting Party in its business or otherwise or a joint venture or a member of any joint enterprise with Contracting Party. Contracting Party shall have no power to incur any debt, obligation, or liability on behalf of City. Contracting Party shall not at any time or in any manner represent that it or any of its agents or employees are agents or employees of City. Except for the Contract Sum paid to Contracting Party as provided in this Agreement, City shall not pay salaries, wages, or other compensation to Contracting Party for performing the Services hereunder for City. City shall not be liable for compensation or indemnification to Contracting Party for injury or sickness arising out of performing the Services hereunder. Notwithstanding any other City, state, or federal policy, rule, regulation, law, or ordinance to the contrary, Contracting Party and any of its employees, agents, and subcontractors providing services under this Agreement shall not qualify for or become entitled to any compensation, benefit, or any incident of employment by City, including but not limited to eligibility to enroll in the California Public Employees Retirement System (“PERS”) as an employee of City and entitlement to any contribution to be paid by City for employer contributions and/or employee contributions for PERS benefits. Contracting Party agrees to pay all required taxes on amounts paid to Contracting Party under this Agreement, and to indemnify and hold City harmless from any and all taxes, assessments, penalties, and interest asserted against City by reason of the independent contractor relationship created by this Agreement. Contracting Party shall fully comply with the wor kers’ compensation laws regarding Contracting Party and Contracting Party’s employees. Contracting Party further agrees to indemnify and hold City harmless from any failure of Contracting Party to comply with applicable workers’ compensation laws. City shall have the right to offset against the amount of any payment due to Contracting Party under this Agreement any amount due to City from Contracting Party as a result of Contracting Party’s failure to promptly pay to City any reimbursement or indemnification arising under this Section. 4.5 Identity of Persons Performing Work. Contracting Party represents that it employs or will employ at its own expense all personnel required for the satisfactory performance of any and all of the Services set forth herein. Contracting Party represents that the Services required herein will be performed by Contracting Party or under its direct supervision, and 299 -8- that all personnel engaged in such work shall be fully qualified and shall be authorized and permitted under applicable State and local law to perform such tasks and services. 4.6 City Cooperation. City shall provide Contracting Party with any plans, publications, reports, statistics, records, or other data or information pertinent to the Services to be performed hereunder which are reasonably available to Contracting Party only from or through action by City. 5. INSURANCE. 5.1 Insurance. Prior to the beginning of any Services under this Agreement and throughout the duration of the term of this Agreement, Contracting Party shall procure and maintain, at its sole cost and expense, and submit concurrently with its execution of this Agreement, policies of insurance as set forth in “Exhibit E” (the “Insurance Requirements”) which is incorporated herein by this reference and expressly made a part hereof. 5.2 Proof of Insurance. Contracting Party shall provide Certificate of Insurance to Agency along with all required endorsements. Certificate of Insurance and endorsements must be approved by Agency’s Risk Manager prior to commencement of performance. 6. INDEMNIFICATION. 6.1 Indemnification. To the fullest extent permitted by law, Contracting Party shall indemnify, protect, defend (with counsel selected by City), and hold harmless City and any and all of its officers, employees, agents, and volunteers as set forth in “Exhibit F” (“Indemnification”) which is incorporated herein by this reference and expressly made a part hereof. 7. RECORDS AND REPORTS. 7.1 Reports. Contracting Party shall periodically prepare and submit to the Contract Officer, or assigned designee, such reports concerning Contracting Party’s performance of the Services required by this Agreement as the Contract Officer, or assigned designee, shall require. Contracting Party hereby acknowledges that City is greatly concerned about the cost of the Services to be performed pursuant to this Agreement. For this reason, Contracting Party agrees that if Contracting Party becomes aware of any facts, circumstances, techniques, or events that may or will materially increase or decrease the cost of the Services contemplated herein or, if Contracting Party is providing design services, the cost of the project being designed, Contracting Party shall promptly notify the Contract Officer , or assigned designee, of said fact, circumstance, technique, or event and the estimated 300 -9- increased or decreased cost related thereto and, if Contracting Party is providing design services, the estimated increased or decreased cost estimate for the project being designed. 7.2 Records. Contracting Party shall keep, and require any subcontractors to keep, such ledgers, books of accounts, invoices, vouchers, canceled checks, reports (including but not limited to payroll reports), studies, or other documents relating to the disbursements charged to City and the Services performed hereunder (the “Books and Records”), as shall be necessary to perform the Services required by this Agreement and enable the Contract Officer, or assigned designee, to evaluate the performance of such Services. Any and all such Books and Records shall be maintained in accordance with generally accepted accounting principles and shall be complete and detailed. The Contract Officer, or assigned designee, shall have full and free access to such Books and Records at all times during normal business hours of City, including the right to inspect, copy, audit, and make records and transcripts from such Books and Records. Such Books and Records shall be maintained for a period of three (3) years following completion of the Services hereunder, and City shall have access to such Books and Records in the event any audit is required. In the event of dissolution of Contracting Party’s business, custody of the Books and Records may be given to City, and access shall be provided by Contracting Party’s successor in interest. Under California Government Code Section 8546.7, if the amount of public funds expended under this Agreement exceeds Ten Thousand Dollars ($10,000.00), this Agreement shall be subject to the examination and audit of the State Auditor, at the request of City or as part of any audit of City, for a period of three (3) years after final payment under this Agreement. 7.3 Ownership of Documents. All drawings, specifications, maps, designs, photographs, studies, surveys, data, notes, computer files, reports, records, documents, and other materials plans, drawings, estimates, test data, survey results, models, renderings, and other documents or works of authorship fixed in any tangible medium of expression, including but not limited to, physical drawings, digital renderings, or data stored digitally, magnetically, or in any other medium prepared or caused to be prepared by Contracting Party, its employees, subcontractors, and agents in the performance of this Agreement (the “Documents and Materials”) shall be the property of City and shall be delivered to City upon request of the Contract Officer, or assigned designee, or upon the expiration or termination of this Agreement, and Contracting Party shall have no claim for further employment or additional compensation as a result of the exercise by City of its full rights of ownership use, reuse, or assignment of the Documents and Materials hereunder. Any use, reuse or assignment of such completed Documents and 301 -10- Materials for other projects and/or use of uncompleted documents without specific written authorization by Contracting Party will be at City’s sole risk and without liability to Contracting Party, and Contracting Party’s guarantee and warranties shall not extend to such use, revise, or assignment. Contracting Party may retain copies of such Documents and Materials for its own use. Contracting Party shall have an unrestricted right to use the concepts embodied therein. All subcontractors shall provide for assignment to City of any Documents and Materials prepared by them, and in the event Contracting Party fails to secure such assignment, Contracting Party shall indemnify City for all damages resulting therefrom. 7.4 In the event City or any person, firm, or corporation authorized by City reuses said Documents and Materials without written verification or adaptation by Contracting Party for the specific purpose intended and causes to be made or makes any changes or alterations in said Documents and Materials, City hereby releases, discharges, and exonerates Contracting Party from liability resulting from said change. The provisions of this clause shall survive the termination or expiration of this Agreement and shall thereafter remain in full force and effect. 7.5 Licensing of Intellectual Property. This Agreement creates a non- exclusive and perpetual license for City to copy, use, modify, reuse, or sublicense any and all copyrights, designs, rights of reproduction, and other intellectual property embodied in the Documents and Materials. Contracting Party shall require all subcontractors, if any, to agree in writing that City is granted a non-exclusive and perpetual license for the Documents and Materials the subcontractor prepares under this Agreement. Contracting Party represents and warrants that Contracting Party has the legal right to license any and all of the Documents and Materials. Contracting Party makes no such representation and warranty in regard to the Documents and Materials which were prepared by design professionals other than Contracting Party or provided to Contracting Party by City. City shall not be limited in any way in its use of the Documents and Materials at any time, provided that any such use not within the purposes intended by this Agreement shall be at City’s sole risk. 7.6 Release of Documents. The Documents and Materials shall not be released publicly without the prior written approval of the Contract Officer , or assigned designee, or as required by law. Contracting Party shall not disclose to any other entity or person any information regarding the activities of City, except as required by law or as authorized by City. 7.7 Confidential or Personal Identifying Information. Contracting Party covenants that all City data, data lists, trade secrets, documents with personal identifying information, documents that are not public records, draft 302 -11- documents, discussion notes, or other information, if any, developed or received by Contracting Party or provided for performance of this Agreement are deemed confidential and shall not be disclosed by Contracting Party to any person or entity without prior written authorization by City or unless required by law. City shall grant authorization for disclosure if required by any lawful administrative or legal proceeding, court order, or similar directive with the force of law. All City data, data lists, trade secrets, documents with personal identifying information, documents that are not public records , draft documents, discussions, or other information shall be returned to City upon the termination or expiration of this Agreement. Contracting Party’s covenant under this section shall survive the termination or expiration of this Agreement. 8. ENFORCEMENT OF AGREEMENT. 8.1 California Law. This Agreement shall be interpreted, construed, and governed both as to validity and to performance of the parties in accordance with the laws of the State of California. Legal actions concerning any dispute, claim, or matter arising out of or in relation to this Agreement shall be instituted in the Superior Court of the County of Riverside, State of California, or any other appropriate court in such county, and Contracting Party covenants and agrees to submit to the personal jurisdiction of such court in the event of such action. 8.2 Disputes. In the event of any dispute arising under this Agreement, the injured party shall notify the injuring party in writing of its contentions by submitting a claim therefore. The injured party shall continue performing its obligations hereunder so long as the injuring party commences to cure such default within ten (10) days of service of such notice and completes the cure of such default within forty-five (45) days after service of the notice, or such longer period as may be permitted by the Contract Officer, or assigned designee; provided that if the default is an immediate danger to the health, safety, or general welfare, City may take such immediate action as City deems warranted. Compliance with the provisions of this Section shall be a condition precedent to termination of this Agreement for cause and to any legal action, and such compliance shall not be a waiver of any party’s right to take legal action in the event that the dispute is not cured, provided that nothing herein shall limit City’s right to terminate this Agreement without cause pursuant to this Article 8.0. During the period of time that Contracting Party is in default, City shall hold all invoices and shall, when the defau lt is cured, proceed with payment on the invoices. In the alternative, City may, in its sole discretion, elect to pay some or all of the outstanding invoices during any period of default. 303 -12- 8.3 Retention of Funds. City may withhold from any monies payable to Contracting Party sufficient funds to compensate City for any losses, costs, liabilities, or damages it reasonably believes were suffered by City due to the default of Contracting Party in the performance of the Services required by this Agreement. 8.4 Waiver. No delay or omission in the exercise of any right or remedy of a non-defaulting party on any default shall impair such right or remedy or be construed as a waiver. City’s consent or approval of any act by Contracting Party requiring City’s consent or approval shall not be deemed to waive or render unnecessary City’s consent to or approval of any subsequent act of Contracting Party. Any waiver by either party of any default must be in writing and shall not be a waiver of any other default concerning the same or any other provision of this Agreement. 8.5 Rights and Remedies are Cumulative. Except with respect to rights and remedies expressly declared to be exclusive in this Agreement, the rights and remedies of the parties are cumulative and the exercise by either party of one or more of such rights or remedies shall not preclude the exercise by it, at the same or different times, of any other rights or remedies for the same default or any other default by the other party. 8.6 Legal Action. In addition to any other rights or remedies, either party may take legal action, at law or at equity, to cure, correct, or remedy any default, to recover damages for any default, to compel specific performance of this Agreement, to obtain declaratory or injunctive relief, or to obtain any other remedy consistent with the purposes of this Agreement. 8.7 Termination Prior To Expiration of Term. This Section shall govern any termination of this Agreement, except as specifically provided in the following Section for termination for cause. City reserves the right to terminate this Agreement at any time, with or without cause, upon thirty (30) days’ written notice to Contracting Party. Upon receipt of any notice of termination, Contracting Party shall immediately cease all Services hereunder except such as may be specifically approved by the Contract Officer, or assigned designee. Contracting Party shall be entitled to compensation for all Services rendered prior to receipt of the notice of termination and for any Services authorized by the Contract Officer, or assigned designee, thereafter in accordance with the Schedule of Compensation or such as may be approved by the Contract Officer, or assigned designee, except amounts held as a retention pursuant to this Agreement. 8.8 Termination for Default of Contracting Party. If termination is due to the failure of Contracting Party to fulfill its obligations under this Agreement, Contracting Party shall vacate any City-owned property which Contracting 304 -13- Party is permitted to occupy hereunder and City may, after compliance with the provisions of Section 8.2, take over the Services and prosecute the same to completion by contract or otherwise, and Contracting Party shall be liable to the extent that the total cost for completion of the Services required hereunder exceeds the compensation herein stipulated (provided that City shall use reasonable efforts to mitigate such damages), and City may withhold any payments to Contracting Party for the purpose of setoff or partial payment of the amounts owed City. 8.9 Attorneys’ Fees. If either party to this Agreement is required to initiate or defend or made a party to any action or proceeding in any way connected with this Agreement, the prevailing party in such action or proceeding, in addition to any other relief which may be granted, whether legal or equitable, shall be entitled to reasonable attorneys’ fees; provided, however, that the attorneys’ fees awarded pursuant to this Section shall not exceed the hourly rate paid by City for legal services multiplied by the reasonable number of hours spent by the prevailing party in the conduct of the litigation. Attorneys’ fees shall include attorneys’ fees on any appeal, and in addition a party entitled to attorneys’ fees shall be entitled to all other reasonable costs for investigating such action, taking depositions and discovery, and all other necessary costs the court allows which are incurred in such litigation. All such fees shall be deemed to have accrued on commencement of such action and shall be enforceable whether or not such action is prosecuted to judgment. The court may set such fees in the same action or in a separate action brought for that purpose. 9. CITY OFFICERS AND EMPLOYEES; NONDISCRIMINATION. 9.1 Non-liability of City Officers and Employees. No officer, official, employee, agent, representative, or volunteer of City shall be personally liable to Contracting Party, or any successor in interest, in the event or any d efault or breach by City or for any amount which may become due to Contracting Party or to its successor, or for breach of any obligation of the terms of this Agreement. 9.2 Conflict of Interest. Contracting Party covenants that neither it, nor any officer or principal of it, has or shall acquire any interest, directly or indirectly, which would conflict in any manner with the interests of City or which would in any way hinder Contracting Party’s performance of the Services under this Agreement. Contracting Party further covenants that in the performance of this Agreement, no person having any such interest shall be employed by it as an officer, employee, agent, or subcontractor without the express written consent of the Contract Officer , or assigned designee. Contracting Party agrees to at all times avoid conflicts of interest or the 305 -14- appearance of any conflicts of interest with the interests of City in the performance of this Agreement. No officer or employee of City shall have any financial interest, direct or indirect, in this Agreement nor shall any such officer or employee participate in any decision relating to this Agreement which effects his financial interest or the financial interest of any corporation, partnership or association in which he is, directly or indirectly, interested, in violation of any State statute or regulation. Contracting Party warrants that it has not paid or given and will not pay or give any third party any money or other consideration for obtaining this Agreement. 9.3 Covenant against Discrimination. Contracting Party covenants that, by and for itself, its heirs, executors, assigns, and all persons claiming under or through them, that there shall be no discrimination against or segregation of, any person or group of persons on account of any impermissible classification including, but not limited to, race, color, creed, religion, sex, marital status, sexual orientation, national origin, or ancestry in the performance of this Agreement. Contracting Party shall take affirmative action to ensure that applicants are employed and that employees are treated during employment without regard to their race, color, creed, religion, sex, marital status, sexual orientation, national origin, or ancestry. 10. MISCELLANEOUS PROVISIONS. 10.1 Notice. Any notice, demand, request, consent, approval, or communication either party desires or is required to give the other party or any other person shall be in writing and either served personally or sent by prepaid, first-class mail to the address set forth below. Either party may change its address by notifying the other party of the change of address in writing. Notice shall be deemed communicated forty-eight (48) hours from the time of mailing if mailed as provided in this Section. To City: CITY OF LA QUINTA Attention: Dianne Hansen Interim Management Analyst 78495 Calle Tampico La Quinta, California 92253 To Contracting Party: Name: SOUTHWEST AQUATICS Attention: Chris Beaty President P.O. Box 13212 Palm Desert, CA 92255 306 -15- 10.2 Interpretation. The terms of this Agreement shall be construed in accordance with the meaning of the language used and shall not be construed for or against either party by reason of the authorship of this Agreement or any other rule of construction which might otherwise apply. 10.3 Section Headings and Subheadings. The section headings and subheadings contained in this Agreement are included for convenience only and shall not limit or otherwise affect the terms of this Agreement. 10.4 Counterparts. This Agreement may be executed in counterparts, each of which shall be deemed to be an original, and such counterparts shall constitute one and the same instrument 10.5 Integrated Agreement. This Agreement including the exhibits hereto is the entire, complete, and exclusive expression of the understanding of the parties. It is understood that there are no oral agreements between the parties hereto affecting this Agreement and this Agreement supersedes and cancels any and all previous negotiations, arrangements, agreements, and understandings, if any, between the parties, and none shall be used to interpret this Agreement. 10.6 Amendment. No amendment to or modification of this Agreement shall be valid unless made in writing and approved by Contracting Party and by the City Council of City. The parties agree that this requirement for written modifications cannot be waived and that any attempted waiver shall be void. 10.7 Severability. In the event that any one or more of the articles, phrases, sentences, clauses, paragraphs, or sections contained in this Agreement shall be declared invalid or unenforceable, such invalidity or unenforceability shall not affect any of the remaining articles, phrases, sentences, clauses, paragraphs, or sections of this Agreement which are hereby declared as severable and shall be interpreted to carry out the intent of the parties hereunder unless the invalid provision is so material that its invalidity deprives either party of the basic benefit of their bargain or renders this Agreement meaningless. 10.8 Unfair Business Practices Claims. In entering into this Agreement, Contracting Party offers and agrees to assign to City all rights, title, and interest in and to all causes of action it may have under Section 4 of the Clayton Act (15 U.S.C. § 15) or under the Cartwright Act (Chapter 2, (commencing with Section 16700) of Part 2 of Division 7 of the Business and Professions Code), arising from purchases of goods, services, or materials related to this Agreement. This assignment shall be made and become effective at the time City renders final payment to Contracting Party without further acknowledgment of the parties. 307 -16- 10.9 No Third-Party Beneficiaries. With the exception of the specific provisions set forth in this Agreement, there are no intended third -party beneficiaries under this Agreement and no such other third parties shall have any rights or obligations hereunder. 10.10 Authority. The persons executing this Agreement on behalf of each of the parties hereto represent and warrant that (i) such party is duly organized and existing, (ii) they are duly authorized to execute and deliver this Agreement on behalf of said party, (iii) by so executing this Agreement, such party is formally bound to the provisions of this Agreement, and (iv) that entering into this Agreement does not violate any provision of any other Agreement to which said party is bound. This Agreement shall be binding upon the heirs, executors, administrators, successors, and assigns of the parties. [SIGNATURES ON FOLLOWING PAGE] 308 -17- IN WITNESS WHEREOF, the parties have executed this Agreement as of the dates stated below. CITY OF LA QUINTA, a California Municipal Corporation JON McMILLEN, City Manager City of La Quinta, California Dated: CONTRACTING PARTY: ATTEST: MONIKA RADEVA, City Clerk La Quinta, California By: Name: Title: APPROVED AS TO FORM: WILLIAM H. IHRKE, City Attorney City of La Quinta, California 309 Exhibit A Page 1 of 7 Last revised summer 2017 Exhibit A Scope of Services Civic Center Campus Lake is located at 78488 Avenida La Fonda. 1.0 SCOPE OF WORK The work shall include furnishing all labor and equipment necessary to maintain the Civic Center Campus lake. Duties include, but are not limited to, the following: Civic Center Campus Lake: Service – Twice per week Civic Center Campus Lake shall be maintained in “first-class condition,” “First-class condition” is defined as the following characteristics: • absence of objectionable odor and water • absence of inappropriate debris and trash • The level of the lake shall not exceed the liner and shall be maintained four inches below the shore line. 1. Debris Removal A. Contractor shall remove all trash, such as paper, cans, bottles, broken glass, and floating debris from water features and surrounding areas. B. Contractor shall remove any organic matter such as leaves or branches that create an aesthetically unpleasant or biologically undesirable condition. C. All refuse shall be removed and taken to a sanitary landfill. D. Algae shall be removed from rocks (scrubbed) as needed. 2. Chemical Applications A. Contractor shall provide complete and continuous control and/or eradication of all noxious aquatic plant or algae growth B. Contractor shall complete and furnish a pesticide application log to City. The log shall include the following information: 1) The target pest(s) 2) Method(s) of control 3) Copies of product labels 4) MSDS 5) Frequency schedule(s) 6) Copies of PCA recommendations 310 Exhibit A Page 2 of 7 3. Water Quality/Clarity and pH A. The Civic Center Lake supports a variety of aquatic. 1) Contractor shall maintain a water pH balance that promotes optimal health conditions of aquatic life, waterfowl and wildlife in and around the lake. 2) Contractor shall maintain the level of water clarity such that the average Secchi disk measurement is at least 18 inches. 4. Notification A. Contractor shall notify the Interim Management Analyst (or his designee) of any conditions noted that require further monitoring, investigation, or remedy for the safe and optimal operation of water features and related equipment. 5. Reports A. Contractor shall produce and deliver to the Interim Management Analyst (or his designee) a report indicating all service activities performed, monthly. Equipment A. Contractor shall possess a working knowledge of pumps and equipment, inspect weekly and notify the City’s Representative of any abnormalities. B. Pumps and motors shall be visually inspected for abnormal conditions and lubricated per manufacturer’s specifications. C. Skimmers shall be visually inspected and emptied of debris. D. Contractor is responsible to keep the pump house free of excess debris, water/algae buildup. Maintenance Activity Civic Center Lake Remove debris 2 times per week* Visually inspect all equipment Monthly Inspect and empty skimmers/baskets 2 times per week* Chemical applications Continuously as needed Check motor(s) Quarterly Water quality/clarity and pH maintenance Continuously as needed pH balance test and adjustment Weekly Algae removal from rocks As needed Lake Maintenance; Monday and Friday before 10:00 AM 311 Exhibit A Page 3 of 7 1. Performance Standards: Measurement and Payment City has specific criteria by which to evaluate the performance of Contractor on a weekly basis. If performance by Contractor is deficient, City reserves the right to subtract an associated amount form the monthly billing. Since it is difficult to quantify and assess a value to every aspect of the work, City may implement liquidated damages of $250 per day per incident until the deficiency is corrected. The following is a brief summary of possible deficiencies: 1. Failure to comply with contract specifications. 2. Failure to comply in a timely manner with contractually legitimate requests made by City. 3. Failure to provide specified reports or falsification of reports. 4. Failure to supply adequate equipment, labor or supervision. 5. Failure to repair deficiencies in the allotted time frame. 6. Failure to comply with schedules. 7. Failure to protect public health and safety. 8. Failure to provide adequate identification on vehicles or employees. In the event Contractor fails to perform contractual obligations to the satisfaction of City, City many choose to obtain the services of a separate lake maintenance provider to fulfill Contractor’s obligations, and any and all associated charges shall be the responsibility of the Contractor. 312 Exhibit A Page 4 of 7 ADDENDUM TO AGREEMENT Re: Scope of Services If the Scope of Services include construction, alteration, demolition, installation, repair, or maintenance affecting real property or structures or improvements of any kind appurtenant to real property, the following apply: 1. Prevailing Wage Compliance. If Contracting Party is a contractor performing public works and maintenance projects, as described in this Section 1.3, Contracting Party shall comply with applicable Federal, State, and local laws. Contracting Party is aware of the requirements of California Labor Code Sections 1720, et seq., and 1770, et seq., as well as California Code of Regulations, Title 8, Sections 16000, et seq., (collectively, the “Prevailing Wage Laws”), and La Quinta Municipal Code Section 3.12.040, which require the payment of prevailing wage rates and the performance of other requirements on “Public works” and “Maintenance” projects. If the Services are being performed as part of an applicable “Public works” or “Maintenance” project, as defined by the Prevailing Wage Laws, and if construction work over twenty-five thousand dollars ($25,000.00) and/or alterations, demolition, repair or maintenance work over fifteen thousand dollars ($15,000.00) is entered into or extended on or after January 1, 2015 by this Agreement, Contracting Party agrees to fully comply with such Prevailing Wage Laws including, but not limited to, requirements related to the maintenance of payroll records and the employment of apprentices. Pursuant to California Labor Code Section 1725.5, no contractor or subcontractor may be awarded a contract for public work on a “Public works” project unless registered with the California Department of Industrial Relations (“DIR”) at the time the contract is awarded. If the Services are being performed as part of an applicable “Public works” or “Maintenance” project, as defined by the Prevailing Wage Laws, this project is subject to compliance monitoring and enforcement by the DIR. Contracting Party will maintain and will require all subcontractors to maintain valid and current DIR Public Works contractor registration during the term of this Agreement. Contracting Party shall notify City in writing immediately, and in no case more than twenty-four (24) hours, after receiving any information that Contracting Party’s or any of its subcontractor’s DIR registration status has been suspended, revoked, expired, or otherwise changed. It is understood that it is the responsibility of Contracting Party to determine the correct salary scale. Contracting Party shall make copies of the prevailing rates of per diem wages for each craft, classification, or type of worker needed to execute the Services available to interested parties upon request, and shall post copies at Contracting Party’s principal place of business and at the project site, if any. The statutory penalties for failure to pay prevailing wage or to comply with State wage and hour laws will be enforced. Contracting Party must forfeit to City TWENTY- 313 Exhibit A Page 5 of 7 FIVE DOLLARS ($25.00) per day for each worker who works in excess of the minimum working hours when Contracting Party does not pay overtime. In accordance with the provisions of Labor Code Sections 1810 et seq., eight (8) hours is the legal working day. Contracting Party also shall comply with State law requirements to maintain payroll records and shall provide for certified records and inspection of records as required by California Labor Code Section 1770 et seq., including Section 1776. In addition to the other indemnities provided under this Agreement, Contracting Party shall defend (with counsel selected by City), indemnify, and hold City, its elected officials, officers, employees, and agents free and harmless from any claim or liability arising out of any failure or alleged failure to comply with the Prevailing Wage Laws. It is agreed by the parties that, in connection with performance of the Services, including, without limitation, any and all “Public works” (as defined by the Prevailing Wage Laws), Contracting Party shall bear all risks of payment or non-payment of prevailing wages under California law and/or the implementation of Labor Code Section 1781, as the same may be amended from time to time, and/or any other similar law. Contracting Party acknowledges and agrees that it shall be independently responsible for reviewing the applicable laws and regulations and effectuating compliance with such laws. Contracting Party shall require the same of all subcontractors. 2. Retention. Payments shall be made in accordance with the provisions of Article 2.0 of the Agreement. In accordance with said Sections, City shall pay Contracting Party a sum based upon ninety-five percent (95%) of the Contract Sum apportionment of the labor and materials incorporated into the Services under this Agreement during the month covered by said invoice. The remaining five percent (5%) thereof shall be retained as performance security to be paid to Contracting Party withi n sixty (60) days after final acceptance of the Services by the City Council of City, after Contracting Party has furnished City with a full release of all undisputed payments under this Agreement, if required by City. In the event there are any claims specifically excluded by Contracting Party from the operation of the release, City may retain proceeds (per Public Contract Code § 7107) of up to one hundred fifty percent (150%) of the amount in dispute. City’s failure to deduct or withhold shall not affect Contracting Party’s obligations under the Agreement. 3. Utility Relocation. City is responsible for removal, relocation, or protection of existing main or trunk-line utilities to the extent such utilities were not identified in the invitation for bids or specifications. City shall reimburse Contracting Party for any costs incurred in locating, repairing damage not caused by Contracting Party, and removing or relocating such unidentified utility facilities. Contracting Party shall not be assessed liquidate d 314 Exhibit A Page 6 of 7 damages for delay arising from the removal or relocation of such unidentified utility facilities. 4. Trenches or Excavations. Pursuant to California Public Contract Code Section 7104, in the event the work included in this Agreement requires excavations more than four (4) feet in depth, the following shall apply: (a) Contracting Party shall promptly, and before the following conditions are disturbed, notify City, in writing, of any: (1) material that Contracting Party believes may be material that is hazardous waste, as defined in Section 25117 of the Health and Safety Code, that is required to be removed to a Class I, Class II, or Class III disposal site in accordance with provisions of existing law; (2) subsurface or latent physical conditions at the site different from those indicated by information about the site made available to bidders prior to the deadline for submitting bids; or (3) unknown physical conditions at the site of any unusual nature, different materially from those ordinarily encountered and generally recognized as inherent in work of the character provided for in the Agreement. (b) City shall promptly investigate the conditions, and if it finds that the conditions do materially so differ, or do involve hazardous waste, and cause a decrease or increase in Contracting Party’s cost of, or the time required for, performance of any part of the work shall issue a change order per Section 1.8 of the Agreement. (c) in the event that a dispute arises between City and Contracting Party whether the conditions materially differ, or involve hazardous waste, or cause a decrease or increase in Contracting Party’s cost of, or time required for, performance of any part of the work, Contracting Party shall not be excused from any scheduled completion date provided for by this Agreement, but shall proceed with all work to be performed under this Agreement. Contracting Party shall retain any and all rights provided either by contract or by law which pertain to the resolution of disputes and protests between the contracting Parties. 5. Safety. Contracting Party shall execute and maintain its work so as to avoid injury or damage to any person or property. In carrying out the Services, Contracting Party shall at all times be in compliance with all applicable local, state, and federal laws, rules and regulations, and shall exercise all necessary precautions for the safety of employees appropriate to the nature of the work and the conditions under which the work is to be performed. Safety precautions as applicable shall include, but shall not be limited to: (A) adequate life protection and lifesaving equipment and procedures; (B) instructions in accident prevention for all employees and subcontractors, such as safe walkways, scaffolds, fall protection ladders, 315 Exhibit A Page 7 of 7 bridges, gang planks, confined space procedures, trenching and shoring, equipment and other safety devices, equipment and wearing apparel as are necessary or lawfully required to prevent accidents or injuries; and (C) adequate facilities for the proper inspection and maintenance of all safety measures. 6. Liquidated Damages. Since the determination of actual damages for any delay in performance of the Agreement would be extremely difficult or impractical to determine in the event of a breach of this Agreement, Contracting Party shall be liable for and shall pay to City the sum of One Thousand dollars ($1,000.00) as liquidated damages for each working day of delay in the performance of any of the Services required hereunder, as specified in the Schedule of Performance. In addition, liquidated damages may be assessed for failure to comply with the emergency call out requirements, if any, described in the Scope of Services. City may withhold from any moneys payable on account of the Services performed by Contracting Party any accrued liquidated damages. 316 Exhibit B Page 1 of 1 Exhibit B Schedule of Compensation With the exception of compensation for Additional Services, provided for in Section 2.3 of this Agreement, the maximum total compensation to be paid to Contracting Party under this Agreement is not to exceed: ITEM NO: DESCRIPTION MONTHLY PRICE ANNUAL PRICE 1 CIVIC CENTER CAMPUS LAKE MAINTENANCE SERVICES $1,350.00 $16,200 TOTAL: $1,350.00 $16,200 The Contract Sum shall be paid to Contracting Party in installment payments made on a monthly basis and in an amount identified in Contracting Party’s schedule of compensation attached hereto for the work tasks performed and properly invoiced by Contracting Party in conformance with Section 2.2 of this Agreement. 317 Exhibit C Page 1 of 1 Exhibit C Schedule of Performance Contracting Party shall complete all services identified in the Scope of Services, Exhibit A of this Agreement, in accordance with the Project Schedule, attached hereto and incorporated by this reference. Lake Maintenance Services shall be performed twice weekly on Monday and Friday of each week. 1 WORKING HOURS Maintenance and operation of equipment within one half mile of human occupancy shall be performed only during the time periods as follows: October 1st to April 30th Monday – Friday 7 a.m. to 5:30 p.m. Saturday – Sunday 8 a.m. to 5 p.m. May 1st to September 30th Monday - Friday 7 a.m. to 7 p.m. Saturday – Sunday 8 a.m. to 5 p.m. The Contractor shall notify the Interim Management Analyst at least 24 hours prior to any work outside the normal working hours defined above, on weekends or holidays. 318 Exhibit D Page 1 of 1 Exhibit D Special Requirements Contractor must provide the regular services and expertise of either a Freshwater Biologist or Certified Lake Manager either as the prime contractor, or as a subcontractor. Licenses and Certifications: • Class C-27 (Landscaping Contractor) • State Pesticide Applicators License (QAL Category F) • Riverside County Pesticide Business License, and all applicable county and local certifications, permits and business licenses associated with the application of aquatic pest control chemicals. 319 Exhibit E Page 1 of 6 Exhibit E Insurance Requirements E.1 Insurance. Prior to the beginning of and throughout the duration of this Agreement, the following policies shall be maintained and kept in full force and effect providing insurance with minimum limits as indicated below and issued by insurers with A.M. Best ratings of no less than A-VI: Commercial General Liability (at least as broad as ISO CG 0001) $1,000,000 (per occurrence) $2,000,000 (general aggregate) Must include the following endorsements: General Liability Additional Insured General Liability Primary and Non-contributory Commercial Auto Liability (at least as broad as ISO CA 0001) $1,000,000 (per accident) Personal Auto Declaration Page if applicable Workers’ Compensation (per statutory requirements) Must include the following endorsements: Workers Compensation with Waiver of Subrogation Workers Compensation Declaration of Sole Proprietor if applicable Contracting Party shall procure and maintain, at its cost, and submit concurrently with its execution of this Agreement, Commercial General Liability insurance against all claims for injuries against persons or damages to property resulting from Contracting Party’s acts or omissions rising out of or related to Contracting Party’s performance under this Agreement. The insurance policy shall contain a severability of interest clause providing that the coverage shall be primary for losses arising out of Contracting Party’s performance hereunder and neither City nor its insurers shall be required to contribute to any such loss. An endorsement evidencing the foregoing and naming the City and its officers and employees as additional insured (on the Commercial General Liability policy only) must be submitted concurrently with the execution of this Agreement and approved by City prior to commencement of the services hereunder. Contracting Party shall carry automobile liability insurance of $1,000,000 per accident against all claims for injuries against persons or damages to property arising out of the use of any automobile by Contracting Party, its officers, any person directly or indirectly employed by Contracting 320 Exhibit E Page 2 of 6 Party, any subcontractor or agent, or anyone for whose acts any of them may be liable, arising directly or indirectly out of or related to Contracting Party’s performance under this Agreement. If Contracting Party or Contracting Party’s employees will use personal autos in any way on this project, Contracting Party shall provide evidence of personal auto liability coverage for each such person. The term “automobile” includes, but is not limited to, a land motor vehicle, trailer or semi-trailer designed for travel on public roads. The automobile insurance policy shall contain a severability of interest clause providing that coverage shall be primary for losses arising out of Contracting Party’s performance hereunder and neither City nor its insurers shall be required to contribute to such loss. Contracting Party shall carry Workers’ Compensation Insurance in accordance with State Worker’s Compensation laws with employer’s liability limits no less than $1,000,000 per accident or disease. Contracting Party shall provide written notice to City within ten (10) working days if: (1) any of the required insurance policies is terminated; (2) the limits of any of the required polices are reduced; or (3) the deductible or self-insured retention is increased. In the event any of said policies of insurance are cancelled, Contracting Party shall, prior to the cancellation date, submit new evidence of insurance in conformance with this Exhibit to the Contract Officer. The procuring of such insurance or the delivery of policies or certificates evidencing the same shall not be construed as a limitation of Contracting Party’s obligation to indemnify City, its officers, employees, contractors, subcontractors, or agents. E.2 Remedies. In addition to any other remedies City may have if Contracting Party fails to provide or maintain any insurance policies or policy endorsements to the extent and within the time herein required, City may, at its sole option: a. Obtain such insurance and deduct and retain the amount of the premiums for such insurance from any sums due under this Agreement. b. Order Contracting Party to stop work under this Agreement and/or withhold any payment(s) which become due to Contracting Party hereunder until Contracting Party demonstrates compliance with the requirements hereof. c. Terminate this Agreement. Exercise of any of the above remedies, however, is an alternative to any other remedies City may have. The above remedies are not the exclusive remedies for Contracting Party’s failure to maintain or secure appropriate 321 Exhibit E Page 3 of 6 policies or endorsements. Nothing herein contained shall be construed as limiting in any way the extent to which Contracting Party may be held responsible for payments of damages to persons or property resulting from Contracting Party’s or its subcontractors’ performance of work under this Agreement. E.3 General Conditions Pertaining to Provisions of Insurance Coverage by Contracting Party. Contracting Party and City agree to the following with respect to insurance provided by Contracting Party: 1. Contracting Party agrees to have its insurer endorse the third party general liability coverage required herein to include as additional insureds City, its officials, employees, and agents, using standard ISO endorsement No. CG 2010 with an edition prior to 1992. Contracting Party also agrees to require all contractors, and subcontractors to do likewise. 2. No liability insurance coverage provided to comply with this Agreement shall prohibit Contracting Party, or Contracting Party’s employees, or agents, from waiving the right of subrogation prior to a loss. Contracting Party agrees to waive subrogation rights against City regardless of the applicability of any insurance proceeds, and to require all contractors and subcontractors to do likewise. 3. All insurance coverage and limits provided by Contracting Party and available or applicable to this Agreement are intended to apply to the full extent of the policies. Nothing contained in this Agreement or any other agreement relating to City or its operations limits the application of such insurance coverage. 4. None of the coverages required herein will be in compliance with these requirements if they include any limiting endorsement of any kind that has not been first submitted to City and approved of in writing. 5. No liability policy shall contain any provision or definition that would serve to eliminate so-called “third party action over” claims, including any exclusion for bodily injury to an employee of the insured or of any contractor or subcontractor. 6. All coverage types and limits required are subject to approval, modification and additional requirements by the City, as the need arises. Contracting Party shall not make any reductions in scope of coverage (e.g. elimination of contractual liability or reduction of discovery period) that may affect City’s protection without City’s prior written consent. 322 Exhibit E Page 4 of 6 7. Proof of compliance with these insurance requirements, consisting of certificates of insurance evidencing all the coverages required and an additional insured endorsement to Contracting Party’s general liability policy, shall be delivered to City at or prior to the execution of this Agreement. In the event such proof of any insurance is not delivered as required, or in the event such insurance is canceled at any time and no replacement coverage is provided, City has the right, but not the duty, to obtain any insurance it deems necessary to protect its interests under this or any other agreement and to pay the premium. Any premium so paid by City shall be charged to and promptly paid by Contracting Party or deducted from sums due Contracting Party, at City option. 8. It is acknowledged by the parties of this agreement that all insurance coverage required to be provided by Contracting Party or any subcontractor, is intended to apply first and on a primary, non -contributing basis in relation to any other insurance or self-insurance available to City. 9. Contracting Party agrees to ensure that subcontractors, and any other party involved with the project that is brought onto or involved in the project by Contracting Party, provide the same minimum insurance coverage required of Contracting Party. Contracting Party agrees to monitor and review all such coverage and assumes all responsibility for ensuring that such coverage is provided in conformity with the requirements of this section. Contracting Party agrees that upon request, all agreements with subcontractors and others engaged in the project will be submitted to City for review. 10. Contracting Party agrees not to self-insure or to use any self- insured retentions or deductibles on any portion of the insurance required herein (with the exception of professional liability coverage, if required) and further agrees that it will not allow any contractor, subcontractor, Architect, Engineer or other entity or person in any way involved in the performance of work on the project contemplated by this agreement to self-insure its obligations to City. If Contracting Party’s existing coverage includes a deductible or self-insured retention, the deductible or self -insured retention must be declared to the City. At that time the City shall review options with the Contracting Party, which may include reduction or elimination of the deductible or self-insured retention, substitution of other coverage, or other solutions. 11. The City reserves the right at any time during the term of this Agreement to change the amounts and types of insurance required by g iving the Contracting Party ninety (90) days advance written notice of such change. If such change results in substantial additional cost to the Contracting Party, 323 Exhibit E Page 5 of 6 the City will negotiate additional compensation proportional to the increased benefit to City. 12. For purposes of applying insurance coverage only, this Agreement will be deemed to have been executed immediately upon any party hereto taking any steps that can be deemed to be in furtherance of or towards performance of this Agreement. 13. Contracting Party acknowledges and agrees that any actual or alleged failure on the part of City to inform Contracting Party of non - compliance with any insurance requirement in no way imposes any additional obligations on City nor does it waive any rights hereunder in this or any other regard. 14. Contracting Party will renew the required coverage annually as long as City, or its employees or agents face an exposure from operations of any type pursuant to this agreement. This obligation applies whether the agreement is canceled or terminated for any reason. Termination of this obligation is not effective until City executes a written statement to that effect. 15. Contracting Party shall provide proof that policies of insurance required herein expiring during the term of this Agreement have been renewed or replaced with other policies providing at least the same coverage. Proof that such coverage has been ordered shall be submitted prior to expiration. A coverage binder or letter from Contracting Party’s insurance agent to this effect is acceptable. A certificate of insurance and an additional insured endorsement is required in these specifications applicable to the renewing or new coverage must be provided to City within five (5) days of the expiration of coverages. 16. The provisions of any workers’ compensation or similar act will not limit the obligations of Contracting Party under this agreement. Contracting Party expressly agrees not to use any statutory immunity defenses under such laws with respect to City, its employees, officials, and agents. 17. Requirements of specific coverage features, or limits contained in this section are not intended as limitations on coverage, limits or other requirements nor as a waiver of any coverage normally provided by any given policy. Specific reference to a given coverage feature is for purposes of clarification only as it pertains to a given issue and is not intended by any party or insured to be limiting or all-inclusive. 18. These insurance requirements are intended to be separate and distinct from any other provision in this Agreement and are intended by the parties here to be interpreted as such. 324 Exhibit E Page 6 of 6 19. The requirements in this Exhibit supersede all other sections and provisions of this Agreement to the extent that any other section or provision conflicts with or impairs the provisions of this Exhibit. 20. Contracting Party agrees to be responsible for ensuring that no contract used by any party involved in any way with the project reserves the right to charge City or Contracting Party for the cost of additional insurance coverage required by this agreement. Any such provisions are to be deleted with reference to City. It is not the intent of City to reimburse any third party for the cost of complying with these requirements. There shall be no recourse against City for payment of premiums or other amounts with respect thereto. 21. Contracting Party agrees to provide immediate notice to City of any claim or loss against Contracting Party arising out of the work performed under this agreement. City assumes no obligation or liability by such notice, but has the right (but not the duty) to monitor the handling of any such claim or claims if they are likely to involve City. 325 Exhibit F Page 1 of 3 Exhibit F Indemnification F.1 Indemnity for the Benefit of City. a. Indemnification for Professional Liability. When the law establishes a professional standard of care for Contracting Party’s Services, to the fullest extent permitted by law, Contracting Party shall indemnify, protect, defend (with counsel selected by City), and hold harmless City and any and all of its officials, employees, and agents (“Indemnified Parties”) from and against any and all claims, losses, liabilities of every kind, nature, and description, damages, injury (including, without limitation, injury to or death of an employee of Contracting Party or of any subcontractor), costs and expenses of any kind, whether actual, alleged or threatened, including, without limitation, incidental and consequential damages, court costs, attorneys’ fees, litigation expenses, and fees of expert consultants or expert witnesses incurred in connection therewith and costs of investigation, to the extent same are caused in whole or in part by any negligent or wrongful act, error or omission of Contracting Party, its officers, agents, employees or subcontractors (or any entity or individual that Contracting Party shall bear the legal liability thereof) in the performance of professional services under this agreement. With respect to the design of public improvements, the Contracting Party shall not be liable for any injuries or property damage resulting from the reuse of the design at a location other than that specified in Exhibit A without the written consent of the Contracting Party. b. Indemnification for Other Than Professional Liability. Other than in the performance of professional services and to the full extent permitted by law, Contracting Party shall indemnify, defend (with counsel selected by City), and hold harmless the Indemnified Parties from and against any liability (including liability for claims, suits, actions, arbitration proceedings, administrative proceedings, regulatory proceedings, losses, expenses or costs of any kind, whether actual, alleged or threatened, including, without limitation, incidental and consequential damages, court costs, attorneys’ fees, litigation expenses, and fees of expert consultants or expert witnesses) incurred in connection therewith and costs of investigation, where the same arise out of, are a consequence of, or are in any way attributable to, in whole or in part, the performance of this Agreement by Contracting Party or by any individual or entity for which Contracting Party is legally liable, including but not limited to officers, agents, employees, or subcontractors of Contracting Party. c. Indemnity Provisions for Contracts Related to Construction (Limitation on Indemnity). Without affecting the rights of City under any 326 Exhibit F Page 2 of 3 provision of this agreement, Contracting Party shall not be required to indemnify and hold harmless City for liability attributable to the acti ve negligence of City, provided such active negligence is determined by agreement between the parties or by the findings of a court of competent jurisdiction. In instances where City is shown to have been actively negligent and where City’s active negligence accounts for only a percentage of the liability involved, the obligation of Contracting Party will be for that entire portion or percentage of liability not attributable to the active negligence of City. d. Indemnification Provision for Design Professionals. 1. Applicability of this Section F.1(d). Notwithstanding Section F.1(a) hereinabove, the following indemnification provision shall apply to a Contracting Party who constitutes a “design professional” as the term is defined in paragraph 3 below. 2. Scope of Indemnification. When the law establishes a professional standard of care for Contracting Party’s Services, to the fullest extent permitted by law, Contracting Party shall indemnify and hold harmless City and any and all of its officials, employees, and agents (“Indemnified Parties”) from and against any and all losses, liabilities of every kind, nature, and description, damages, injury (including, without limitation, injury to or death of an employee of Contracting Party or of any subcontractor), costs and expenses, including, without limitation, incidental and consequential damages, court costs, reimbursement of attorneys’ fees, litigation expenses, and fees of expert consultants or expert witnesses incurred in connection therewith and costs of investigation, to the extent same are caused by any negligent or wrongful act, error or omission of Contracting Party, its officers, agents, employees or subcontractors (or any entity or individual that Contracting Party shall bear the legal liability thereof) in the performance of professional services under this agreement. With respect to the design of public improvements, the Contracting Party shall not be liable for any injuries or property damage resulting from the reuse of the design at a location other than that specified in Exhibit A without the written consent of the Contracting Party. 3. Design Professional Defined. As used in this Section F.1(d), the term “design professional” shall be limited to licensed architects, registered professional engineers, licensed professional land surveyors and landscape architects, all as defined under current law, and as may be amended from time to time by Civil Code § 2782.8. F.2 Obligation to Secure Indemnification Provisions. Contracting Party agrees to obtain executed indemnity agreements with provisions 327 Exhibit F Page 3 of 3 identical to those set forth herein this Exhibit F, as applicable to the Contracting Party, from each and every subcontractor or any other person or entity involved by, for, with or on behalf of Contracting Party in the performance of this Agreement. In the event Contracting Party fails to obtain such indemnity obligations from others as required herein, Contracting Party agrees to be fully responsible according to the terms of this Exhibit. Failure of City to monitor compliance with these requirements imposes no additional obligations on City and will in no way act as a waiver of any rights hereunder. This obligation to indemnify and defend City as set forth in this Agreement are binding on the successors, assigns or heirs of Contracting Party and shall survive the termination of this Agreement. 328 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: DISCUSS SHORT-TERM VACATION RENTAL PROGRAM AND CODE COMPLIANCE UPDATES RECOMMENDATION Discuss short-term vacation rental program updates and review compliance efforts. EXECUTIVE SUMMARY •City staff continually seeks improvements to the short-term vacation rental (STVR) program to maintain a balance between residential quality of life and allowing property owners to host STVRs. •In August 2018, the STVR ordinance was updated to clarify regulations and streamline the process. A STVR team was formed to review and make further enhancements to the program. •Online application and reporting are critical for advancement of the STVR program. FISCAL IMPACT – None. BACKGROUND/ANALYSIS To date, there are 1,290 active, registered STVRs in La Quinta. This represents 5% of the total 24,857 dwelling units in the City and a 16% increase in registered STVRs from the same time period last year. The number of active STVRs usually increases during March through April and tends to decrease starting in June and through the summer months. However, in 2019, the number of active STVRs has remained at the higher numbers (average 1,297) from June through August. Staff believes that recent improvements to the permitting services and compliance efforts have attributed to higher numbers of active, registered STVRs. Transient occupancy tax (TOT) received for STVRs for FY 18/19 was $3,411,507. Total TOT received for hotels, B&B, resort fees, including STVRs for FY 18/19 was $10,515,423. Since August 2018, the STVR team, comprised of HUB, Code Compliance, Design and Development, and Finance staff, met regularly to discuss improvements and implement enhancements to the STVR program. The following actions were completed over the last year: STUDY SESSION ITEM NO. 1 329 • La Quinta Municipal Code 3.25 was updated to further streamline process and compliance by updating the permit application, adding a requirement to provide property owner’s authorization and 24/7 local contact, clarifying inspection requirements, and increasing citation fines. These improvements have reinforced accountability of STVR homeowners/authorized agents and is helping to mitigate nuisance activities. • Staff conducted seven community outreach meetings to educate the public about the STVR program requirements. • One-on-one meetings with management companies are available to foster good business practices. • City website was updated to allow residents to report zero Transient Occupancy Tax (TOT) and to use fillable forms. This allows residents the convenience of reporting no rental activity for any given month electronically without having to come in to City Hall or send reporting by mail. • A Permit Technician position was added to assist with administering the program, and process permits and annual renewals. • In February 2019, a 24/7 hotline vendor was selected to provide operator answering services, which allows reporting parties to speak with a person who will relay the concern to the local contact for resolution. In the last seven months, the hotline has received over 700 calls and has proven to be an effective tool to track violators in a timely manner. • Just before festival season began, over 22,000 STVR postcards were mailed out to residents with STVR website information and the 24/7 hotline number to call for complaints. • Citation increases have strengthened program compliance. STVR hosts are now more vigilant and responsive. Enforcement of the three strikes (violation) policy, resulting in an immediate suspension, sends a strong message to repeat offenders. A total of 12 suspensions have been issued since the enactment of this policy. This year, Code Compliance opened 324 cases and issued 71 citations totaling $51,800. In comparison, last year, Code Compliance opened 238 cases and issued 41 citations totaling $14,900. • Staff has solicited proposals to secure a compliance vendor to provide online services for permit applications and TOT payments. The evaluation and selection process will incorporate recommendations from this study session and an agreement for these services will be presented to Council for consideration in October. 330 Prepared by: Tommi Sanchez, HUB Manager Approved by: Danny Castro, Design and Development Director 331 332 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: ADOPT RESOLUTION TO APPROVE AND ADOPT THE RELOCATION PLAN PREPARED FOR THE ACQUISITION OF PERMANENT ROADWAY AND PUBLIC UTILITY EASEMENT INTERESTS IN A PORTION OF CERTAIN REAL PROPERTY IDENTIFIED AS ASSESSOR PARCEL NO. 600-030-010, 46400 DUNE PALMS ROAD, LOCATED IN LA QUINTA, RIVERSIDE COUNTY, CALIFORNIA, FOR THE DUNE PALMS ROAD BRIDGE PROJECT (PROJECT NO. 2011-05/111205) RECOMMENDATION Adopt a resolution to approve and adopt the relocation plan prepared for the acquisition of permanent roadway and public utility easement interests in a portion of certain real property identified as Assessor Parcel No. 600-030-010, 46400 Dune Palms Road, located in La Quinta, Riverside County, California, in accordance with the California Relocation Assistance Law and the California Relocation and Real Property Acquisition Guidelines, superseding Resolution No. 2019-033. EXECUTIVE SUMMARY • Council held a public hearing and adopted Resolution No. 2019-033 approving and adopting a Relocation Plan (Plan) for the Dune Palms Road Bridge Project (Project) at the August 6, 2019 meeting. Several days after meeting, Staff received communication from The Desert Sun newspaper that the public hearing notice had not been published within the required timeframe as requested by Staff (Attachment 1). • The City published a public hearing notice with The Desert Sun newspaper on September 6, 2019, that this item will be considered by Council on September 17, 2019. • The City Council previously authorized staff to undertake investigation and planning in connection with the Project. • The Project would entail acquiring private property for road and bridge right-of-way, the relocation or demolition of two mobile homes, and demolition of one single-family dwelling. • A Plan was prepared and concludes that there are sufficient relocation alternatives to accommodate the households potentially displaced by the PUBLIC HEARING ITEM NO. 1 333 Project, and there are sufficient resources and funding to provide the eligible financial assistance and benefits. • The Plan was circulated for the mandated 30-day review period and no comments were received. FISCAL IMPACT The relocation benefit cost is estimated to be $227,000 not including payments related to property acquisition or improvements pertaining to real estate. There are sufficient funds in the Project budget for these costs (401-000-74010, Land Acquisition). BACKGROUND/ANALYSIS On August 6, 2019, Council held a public hearing and adopted Resolution No. 2019-033 approving and adopting the Plan. Several days after the meeting Staff received communication from The Desert Sun newspaper that the public hearing notice did not publish as requested by Staff, 10 days prior to the public hearing. On September 6, 2019, Staff confirmed that a public hearing notice was published in The Desert Sun newspaper stating that Council will hold a public hearing to consider this item on September 17, 2019, as prescribed by the Municipal Code. Staff is bringing this item for Council ratification, following proper and timely publication of the newspaper public hearing notice. Staff has anticipated the need to relocate or demolish two mobile home coaches and demolish one single family dwelling in order to facilitate the Project. A Plan (Exhibit A to the Resolution) was prepared that: 1) surveys and defines the relocation needs of households potentially displaced by the project; 2) identifies the availability of comparable replacement housing; 3) evaluates the impact of potential property acquisition on the relocated households; and 4) develops viable solutions for relocation problems. The Plan was prepared in accordance with the provisions of the California Relocation Assistance Law and other applicable laws and regulations. The Plan concludes there are sufficient physical and financial resources to meet the relocation needs of displaced occupants. All benefits that would be provided to displaced occupants would be in accordance with all applicable relocation laws and regulations. The Design and Development Department has determined the Project has been adequately reviewed under a Mitigated Negative Declaration (MND), EA 2017- 0013, approved on February 14, 2018, in accordance with the California Environmental Quality Act, and under a Categorical Exclusion (CE) approved on January 17, 2018, in accordance with the National Environmental Policy Act, and that no further environmental review is necessary. 334 ALTERNATIVES Council could direct staff to re-examine all or any part of the Plan which would require further investigation and analysis and would delay the project. Prepared by: Julie Mignogna, Management Analyst Approved by: Bryan McKinney, P.E., City Engineer Attachment: 1. Desert Sun correspondence regarding public hearing notice publication 335 336 RESOLUTION NO. 2019 - xxx A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF LA QUINTA, CALIFORNIA, APPROVING AND ADOPTING THE RELOCATION PLAN PREPARED FOR THE ACQUISITION OF PERMANENT ROADWAY AND PUBLIC UTILITY EASEMENT INTERESTS IN A PORTION OF CERTAIN REAL PROPERTY IDENTIFIED AS ASSESSOR PARCEL NO. 600-030-010, 46400 DUNE PALMS ROAD, LOCATED IN LA QUINTA, RIVERSIDE COUNTY, CALIFORNIA, FOR THE DUNE PALMS ROAD BRIDGE PROJECT PROJECT NO. 2011-05 / 111205 ADDRESS: 46400 DUNE PALMS ROAD APN: 600-030-010 WHEREAS, The City of La Quinta (City) proposes to widen the east side of Dune Palms Road to its ultimate General Plan width from Westward Ho Drive / Blackhawk Way to a point approximately 330 feet north of the Coachella Valley Storm Water Channel (CVSC) as part of the Dune Palms Bridge Project (Project); and WHEREAS, Due to the displacement necessary to proceed with the Project, the City is required to prepare a relocation plan which provides demographic and planning information and sets forth the policies and procedures necessary to conform with the California Relocation Assistance Law (California Government Code Section 7260 et seq.), the California Relocation and Real Property Acquisition Guidelines (California Code of Regulations, Title 25 Chapter 6, Section 6000 et seq.- the Guidelines), and the rules, regulations and procedures as adopted by the City; and WHEREAS, The conclusion of the Relocation Plan is that there are sufficient relocation alternatives to accommodate the households potentially displaced by Project and that Project has sufficient resources and funding to provide the eligible financial assistance and benefits to the affected households that are provided for under the applicable laws and regulations; and WHEREAS, The Relocation Plan has been circulated for review by the affected Project occupants for the mandated 30-day period and no comments to the plan have been received; and 337 Resolution No. 2019-XXX Dune Palms Bridge Project Relocation Plan Adopted: September XX, 2019 Page 2 of 3 WHEREAS, The Design and Development Department has determined the Dune Palms Bridge Widening Project has been adequately reviewed under a Mitigated Negative Declaration (MND), EA 2017-0013, approved on February 14, 2018, in accordance with the California Environmental Quality Act, and has been adequately reviewed under a Categorical Exclusion (CE) approved on January 17, 2018, in accordance with the National Environmental Plan Act, and that no further environmental review is necessary. WHEREAS, The City Council held a public hearing on August 6, 2019, and adopted Resolution No. 2019-033 approving and adopting the Relocation Plan. However, several days after the August 6, 2019 meeting, the City received communication from The Desert Sun newspaper stating that it failed to publish the public hearing notice as requested by the City for the August 6, 2019 meeting. WHEREAS, The City published a public hearing notice with The Desert Sun newspaper on September 6, 2019, that this item will be considered by the City Council on September 17, 2019, as prescribed by the Municipal Code. WHEREAS, The City Council held a duly noticed public hearing on September 17, 2019, to ratify Council’s approval and adoption of the Relocation Plan, and supersede Resolution No. 2019-033, following a proper and timely newspaper publication of the public hearing notice for this item. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of La Quinta, California, as follows: SECTION 1. Resolution No. 2019-033 adopted on August 6, 2019, is hereby superseded. SECTION 2. That the above recitals are true and correct and incorporated herein. SECTION 3. That the City Council of the City of La Quinta does hereby adopt the relocation plan, attached hereto as “Exhibit A” and incorporated by this reference, prepared for the acquisition of a portion of certain real property identified as Assessor Parcel No. 600-030-010, located in La Quinta, Riverside County, California, for the Dune Palms Road Widening Project. 338 Resolution No. 2019-XXX Dune Palms Bridge Project Relocation Plan Adopted: September XX, 2019 Page 3 of 3 PASSED, APPROVED, and ADOPTED at a regular meeting of the La Quinta City Council held on this ___ day of September, 2019 by the following vote: AYES: NOES: ABSENT: ABSTAIN: _____________________________ LINDA EVANS, Mayor City of La Quinta, California ATTEST: __________________________ MONIKA RADEVA, City Clerk City of La Quinta, California (CITY SEAL) APPROVED AS TO FORM: ___________________________ WILLIAM H. IHRKE, City Attorney City of La Quinta, California 339 340 Dune Palms Road Low Water Crossing Bridge Project FINAL RELOCATION PLAN Prepared for: CITY OF LA QUINTA 78-495 Calle Tampico La Quinta, CA 92253 (760) 777-7000 By: Overland, Pacific & Cutler, LLC 2280 MARKET STREET, SUITE 200 RIVERSIDE, CA 92501 (951) 683-2353 JULY 19, 2019 RESOLUTION NO. 2019-XXX EXHIBIT A ADOPTED: SEPTEMBER XX, 2019 341 DOCSOC/1496121v4/022621-0154 TABLE OF CONTENTS INTRODUCTION ........................................................................................................................................... 1 I. PROJECT SITE LOCATION AND DESCRIPTION ..................................................................................... 2 A. REGIONAL LOCATION ............................................................................................................... 2 B. PROJECT SITE LOCATION AND DESCRIPTION .................................................................. 2 C. GENERAL DEMOGRAPHIC AND HOUSING CHARACTERISTICS .................................. 4 II. ASSESSMENT OF RELOCATION NEEDS ................................................................................................. 5 A. SURVEY METHODOLOGY ........................................................................................................ 5 B. FIELD SURVEY DATA ................................................................................................................ 5 1. Housing Mix ...................................................................................................................... 6 2. Project Area Rents .............................................................................................................. 6 3. Occupancy Overcrownding .............................................................................................. 7 4. Replacement Housing Needs .............................................................................................. 7 5. Income ................................................................................................................................ 7 6. Ethnicity/Language ............................................................................................................. 7 7. Senior/Handicapped Households ........................................................................................ 8 8. Preferred Relocation Areas ................................................................................................. 8 III. RELOCATION RESOURCES ....................................................................................................................... 7 A. METHODOLOGY .......................................................................................................................... 7 B. COMPARABLE REPLACEMENT HOUSING AVAILABILITY ............................................ 8 1. Residential Rental Housing .............................................................................................. 8 2. Mobile Home for Sale Housing .......................................................................................... 8 3. Pad Rent .............................................................................................................................. 8 4. Summary ............................................................................................................................ 9 C. RELATED ISSUES ........................................................................................................................ 9 1. Concurrent Residential Displacement .............................................................................. 9 2. Temporary Housing ........................................................................................................ 10 IV. THE RELOCATION PROGRAM ................................................................................................................ 11 A. ADVISORY ASSISTANCE ......................................................................................................... 10 B. RELOCATION BENEFITS ......................................................................................................... 13 1. Residential Moving Expense Payments ......................................................................... 13 a. Actual Cost (Professional Move) ............................................................................... 13 b. Fixed Payment (based on Room Count Schedule) ................................................... 13 2. Rental Assistance to Tenants Who Choose to Rent ...................................................... 14 3. Downpayment Assistance to Tenants Who Choose to Purchase ................................. 15 4. Relocation Benefits – Offsite Owners of Rental Income Property .............................. 16 C. GENERAL INFORMATION REGARDING THE PAYMENT OF RELOCATION BENEFITS ..................................................................................................................................... 16 D. LAST RESORT HOUSING ......................................................................................................... 17 E. IMMIGRATION STATUS ........................................................................................................... 17 F. RELOCATION TAX CONSEQUENCES .................................................................................. 17 V. ADMINISTRATIVE PROVISIONS ............................................................................................................ 18 A. NOTICES ....................................................................................................................................... 18 B. PRIVACY OF RECORDS ........................................................................................................... 19 C. GRIEVANCE PROCEDURES .................................................................................................... 19 D. EVICTION POLICY ..................................................................................................................... 19 E. CITIZEN PARTICIPATION ........................................................................................................ 20 F. PROJECTED DATE OF DISPLACEMENT .............................................................................. 21 G. ESTIMATED RELOCATION COSTS ....................................................................................... 21 342 DOCSOC/1496121v4/022621-0154 LIST OF TABLES TABLE 1: 2010 Census Population – City & Impacted Tract 5 TABLE 2: 2010 Census Housing units – City & Impacted Tract 5 TABLE 3: Availability and Cost of Replacement Rental Housing 9 TABLE 4: Schedule of Fixed Moving Payments 14 TABLE 5: Computation of Rental Assistance Payments 15 LIST OF EXHIBITS EXHIBIT A: Residential Interview Form EXHIBIT B: HUD Income Levels – Riverside County EXHIBIT C: Residential Informational Statement- Mobile Homes (Federal) EXHIBIT D: Residential Informational Statement- Families and Individuals (Federal) EXHIBIT E: Non-Residential Informational Statement for Business (Federal) EXHIBIT F: Mobile Homes for Sale EXHIBIT G: Single Family Residential Rentals EXHIBIT H: Public Comments and Responses 343 1 INTRODUCTION The City proposes to construct an all-weather crossing and remove the existing low-water crossing of Dune Palms Road at the Coachella Valley Storm Water Channel (CVSWC) in the City of La Quinta, in Riverside County. The crossing will consist of 480 feet long and 86 feet wide four-span bridge. The bridge typical section consists of six-foot sidewalk on both sides of the bridge, two (2) eight-foot outside shoulders also serving as bike/golf cart lanes, a 10-foot raised median, two (2) eleven-foot travel lanes, and two (2) twelve-foot travel lanes. Other project features include reconstruction of the north and south bridge approaches to accommodate the raised profile of the roadway to meet the bridge elevation, installation of concrete slope protection at the northwest and southeast corners of the bridge, relocation of overhead electrical distribution lines, and relocation of sewer lines at the northern bridge abutment. This improvement will connect with the widening of Dune Palms Road to include widening of the east side of Dune Palms Road to its ultimate General Plan width from Westward Ho Drive/Blackhawk way to a point approximately 330 feet north of Coachella Valley Storm Water Channel. La Quinta High School is adjacent to the westerly project limits and vacant land, a church and a mobile home park is adjacent to the easterly project limits. Significant impacts are anticipated to the Dune Palms Mobile Estates mobile home park, including the demolition / removal of 2 mobile home units, and a single-family residential unit. Permanent relocation of the current Project occupants identified on this plan and personal property is anticipated. The City was successful in obtaining federal Highway Bridge Program (HBP) funding for 88.53 percent of the design, right- of-way acquisition, and construction costs for the new Dune Palms Road Bridge. Due to the displacement proposed by the Project, the City has prepared a relocation plan which provides demographic and planning information and sets forth the policies and procedures necessary to conform with the requirements of the Federal Uniform Relocation and Real Property Acquisition Policies Act of 1970, as amended (URA), Title 25, California Code of Regulations Chapter 6, Article 1, Section 6000 et seq (Guidelines). This Plan was written by Overland, Pacific & Cutler, LLC. (OPC), a professional consulting firm specializing in public acquisition and relocation projects. The Plan is organized in five sections: 1. Project location and description (SECTION I); 2. Assessment of the relocation needs of persons subject to displacement (SECTION II); 344 2 3. Assessment of available replacement housing units within the La Quinta and surrounding communities (SECTION III); 4. Description of the City’s relocation program (SECTION IV); 5. Description of the City’s administrative provisions (SECTION V). I. PROJECT SITE LOCATION AND DESCRIPTION A. REGIONAL PROJECT LOCATION The Project site is generally located in the City, within the County of Riverside. The Project site is easily accessible from Highway 111 and Interstate 10. Surrounding communities include, Bermuda Dunes, Indio, Coachella, Palm Desert, Rancho Mirage, and Indian Wells. (See Figure 1: Regional Project Location) Figure 1: Regional Project Location B. PROJECT SITE LOCATION AND DESCRIPTION The specific portion of the Project site addressed in this Plan is in the northerly central area of the City and is generally bounded by the Coachella Valley Storm Water Channel to the south, 345 3 Westward Ho Drive / Blackhawk Way to the north, La Quinta High School to the west, and mobile homes / church / vacant lands to the east. (See Figure 2: Project Site Location) Figure 2: Project Site Location –46400 Dune Palms Road 346 4 C. GENERAL DEMOGRAPHIC AND HOUSING CHARACTERISTICS According to the July 1, 281 (V2018) U.S. Census, the population data of the City is 41,535, and the population of the impacted Census Tract 452.15 is 8,515 (see Table 1 on the following page). Corresponding Census data concerning the housing mix is shown on the following page in Table 2. TABLE 1: 2010 Census Population – City Population Tract 452.15 % City % Total Population 8,515 100.0% 37,467 100.0% White 6,735 79.1%/ 29,489 82.1% Black or African American 137 1.6% 713 1.9% American Indian or Alaska Native 49 0.6% 220 0.6% Asian 489 5.7% 1,176 3.1% Native Hawaiian or Other Pacific Islander 10 0.1% 41 0.1% Some Other Race 770 9.0% 4,595 12.3% Two or More Races 325 3.8% 1,223 3.3% Hispanic or Latino (of Any Race) 2,340 27.5% 11,339 30.3% Source: U.S. Census Bureau, QT-PL. Race, Hispanic or Latino, and Age: 2010 TABLE 2: 2010 Census Housing Units – City Type Block 1001 Tract 874.04 % City % Total Units 2,953 100.0% 14,820 100.0% Owner-Occupied 2,302 78.0% 11,152 75.2% Renter-Occupied 651 22.0% 3,668 24.8% Vacant Housing Units 559 100.0% 8,669 100.0% Available for Sale Only (of Total Vacant Units) 76 13.6% 783 9.0% Available for Rent – Full Time Occupancy (of Total Vacant Units) 47 8.4% 736 8.5% Sold or Rented – Not Occupied 14 2.5% 141 1.6% Otherwise Not Available (e.g. seasonal, recreational, migratory, occasional use) 379 67.8% 6,449 74.4% Other Vacant 43 7.7% 560 6.5% Source: U.S. Census Bureau, QT-H1. General Housing Characteristics: 2010 347 5 II. ASSESSMENT OF RELOCATION NEEDS A. SURVEY METHODOLOGY To obtain information necessary for the preparation of this Plan, personal interviews with the households that may be displaced were conducted by OPC staff in November 2018. The interviewers were successful in obtaining survey responses from all project households in the Project. Inquiries made of the residential occupants concerned household size and composition, income, monthly rent and estimated utility costs, length of occupancy, ethnicity, home language, physical disabilities, legal presence status, relocation needs, and replacement housing preferences. A sample of the residential interview form used in the interview process is presented as Exhibit “A” of this report. B. FIELD SURVEY DATA There are three residential households, which will be permanently relocated for the Project as presently planned. At the time of the interviews, the households consisted of six adults and four children (10 years or younger) for a total of 10 individuals to be displaced. There is 1 known non- occupant owner of investment property that will potentially be affected as a result of the proposed Project’s acquisitions. This owner leases their space within the proposed Project boundaries to residents occupying the area. To the extent that off-site owner’s activity may be is considered a business, it may be eligible to receive assistance and benefits for expenses actually incurred in reestablishing the business at a replacement property site, in the amount not to exceed $25,000. These and other benefits are outlined in Section IV. 1. Housing Mix The proposed Project area includes single-family residence and two mobile home units. The mobile home units are owner-occupied and lease the pad space . The single-family residence is a three -bedroom home that is occupied by the park manager. The mobile home units consist of a two-bedroom mobile home, and three-bedroom mobile home with a room conversion that is being used as a fourth sleeping area. See Table 3 below. Table 3: Current Project Area Housing # of Bedrooms Two Three Four # of Units- Mobile Home Owners/ Space Tenants 1 1 - # of Single-Family-Tenants 1 - 348 6 2. Project Area Rents Of the three tenant households, we received monthly rent data for 2 of the households. Table 4 below shows monthly rents by bedroom size among the mobile home tenant households. Table 4: Proposed Project Area Tenant Rents (2 respondents) Two Bedroom Three Bedroom Four Bedroom Mobile Home $560 $560 - Single-Family Residence Unknown - 3. Occupancy /Overcrowding The City has adopted and would adhere to its local housing occupancy standards to make sure housing is of the appropriate size in relocating the affected occupants. Based on this criterion and available household data, one of the residential mobile home units is currently overcrowded. City has made the policy determination to use non-federal funds to pay relocation benefits to those tenants not legally present in the United States but otherwise eligible for assistance. Therefore, based on the occupancy standard stated above, the comparable replacement units required for the displaced households are 2 three-bedroom mobile home units and one three-bedroom single-family residence. 4. Replacement Housing Needs Comparable replacement housing needs, as expressed in this plan, are defined by the total number of required comparable replacement units and distribution of those units by bedroom size. The projected number of required units by bedroom size is calculated by comparing survey data for household size with the City’s replacement housing occupancy standards. These standards, generally, allow for up to three persons in a one-bedroom unit, five persons in a two-bedroom unit, seven persons in a three-bedroom unit and nine or more persons in a four-bedroom unit. See Table 5 below. In addition, replacement housing needs must also be based on the legally present members of the household. Table 5: Proposed Project’s Replacement Housing Needs # of Bedrooms Two Three Four # of Units- Mobile Home Owners/ Space Tenants 0 2 0 # of Single-Family-Tenants 0 1 0 349 7 5. Income Income information was provided by the mobile home households during the Plan interview. According to income standards for the County of Riverside (Exhibit B) adjusted for family size as published by the United States Department of Housing and Urban Development (HUD), one household qualifies as Very Low Income (earning 31% - 50% AMI), and one household qualifies as Moderate Income (51% - 80% AMI). Table 6: Income Levels of Residential Households Interviewed Extremely Low Very Low Low Median Moderate 1 1 1 6. Ethnicity/Language Both households reported Hispanic as their ethnicity and Spanish as their preferred language. 7. Senior/Handicapped Households One household reported a senior spouse (62 years or older). No households reported having a member with a disability. Required accommodations at a replacement dwelling are not anticipated on this project based on those households surveyed. 8. Preferred Relocation Areas All three households expressed a preference to remain in the City community in order to maintain current access to employment, and schools. One household would like to purchase a mobile home at Las Palmas de La Quinta located on the East side of Jefferson Street which divides the City with the neighboring City of Indio in order to maintain the proximity to the current school enrollment and family. III. RELOCATION RESOURCES B. METHODOLOGY No eligible person shall be required to move from their dwelling unless comparable replacement dwellings are available to such persons. The purpose of this section is to identify if sufficient comparable replacement housing resources exist for all potential residential displaces. The City is committed to making every effort to satisfactorily relocate all displaced occupants. For residential housing, a resource survey was conducted to identify available rental units within the proposed Project area. The following sources were utilized: -- Calls to Local Mobile Home Parks for Advertised and Posted MH Sales 350 8 ---Calls to Local Mobile Home Parks for Mobile Home Space Rentals ---Contacts with Mobile Home Parke Owners and real estate/property management companies serving the community -- Internet sources of rental opportunities (Zillow, Realtor.com) B. COMPARABLE REPLACEMENT HOUSING AVAILABILITY 1. Residential Rental Housing There are adequate numbers of replacement single family housing units to accommodate the tenant household residing in the single-family home at this project. The number of units found, by bedroom size, are presented alongside the number of units needed (shown in parentheses) of those interviewed to meet re-housing obligations in the tables below. TABLE 7: Availability and Cost of Replacement Single Family Rental Bedroom Size Two Three Four # Found (# Needed) N/A 25 (1) N/A Rent Range - $1,600-$2,800 - Median Rent - $ 2,300.00 - The rental amounts are naturally subject to change according to the market rates prevailing at the time of any displacement. 2. Mobile Homes for Sale Housing The resource survey identified seven (7) two-bedroom mobile homes, ranging in price from $10,000 to 60,000 with a median price of $ 39,000.00. Fourteen (14) three-bedroom mobile homes were also identified, ranging in price from $45,000 to $109,000 with a median price of $64,750.00. Four bedrooms were not required for to accommodate the current households to be potentially displaced. TABLE 8: Availability and Cost of Replacement Mobile Homes for Sales Bedroom Size Two Three Four # Found (# Needed) 7 (0) 14 (2) N/A Rent Range N/A N/A N/A Median Rent N/A N/A N/A 3. Pad Rent While surveying for mobile homes for sale, pad rents were considered where available. The resource survey monthly pad rental rates range from $560 to $950 with a median price of $700.00. 351 9 4. Summary Considering the above described availability of temporary and replacement housing resources gathered over an eight-week period, it appears that there are more than adequate replacement resources for the residential occupants. But, while adequate replacement resources exist, based on survey results of rental opportunities and the tenants’ current rents, some of the tenant occupants will likely have an increase in monthly rent. Possible increases, if any, will be met through the City’s obligation under applicable Relocation Laws, including Last Resort Housing (LHR) requirements. (See Section IV). The City will work with displacees to provide funds necessary to meet replacement housing obligations due to an increase in monthly rents of these available units or an increase of pad rents for owner-occupants. Individual preferences will be accounted for once the process has begun and a relocation consultant has had the opportunity to speak personally with each resident. It is anticipated that the relocation activities will not necessitate any special housing considerations, other than potential Last Resort Housing obligations, for the Project to meet the comparable replacement housing requirement. Therefore, with possible benefit payments exceeding statutory amounts through LRH obligations, the relocation activities are not anticipated to create any special housing considerations. With LRH benefit payments, the Project will meet comparable replacement dwelling requirements. C. RELATED ISSUES 1. Concurrent Residential Displacement The City’s Dune Palms Road Widening, and La Quinta Village Complete Road Diet Project are current public projects, but do not cause significant competing residential displacements. The Dune Palms Road Widening Project is currently underway in the City which will insignificantly compete with this Project since most of the relocations have already secured replacement housing resources needed to complete that project. No residential displacees will be required to move without both adequate notice and access to available, affordable, decent, safe and sanitary housing. 352 10 2. Temporary Housing and Assistance The Proposed Project is not anticipated to cause any temporary displacement. IV. THE RELOCATION PROGRAM The City’s Relocation Program for displacements is designed to minimize hardship, be responsive to unique Project circumstances, emphasize maintaining personal contact with all affected individuals, consistently apply all regulatory criteria to formulate eligibility and benefit determinations and conform to all applicable requirements. The relocation program to be implemented by the City will conform with the standards and provisions of all applicable Relocation Laws. The City has retained OPC, a multi-lingual consulting firm, to administer the Relocation Program. OPC has worked on more than 5,000 public acquisition and relocation projects over the past 38 years. Experienced City staff will monitor the performance of OPC and be responsible to approve or disapprove OPC recommendations concerning eligibility and benefit determinations and interpretations of City’s policies. A. ADVISORY ASSISTANCE Every reasonable effort will be made to ensure that the relocation of displacees occurs with a minimum of delay and hardship. The following specific services will be provided: 1. Each household affected by the Project will be personally interviewed to gather information appropriate to the determination of needs and preferences regarding replacement of existing accommodations; 2. A printed Informational Brochure (see Exhibit “C”) will be provided in English or the displacees’ language, should that be subsequently deemed necessary, for all displaced households. To the non-occupant owner leasing to others an Informational Brochures will be provided also (see Exhibit “D”). Signed acknowledgments will be obtained to verify receipt of this material; 3. Prior to issuance of a notice-to-vacate, residential displacees will be provided, if available, at least three, and preferably more, referrals to comparable replacement dwellings, pursuant to Section 24.403 of 49CFR. In no event shall an eligible residential displacee be required to move until comparable housing has been made available. Resource surveys and referrals will be undertaken and updated on a continuous basis over the duration of the Project. 353 11 Generally, a comparable replacement dwelling must satisfy the following criteria: a) The unit is decent, safe and sanitary - electrical, plumbing and heating systems in good repair - no major, observable hazards or defects. The unit is comparable to the acquired dwelling with respect to number of rooms, habitable living space and type and quality of construction, but not lesser in rooms or living space as necessary to accommodate the displaced person; b) The unit is located in an area not subjected to unreasonable adverse environmental conditions from either natural, or man-made sources, and not generally less desirable with respect to public utilities, transportation, public and commercial facilities, including schools and municipal services and reasonably accessible to the displaced person’s place of employment; c) The unit is available both on the private market and to all persons regardless of race, color, sex, marital status, religion, or national origin; d) The monthly rental rate is within the financial means of the displaced residential tenant; 4. Transportation will be provided, if necessary, for any displaced resident to inspect replacement sites within the local area. Specific assistance will be offered, as appropriate, to help tenants find housing near friends, relatives, medical facilities and services, and convenient transportation; 5. Assistance will be offered to all displacees in connection with arrangements for the purchase of real property, the completion of applications for replacement housing and the filing of claim forms to request relocation benefits; 6. Special assistance in the form of referrals to governmental and nongovernmental social service agencies will be made, if needed. Agencies to which referrals may be made include, but are not necessarily limited to the following: a) Federal Social Security Administration b) The Housing Agency of the County of Riverside To follow through on the advisory assistance component of the permanent relocation program and assure that the City meets its obligations under the Relocation Laws, OPC staff will perform the following functions: 354 12 1. Distribute appropriate written information concerning the City’s relocation program; 2. Inform the eligible households of the nature of, and procedures for, obtaining available Relocation Benefits; 3. Determine the needs of each displacee eligible for assistance (including through personal interviews with the persons to be displaced); 4. Provide the eligible displacees with at least three referrals to comparable replacement housing within a reasonable time prior to displacement. Generally, a comparable replacement dwelling must satisfy the following criteria: (a) The unit is decent, safe and sanitary - electrical, plumbing and heating systems are in good repair - no major, observable hazards or defects. The unit is adequate in size and is comparable to the acquired dwelling with respect to number of rooms, habitable living space and type and quality of construction, but not lesser in rooms or living space as necessary to accommodate the displaced person. The unit is functionally equivalent, including principle features. (b) The unit is located in an area not subjected to unreasonable adverse environmental conditions from either natural, or man-made sources, and not generally less desirable with respect to public utilities, transportation, public and commercial facilities, including schools and municipal services and reasonably accessible to the displaced person’s place of employment. (c) The unit is available both on the private market and to all persons regardless of race, color, sex, marital status, religion or, national origin. (d) The monthly rental rate is within the financial means of the displaced residential tenant. 5. Maintain an updated database of available housing resources, and distribute referral information to displacees for the duration of the Project; 6. Provide transportation to the residential displacees, if necessary, to inspect replacement sites within the local area; 7. Inspect replacement housing to assure it meets decent, safe and sanitary standards as described in the URA and per local ordinance; 8. Supply information concerning federal and state programs and other governmental programs providing assistance to displaced persons; 9. Assist eligible occupants in the preparation and submission of relocation assistance claims; 10. Provide additional reasonable services necessary to successfully relocate occupants; 355 13 11. Make benefit determinations and payments in accordance with applicable law and the City’s adopted relocation guidelines; 12. Assure that no occupant is required to move without a minimum of 90 days written notice to vacate; 13. Inform all persons subject to displacement of the City’s policies with regard to eviction and property management; 14. Establish and maintain a formal grievance procedure for use by displaced persons seeking administrative review of the City’s decisions with respect to relocation assistance; and 15. Provide assistance that does not result in different or separate treatment based on or due to an individual’s sex, marital status, race, color, religion, ancestry, national origin, physical handicap, sexual orientation, and domestic partnership status. B. RELOCATION BENEFITS Specific eligibility requirements and benefit plans will be detailed on an individual basis with the household to be permanently displaced. In the course of personal interviews and follow-up visits, the household to be displaced will be counseled as to available options, maximum assistance amounts, and the consequences of any choice with respect to financial assistance. Relocation benefits will be provided in accordance with the provisions of all applicable Relocation Laws, and City rules, regulations and procedures pertaining thereto. Benefits will be paid to eligible displaced persons upon submission of required claim forms and documentation in accordance with the City’s normal administrative procedures. The City will process advance payment requests to mitigate hardships for tenants who do not have access to sufficient funds to pay move-in costs such as first month’s rent and/or security deposits. Approved requests will be processed expeditiously to help avoid the loss of desirable, appropriate replacement housing. 1. Residential Moving Expense Payments All residential occupants to be permanently relocated will be eligible to receive a payment for moving expenses. Moving expense payments will be made based upon the actual cost of a professional move or a fixed payment based on a room -count schedule. a. Actual Cost (Professional Move) Displacees may elect to have a licensed professional mover perform the move. The actual cost of the moving services, based on at least two acceptable bids, will be compensated by the City in the form of a direct payment to the moving company upon presentation of an invoice. Transportation costs are limited to a distance of 50 miles in either case. In addition 356 14 to the actual move, costs associated with utility reconnections (i.e., gas, water, electricity, telephone, and cable, if any), are eligible for reimbursement. b. Fixed Payment (based on Room Count Schedule) An occupant may elect to receive a fixed payment for moving expenses which is based on the number of rooms occupied in the displacement dwelling. In this case, the person to be relocated takes full responsibility for the move. The fixed payment includes all utility connections as described in Paragraph B.1.a., above. The current schedule for fixed moving payments is set forth in Table 4 following: TABLE 4: Schedule of Fixed Moving Payments Unfurnished Dwelling Room count 1 2 3 4 5 6 7 8 Each additional Amount $725 $930 $1,165 $1,375 $1,665 $1,925 $2,215 $2,505 $265 Furnished Dwelling Room count 1 each additional Amount $475 $90 Source: Federal Highway Administration (effective July 24, 2015) 2. Rental Assistance to Tenants Who Choose to Rent To be eligible to receive rental assistance benefits, a displaced tenant household must rent or purchase and occupy decent, safe, and sanitary comparable replacement dwelling within one year from the date they move from the displacement dwelling. Based upon the available data regarding Project displacees, the displaced households may qualify for, and may be eligible to apply for, relocation benefits under URA and/or State provisions. Except in the case of Last Resort Housing situations, the potential payment to the household will be payable over a 42-month period and limited to a maximum of $7,200 as stated under URA guidelines. The relocation program is explained in detail in the informational brochure to be provided to each permanently displaced household (Exhibit C). Rental Assistance payment amounts are equal to 42 times the difference between the base monthly rent and the lesser of: (i) The monthly rent and estimated average monthly cost of utilities for a comparable replacement dwelling; or (ii) The monthly rent and estimated average monthly cost of utilities for the decent, safe, and sanitary replacement dwelling actually occupied by the displaced person. The base monthly rent for the displacement dwelling is the lesser of: 357 15 (i) The average monthly cost for rent and utilities at the displacement dwelling for a reasonable period prior to displacement, as determined by the City. For owner-occupants or households, which paid little or no rent, fair market rent will be used as a substitute for actual rent; or (ii) Thirty percent (30%) of the displaced person’s average, monthly gross household income, if the amount is classified as “low income” by the U. S. Department of Housing and Urban Development’s (HUD) Annual Survey of Income Limits for the Public Housing and Section 8 Programs. (HUD’s Survey is shown as Exhibit B.) If a displaced household earns more than the amount that would qualify them as a “low income” household, refuses to provide appropriate evidence of income, or is a dependent, the base monthly rent shall be determined to be the average monthly cost for rent and utilities at the displacement dwelling; or (iii) The total of the amount designated for shelter and utilities if receiving a welfare assistance payment from a program that designates the amounts for shelter and utilities. Table 5 portrays the benefits determination under the URA: TABLE 5: Example Computation of URA Rental Assistance Payments 1. Old Rent $650 Old Rent and Utilities or 2. Ability to Pay $700 30% of the Gross Household Income (if Low Income) 3. Lesser of lines 1 or 2 $650 Base Monthly Rental Subtracted From: 4. Actual New Rent $750 Actual New Rent and Estimated Utilities or 5. Comparable Rent $775 Determined by City (includes estimated utilities) 6. Lesser of lines 4 or 5 $750 7. Yields Monthly Need: $100 Subtract line 3 from line 6 8. Rental Assistance $4,200 Multiply line 7 by 42 months 3. Down payment Assistance to Tenants Who Choose to Purchase A displaced household may opt to apply the entire benefit amount for which they are eligible toward the purchase of a replacement unit (URA, at 49 CFR 24.402(b). If a displaced household chooses to utilize up to the full amount of rental assistance eligibility (including any Last Resort benefits) to purchase a home, it may have the funds deposited in an open escrow account, provided that the entire amount is used for the down payment and eligible, 358 16 incidental costs associated with the purchase of a decent, safe, and sanitary replacement home. A provision shall be made in the escrow arrangements for the prompt return of the City funds, in the event escrow should fail to close within a reasonable period of time. Final determination about the type of relocation benefits and assistance for which the households are eligible will be determined upon verification of the households’ occupants and incomes. 4. Relocation Benefits – Offsite Owners of Rental Income Property Potential eligible offsite owners of property who lease space or a site to others, may be eligible for certain benefits in accordance with the Uniform Relocation Assistance and Real Property Acquisition Policies Act (URA) and the City’s Relocation Assistance Program, if the City determines that certain criteria is met see Exhibit D: C. GENERAL INFORMATION REGARDING THE PAYMENT OF RELOCATION BENEFITS Claims and supporting documentation for relocation benefits must be filed with the City no later than 18 months after the date of displacement. The procedure for the preparation and filing of claims and the processing and delivery of payments will be as follows: • Claimant(s) will provide all necessary documentation to substantiate eligibility for assistance; • City staff will review all necessary documentation including, but not limited to, rental agreements or lease documents, moving bids, invoices and escrow material before reaching a determination as to which expenses are eligible for compensation; • Required claim forms will be prepared by OPC staff and presented to the claimants for review. Signed claims and supporting documentation will be returned to relocation staff and submitted to the City; • The City will review and approve claims for payment, or request additional information; • The City will issue benefit checks to claimants in the most secure, expeditious manner possible; • Final payments to residential displacees will be issued after confirmation that the Project premises have been completely vacated, and actual residency at the replacement unit is verified; 359 17 • Receipts of payment and all claim material will be maintained in the relocation case file. D. LAST RESORT HOUSING Based on data derived from the surveys and analyses of the occupants in the Project area and costs of replacement housing resources, it is anticipated that “comparable replacement housing” may not be available, because the computed replacement housing assistance eligibility exceeds $7,200 and the estimated replacement dwelling monthly rental costs (including utilities) exceed 30% of the households’ average gross monthly income. Therefore, if the Project proceeds, the City will authorize sufficient funds to provide housing of last resort to eligible displaced households. Due to the demonstrated number of available replacement housing resources for the displaced households, as shown above in Section III, B - 1, the need to develop a replacement housing plan to produce sufficient number of comparable replacement dwellings will not be necessary. Rather, funds will be used to make payments in excess of the monetary limits specified in the statute ($7,200); hence, satisfying the requirement that “comparable replacement housing” is available. The City, at its discretion, may opt to pay Last Resort Housing payments in installments or in a lump sum. Recipients of Last Resort rental assistance, who intend to purchase rather than rent replacement housing, will have the right to request a lump sum payment of all benefits in the form of down payment assistance, as described above, to assist with the purchase of a decent, safe and sanitary dwelling. E. IMMIGRATION STATUS Federal legislation (PL105-117) prohibits the payment of relocation assistance benefits under the Uniform Act to any alien not lawfully present in the United States unless such ineligibility would result in an exceptional and extremely unusual hardship to the alien’s spouse, parent, or child any of whom is a citizen or an alien admitted for permanent residence. Exceptional and extremely unusual hardship is defined as significant and demonstrable adverse impact on the health or safety, continued existence of the family unit, and any other impact determined by the City to negatively affect the alien’s spouse, parent or child. However, the City will authorize the payment of relocation assistance benefits to any otherwise eligible residential displacees from non-federally authorized reimbursable funds. In order to track and account for relocation assistance and benefit payments, City staff will be required to seek immigration status information from each displacee aged 18 years or older by having them certify as to their legal status. F. RELOCATION TAX CONSEQUENCES In general, relocation payments are not considered income for the purpose of Division 2 of the Internal Revenue Code of 1954, which has been re-designated as the Internal Revenue Code of 1986 (Title 26, U. S. Code), or for the purpose of determining the eligibility or the extent of eligibility of any person for assistance under the Social Security Act (42 U. S. Code 301 et seq.) or the Personal Income Tax Law, Part 10 (commencing with Section 17001) of the Revenue and 360 18 Taxation Code, or the Bank and Corporation Tax Law, Part II (commencing with Section 23001) of Division 2 of the Revenue and Taxation Code. The above statement on tax consequences is not intended as tax advice by the City. Displacees are responsible for consulting with their own tax advisors and/or making their own determinations of tax consequences concerning relocation payments. V. ADMINISTRATIVE PROVISIONS A. NOTICES Each notice, which the City is required to provide to a property owner or occupant, shall be personally delivered or sent by certified or registered first-class mail, return receipt requested and documented in the case file. Each notice will be written in plain, understandable language. Persons who are unable to read and understand any notice will be provided with appropriate translation and counseling. Each notice will indicate the name and telephone number of a person who may be contacted for answers to questions or other needed help. There are three principal notices: 1) General Information Notice, 2) Notice of Relocation Eligibility, and 3) Ninety-Day Notice to Vacate The General Information Notice (GIN) is intended to provide potential relocatees with a general written description of the City’s relocation program and basic information concerning benefits, conditions of eligibility, noticing requirements and appeal rights. The GIN is issued as early as is feasible in the initial stages of a Project, preferably, the planning stage. This notice was issued at the time the properties were being appraised via Certified Mail and hand delivered to those interviewed for this Plan. A Notice of Relocation Eligibility (NOE) will be distributed to each eligible displacee. The NOE to the residential relocatee contains a determination of eligibility for relocation assistance and a computation of a maximum entitlement based on information provided by the affected household and the analysis of comparable replacement properties undertaken by OPC staff. No lawful occupant will be required to permanently move without having received at least 90 days advance written notice of the earliest date by which the move will be necessary. The 90-day notice will either state a specific date as the earliest date by which the occupant may be required to move or state that the occupant will receive a further notice indicating, at least 60 days in advance, the specific date of the required move. The 90-day notice will not be issued to any residential displacee before a comparable replacement dwelling has been made available. Tenants to be temporarily displaced will be provided with a 30-day notice to vacate and the offer of comparable temporary housing. 361 19 In addition to the three principal notices, OPC staff will issue a timely written notification in the form of a Reminder Notice, which discusses the possible loss of rights and sets the expiration date for the loss of benefits to those persons who: 1) are eligible for monetary benefits, 2) have moved from the acquired property, and 3) have not filed a claim for benefits. Reminder Notices will be issued periodically throughout the qualification period, as appropriate. An attempt shall be made to make written contact with all non-responsive relocatees no later than within the last six months prior to the filing expiration date. B. PRIVACY OF RECORDS All information obtained from displacees is considered confidential and will not be shared without the consent of the displacee or the City, except as may otherwise be required by law. City staff will comply with federal regulations concerning the safeguarding of relocation files and their contents. C. GRIEVANCE PROCEDURES A person who is dissatisfied with a determination as to eligibility for benefits, a payment amount, the failure to provide comparable housing, or the City’s property management practices may file a Relocation Assistance Appeal Form or any other written form of appeal with the City and have the right of administrative review. The City’s appeal policies will follow the standards described in Article 5, Section 6150 et seq., Title 25, Chapter 6, State of California, Department of Housing and Community Development Program guidelines and the City’s Relocation Policy and Procedures Plan. Requests for administrative review and informal hearings will be directed to the City Project Manager, and further review will be by the Community Development Director or Designee. All requests for review will receive written responses from the City within three weeks of their receipt. If an informal appeal is denied, appellants will be entitled to file a written request for a formal hearing before an impartial and independent hearing officer. The appellant does not have to exhaust administrative remedies first; the appeal/grievance can either go directly to the city, directly to HCD or directly to the Court. Any person and/or organization directly affected by the relocation plan may petition the Department of Housing and Community Development (HCD), located at 2020 West El Camino Ave., Sacramento, CA 95833 to review the relocation plan. More detail concerning the appeals process will be provided upon request. Appellants will retain their appeal rights for up to 18 months following the date of displacement from the Project premises or receipt of final payment for relocation benefits, whichever is later. 362 20 D. EVICTION POLICY 1. Eviction may cause the forfeiture of a displacee’s right to relocation assistance or benefits. Relocation records will be documented to reflect the specific circumstances surrounding any eviction action. 2. Eviction may be undertaken for one or more of the following reasons: (a) Failure to pay rent, except in those cases where the failure to pay is due to the owner’s failure to keep the premises in habitable condition, is the result of harassment or retaliatory action, or is the result of discontinuation or a substantial interruption of services; (b) Performance of a dangerous and/or illegal act in the unit; (c) A material breach of the rental agreement and failure upon notification to correct said breach within 30 days of Notice; (d) Maintenance of a nuisance and failure to abate such nuisance upon notification within a reasonable time following Notice; (e) Refusal to accept one of a reasonable number of offers of replacement dwellings; and/or, (f) A requirement under State or local law or emergency circumstances that cannot be prevented by reasonable efforts on the part of the City. E. CITIZEN PARTICIPATION As the process for considering the Project moves forward, the City will observe the following protocol: 1. Provide affected tenants with full and timely access to documents relevant to the relocation program; 2. Encourage meaningful participation in reviewing the relocation plan and monitoring the relocation assistance program; including the Project area occupants, neighborhood groups and community organizations forming a relocation committee; 3. Provide technical assistance necessary to interpret elements of the relocation program; 4. Issue a general notice concerning the availability of the Plan for public review, as required, 30 days prior to its proposed approval; and 5. Include written or oral comments concerning the Plan as an attachment (Exhibit E) when it is forwarded to the City Council for approval. A copy of the approved Plan 363 21 will be forwarded to the California Department of Housing and Community Development (HCD). F. PROJECTED DATE OF DISPLACEMENT The City anticipates that Notices to Vacate will not be issued prior to November 2019. The City has obtained approval to initiate the acquisition and relocation activities at the end of April 2019 and the City anticipates that those activities will be completed by the end of November 2019, with construction to begin shortly after. G. ESTIMATED RELOCATION COSTS The total budget estimate for relocation-related payments for this Project, including a 20% contingency, is $227,000.00. The estimated relocation budget does not include any payments related to property renovations. In addition, the budget does not consider the cost of any services necessary to implement the Plan and complete the relocation element of the Project. If the Project is implemented, and circumstances arise that should change either the number of residential occupants, or the nature of their activity, the City will authorize any additional funds that may need to be appropriated. The City pledges to appropriate, on a timely basis, the funds necessary to ensure the successful completion of the Project, including funds indicated as necessary for LRH as indicated in Section IV, E, of this Plan to meet its obligation under applicable Relocation Laws. 364 EXHIBIT A 365 366 367 EXHIBIT B HUD INCOME LEVELS – RIVERSIDE COUNTY The following figures are approved by the U. S. Department of Housing and Urban Development (HUD) for use in Riverside County to define and determine housing eligibility by income level. Figures are per the Department of Housing and Urban Development (California), updated in April 2018. Area Median Income: $65,800 Family Size Extremely Low Very Low Low 1 Person 14,150 23,600 37,750 2 Person 16,460 27,000 43,150 3 Person 20,780 30,350 48,550 4 Person 25,100 33,700 53,900 5 Person 29,420 36,400 58,250 6 Person 33,740 39,100 62,550 7 Person 38,060 41,800 66,850 8 Person 42,380 44,500 71,150 368 EXHIBIT C Relocation Assistance Informational Statement for Families and Individuals - Mobile Homes (Federal) City of La Quinta Project Name: Dune Palms Road Low Water Crossing Bridge Project City Representative: Overland, Pacific & Cutler, LLC. 2280 Market Street, Suite 200 Riverside, CA 92501 Phone: (951) 683-2353 369 Informational Statement Content: 1. General Information 2. Assistance In Locating A Replacement Dwelling 3. Moving Benefits 4. Replacement Housing Payment – Mobile Home Tenants And Certain Others 5. Section 8 Tenants 6. Replacement Housing Payment – Mobile Home Homeowners 7. Qualification For And Filing Of Relocation Claims 8. Last Resort Housing Assistance 9. Rental Agreement 10. Evictions 11. Appeal Procedures – Grievance 12. Tax Status of Relocation Benefits 13. Legal Presence Requirement 14. Non-Discrimination and Fair Housing 15. Additional Information And Assistance Available Spanish speaking agents are available. Si necesita esta información en español, por favor llame a su agente. 1. GENERAL INFORMATION The dwelling in which you now live is in a project area proposed to be improved by, or financed through, the City using federal funds. If and when the project proceeds, and it is necessary for you to move from your dwelling, you may be eligible for certain benefits. in this event, you will be notified in a timely manner as to the date by which you must move. Please read this information, as it will be helpful to you in determining your eligibility and the amount of the relocation benefits you may receive under the federal law. You will need to provide adequate and timely information to determine your relocation benefits. The information is voluntary, but if you don’t provide it, you may not receive the benefits or it may take longer to pay you. We suggest you save this informational statement for reference. The City has retained the professional firm of Overland, Pacific & Cutler, LLC. (OPC) to provide relocation assistance to you. The firm is available to explain the program and benefits. Their address and telephone number is listed on the cover. 370 PLEASE DO NOT MOVE PREMATURELY. THIS IS NOT A NOTICE TO VACATE YOUR DWELLING. However, if you desire to move sooner than required, you must contact your agent at Overland, Pacific & Cutler, LLC., so you will not jeopardize any benefits. This is a general informational brochure only, does not constitute legal advice to you, and is not intended to give a detailed description of either the law or regulations pertaining to the City’s relocation assistance program. Please continue to pay your rent to your current landlord, otherwise you may be evicted and jeopardize the relocation benefits to which you may be entitled to receive. Once the City acquires the property, you will also be required to pay rent to the City. 2. ASSISTANCE IN LOCATING A REPLACEMENT DWELLING The City, through its representatives, will assist you in locating a comparable replacement dwelling by providing referrals to appropriate and available housing units. You are encouraged to actively seek such housing yourself. When a suitable replacement dwelling unit has been found, your relocation agent will carry out an inspection and advise you as to whether the dwelling unit meets decent, safe and sanitary housing requirements. A decent, safe and sanitary housing unit provides adequate space for its occupants, proper weatherproofing and sound heating, electrical and plumbing systems. Your new dwelling must pass inspection before relocation assistance payments can be authorized. 3. MOVING BENEFITS If you must move as a result of displacement by the City, you will receive a payment to assist in moving your personal property. The actual, reasonable and necessary expenses for moving your household belongings may be determined based on the following methods: • A Fixed Moving Payment based on the number of rooms you occupy (see below); or • A payment for your Actual Reasonable Moving and Related Expenses based on at least two written estimates and receipted bills; or • A combination of both (in some cases). For example, you may choose a Self-Move, receiving a payment based on the Fixed Residential Moving Cost Schedule shown below, plus contract with a professional mover to transport your grand piano and/or other items that require special handling. In this case, there may be an adjustment in the number of rooms which qualify under the Fixed Residential Moving Cost Schedule. 371 A. Fixed Moving Payment (Self Move) A Fixed Moving Payment is based upon the number of rooms you occupy and whether or not you own your own furniture. The payment is based upon a schedule approved by the City, and ranges, for example, from $475.00 for one furnished room to $2,505.00 for eight rooms in an unfurnished dwelling. (For details see the table). Your relocation agent will inform you of the amount you are eligible to receive, if you choose this type of payment. If you select a fixed payment, you will be responsible for arranging for your own move, and the City will assume no liability for any loss or damage of your personal property. A fixed payment also includes utility hook-ups and other related moving fees. B. Actual Moving Expense (Commercial Move) If you wish to engage the services of a licensed commercial mover and have the City pay the bill, you may claim the ACTUAL cost of moving your personal property up to 50 miles. At least two competitive moving bids will be required. Your relocation agent can assist you in developing a “mover” scope of services for City approval. 4. MOBILE HOME TENANTS AND CERTAIN OTHERS - REPLACEMENT HOUSING PAYMENT You may be eligible for a payment up to $7,200.00 to assist in renting or purchasing a comparable replacement dwelling. In order to qualify, you must either be a tenant or owner who has occupied the present dwelling for at least 90 days immediately prior to the initiation of negotiations. A. Rental Assistance. If you wish to rent your replacement dwelling, your maximum rental assistance benefits will be based upon the difference over a forty-two (42) month period between the rent you must pay for a comparable replacement dwelling and the lesser of your current rent or thirty percent (30%) of your monthly household income if your total gross income is classified as “low income” by the U. S. Department of Housing and Urban Development’s (HUD) Annual Survey of Income Limits for Public Housing and Section 8 Programs. You will be required to provide your relocation agent with monthly rent and household income verification prior to the determination of your eligibility for this payment. Fixed Moving Schedule CALIFORNIA (Effective 2015) Occupant Owns Furniture: 1 room $725 2 rooms $930 3 rooms $1,165 4 rooms $1,375 5 rooms $1,665 6 rooms $1,925 7 rooms $2,215 8 rooms $2,505 Each additional room $265 Occupant does NOT Own Furniture: 1 room $475 Each additional room $90 372 - OR – B. Down-payment Assistance. If you qualify, and wish to purchase a home as a replacement dwelling, you can apply up to the total amount of your rental assistance payment towards the down-payment and non-recurring incidental expenses. Your relocation agent will clarify procedures necessary to apply for this payment. 5. SECTION 8 TENANTS If you do move, you may be eligible to transfer your Section 8 eligibility to a replacement site. In such cases, a comparable replacement dwelling will be determined based on your family composition at the time of displacement and the current housing program criteria. This may not be the size of the unit you currently occupy. Your relocation agent will provide counseling and other advisory services along with moving benefits. 6. MOBILE HOME HOMEOWNERS - REPLACEMENT HOUSING & MOVING PAYMENTS A. Replacement Housing Option - If you own and occupy a mobile home to be purchased by the City for at least 90 days prior to the initiation of negotiation, you may be eligible to receive a payment of up to $31,000.00 to assist you in purchasing a comparable replacement unit. This payment is intended to cover the following items: 1. Purchase Price Differential - An amount which, when added to the amount for which the City purchased your mobile home, equals the lesser of the actual cost of your replacement dwelling; or the amount determined by the City as necessary to purchase a comparable replacement dwelling. Your relocation agent will explain both methods to you. 2. Mortgage Interest Differential - The amount which covers the increased interest costs, if any, required to finance a replacement dwelling. Your relocation agent will explain limiting conditions. 3. Incidental Expenses - Those one time incidental costs related to purchasing a replacement unit, such as escrow fees, recording fees, and credit report fees. Recurring expenses such as prepaid taxes and insurance premiums are not compensable. B. Rental Assistance Option - If you are an owner-occupant and choose to rent rather than purchase a replacement dwelling, you may be eligible for a rental assistance payment of up to the amount that you could have received under the Purchase Price Differential, explained above. The payment will be based on the difference between the fair market rent of the 373 dwelling you occupy and the rent you must pay for a comparable replacement dwelling. If you receive a rental assistance payment, as described above, and later decide to purchase a replacement dwelling, you may apply for a payment equal to the amount you would have received if you had initially purchased a comparable replacement dwelling, less the amount you have already received as a rental assistance payment. C. Space Rent Differential - If you decide to purchase another mobile home or move your mobile home, you may be eligible for additional assistance to cover any increased space rent at the facility to which you relocate. Your maximum rental assistance benefits will be based upon the difference over a forty-two (42) month period between the rent and estimated utilities you must pay for a comparable replacement dwelling (as determined by the City and the lesser of your current rent and average utilities or thirty percent (30%) of your gross monthly household income (if your household income is classified as “low income” by the U. S. Department of Housing and Urban Development’s Annual Survey of Income Limits for the Public Housing and Section 8 Programs.) This space rent differential payment may be used to lease a replacement site; may be applied to the purchase price of a replacement site; or may be applied, with any replacement housing payment attributable to the mobile home, to the purchase of a replacement mobile home or conventional “decent, safe and sanitary” dwelling. D. Moving Option - If your coach is movable and you elect to have the City move your coach to another park, the City will pay for the following: 1. Preparation of your coach for moving; 2. Transport of your coach to a new site (within 50 miles); 3. Set-up of your coach at the new location (including code required modifications such as earthquake strapping); 4. Reconstruction or reinstallation of all appurtenances such as porches, awnings and/or storage buildings; which are not acquired; 5. Payment of all fees for reinstallation; 6. Space Rent Differential, as described above; and 7. Other expenses which the City deems to be reasonable and necessary. NOTE: The cost of replacing landscaping and hardscape improvements is not covered. 7. QUALIFICATION FOR, AND FILING OF, RELOCATION CLAIMS To be eligible for a replacement housing payment described above, you must purchase or rent and occupy a decent, safe and sanitary replacement dwelling within 12 months from the later of the following dates: 374 1) the date the City has paid the Acquisition cost of your current dwelling, or 2) the date the first comparable replacement dwelling referral has been made available to you. You must also file all claims for replacement housing or moving payments within 18 months from the later of the following dates: 1) the date which you moved from your displacement dwelling, or 2) the date the City has paid the Acquisition cost of your current dwelling. Failure to occupy the replacement dwelling or to submit claims within the above time limits could result in loss of moving and/or replacement housing benefits. 8. LAST RESORT HOUSING ASSISTANCE If comparable replacement dwellings are not available when you are required to move, or if replacement housing is not available within the monetary limits described above, the City will provide Last Resort Housing assistance to enable you to rent or purchase a replacement dwelling on a timely basis. Last Resort Housing assistance is based on the individual circumstances of the displaced person. Your relocation agent will explain the process for determining whether or not you qualify for Last Resort assistance. If you are a tenant, and you choose to purchase rather than rent a comparable replacement dwelling, the entire amount of your rental assistance and Last Resort eligibility must be applied toward the down-payment and eligible incidental expenses of the home you intend to purchase. 9. RENTAL AGREEMENT As a result of the City action to purchase the property where you live, you may become a tenant of the City. If this occurs, you will be asked to sign a rental agreement which will specify the monthly rent to be paid, when rent payments are due, where they are to be paid and other pertinent information. 10. EVICTIONS Eviction for cause must conform to applicable State and local law. Any person who occupies the real property and is not in unlawful occupancy on the date of initiation of negotiations, is presumed to be entitled to relocation benefits, unless the City determines that: 375 • The person received an eviction notice prior to the initiation of negotiations and, as a result, was later evicted; or • The person is evicted after the initiation of negotiations for serious or repeated violation of material terms of the lease; and • The eviction was not undertaken for the purpose of evading relocation assistance regulations. Except for the causes of eviction set forth above, no person lawfully occupying property to be purchased by the City will be required to move without having been provided with at least 90 days written notice from the City. 11. APPEAL PROCEDURES - GRIEVANCE Any person aggrieved by a determination as to eligibility for, or the amount of, a payment authorized by the City Relocation Assistance Program may have the appeal application reviewed by the City in accordance with its appeals procedure. Complete details on appeal procedures are available upon request from the City. 12. TAX STATUS OF RELOCATION BENEFITS California Government Code Section 7269 indicates no relocation payment received shall be considered as income for the purposes of the Personal Income Tax Law, Part 10 (commencing with Section 170 01) of Division 2 of the Revenue and Taxation Code, or the Bank and Corporation Tax law, Part 11 (commencing with Section 23001) of Division 2 of the Revenue and Taxation Code. Furthermore, federal regulations (49 CFR Part 24, Section 24.209) also indicate that no payment received under this part (Part 24) shall be considered as income for the purpose of the Internal Revenue Code of 1954, which has been re-designated as the Internal Revenue Code of 1986. The preceding statement is not tendered as legal advice in regard to tax consequences, and displacees should consult with their own tax advisor or legal counsel to determine the current status of such payments. (IRS Circular 230 disclosure: To ensure compliance with requirements imposed by the IRS, we inform you that any tax advice contained in this communication (including any attachments) was not intended or written to be used, and cannot be used, for the purpose of (i) avoiding tax-related penalties under the Internal Revenue Code or (ii) promoting marketing or recommending to another party any matters addressed herein) 13. LAWFUL PRESENCE REQUIREMENT In order to be eligible to receive relocation benefits in federally-funded relocation projects, all members of the household to be displaced must provide information regarding their lawful presence in the United States. Any member of the household who is not lawfully present in the United States or declines to provide this information may be denied relocation benefits, unless 376 such ineligibility would result in an exceptional and extremely unusual hardship to the alien’s spouse, parent, or child, any of whom is a citizen or an alien admitted for permanent residence. Exceptional and extremely unusual hardship is defined as significant and demonstrable adverse impact on the health or safety, continued existence of the family unit, and any other impact determined by the City to negatively affect the alien’s spouse, parent or child. Relocation benefits will be prorated to reflect the number of household members with certified lawful presence in the US. For this Project, the City has determined it will fund eligible payments for persons otherwise eligible for them, except for residency status, firm non-federal funds. Your relocation agent can explain this more fully. 14. NON-DISCRIMINATION AND FAIR HOUSING No person shall on the grounds of race, color, national origin or sex, be excluded from participation in, be denied the benefits of, or be subjected to discrimination under the City relocation assistance program pursuant to Title VI of the Civil Rights Act of 1964, Title VIII of the Civil Rights Act of 1968, and other applicable state and federal anti-discrimination and fair housing laws. You may file a complaint if you believe you have been subjected to discrimination. For details contact the City. 15. ADDITIONAL INFORMATION AND ASSISTANCE AVAILABLE Those responsible for providing you with relocation assistance hope to assist you in every way possible to minimize the hardships involved in relocating to a new home. Your cooperation will be helpful and greatly appreciated. If you have any questions at any time during the process, please do not hesitate to contact your relocation agent at Overland, Pacific & Cutler. 377 EXHIBIT D Relocation Assistance Informational Statement for Families and Individuals (Federal) City of La Quinta Project Name: Dune Palms Road Low Water Crossing Bridge Project City Representative: Overland, Pacific & Cutler, LLC 2280 Market Street, Suite 200 Riverside, CA 92501 Phone: (951) 683-2353 Informational Statement Content: 378 1. General Information 2. Assistance In Locating A Replacement Dwelling 3. Moving Benefits 4. Replacement Housing Payment - Tenants And Certain Others 5. Section 8 Tenants 6. Replacement Housing Payment – Homeowners 7. Qualification For And Filing Of Relocation Claims 8. Last Resort Housing Assistance 9. Rental Agreement 10. Evictions 11. Appeal Procedures – Grievance 12. Tax Status of Relocation Benefits 13. Legal Presence Requirement 14. Non-Discrimination and Fair Housing 15. Additional Information And Assistance Available Spanish speaking agents are available. Si necesita esta información en español, por favor llame a su agente. 1. GENERAL INFORMATION The dwelling in which you now live is in a project area that may be improved by, or financed through, the City of La Quinta using federal funds. If and when the project proceeds, and it is necessary for you to move from your dwelling, you may be eligible for certain benefits. You will be notified in a timely manner as to the date by which you must move. Please read this information, as it will be helpful to you in determining your eligibility and the amount of the relocation benefits you may receive under the federal law. You will need to provide adequate and timely information to determine your relocation benefits. The information is voluntary, but if you don’t provide it, you may not receive the benefits or it may take longer to pay you. We suggest you save this informational statement for reference. The Displacing Agency has retained the professional firm of Overland, Pacific & Cutler, LLC (OPC) to provide relocation assistance to you. The firm is available to explain the program and benefits. Their address and telephone number is listed on the cover. PLEASE DO NOT MOVE PREMATURELY. THIS IS NOT A NOTICE TO VACATE YOUR DWELLING. However, if you desire to move sooner than required, you must contact your representative with OPC, so you will not jeopardize any benefits. This is a general informational brochure only, and is not intended to give a detailed description of either the law or regulations pertaining to the Displacing Agency’s relocation assistance program. 379 Please continue to pay your rent to your current landlord, otherwise you may be evicted and jeopardize the relocation benefits to which you may be entitled to receive. Once the Displacing Agency acquires the property, you will also be required to pay rent to the Displacing Agency. 2. ASSISTANCE IN LOCATING A REPLACEMENT DWELLING The Displacing Agency, through its representatives, will assist you in locating a comparable replacement dwelling by providing referrals to appropriate and available housing units. You are encouraged to actively seek such housing yourself. When a suitable replacement dwelling unit has been found, your relocation agent will carry out an inspection and advise you as to whether the dwelling unit meets decent, safe and sanitary housing requirements. A decent, safe and sanitary housing unit provides adequate space for its occupants, proper weatherproofing and sound heating, electrical and plumbing systems. Your new dwelling must pass inspection before relocation assistance payments can be authorized. 3. MOVING BENEFITS If you must move as a result of displacement by the Displacing Agency, you will receive a payment to assist in moving your personal property. The actual, reasonable and necessary expenses for moving your household belongings may be determined based on the following methods: • A Fixed Moving Payment based on the number of rooms you occupy (see below); or • A payment for your Actual Reasonable Moving and Related Expenses based on at least two written estimates and receipted bills; or • A combination of both (in some cases). For example, you may choose a Self-Move, receiving a payment based on the Fixed Residential Moving Cost Schedule shown below, plus contract with a professional mover to transport your grand piano and /or other items that require special handling. In this case, there may be an adjustment in the number of rooms which qualify under the Fixed Residential Moving Cost Schedule. 380 A. Fixed Moving Payment (Self-Move) A Fixed Moving Payment is based upon the number of rooms you occupy and whether or not you own your own furniture. The payment is based upon a schedule approved by the Displacing Agency, and ranges, for example, from $450.00 for one furnished room to $2,365.00 for eight rooms in an unfurnished dwelling. (For details see the table). Your relocation agent will inform you of the amount you are eligible to receive, if you choose this type of payment. If you select a fixed payment, you will be responsible for arranging for your own move, and the Displacing Agency will assume no liability for any loss or damage of your personal property. A fixed payment also includes utility hook-ups and other related moving fees. C. Actual Moving Expense (Commercial Move) If you wish to engage the services of a licensed commercial mover and have the Displacing Agency pay the bill, you may claim the ACTUAL cost of moving your personal property up to 50 miles. Two competitive moving bids will be required. Your relocation agent will assist you in developing a “mover” scope of services for Displacing Agency approval. 4. REPLACEMENT HOUSING PAYMENT – TENANTS AND CERTAIN OTHERS You may be eligible for a payment up to $7,200.00 to assist in renting or purchasing a comparable replacement dwelling. In order to qualify, you must either be a tenant or owner who has occupied the present dwelling for at least 90 days immediately prior to the initiation of negotiations. A. Rental Assistance. If you wish to rent your replacement dwelling, your maximum rental assistance benefits will be based upon the difference over a forty-two (42) month period between the rent you must pay for a comparable replacement dwelling and the lesser of your current rent or thirty percent (30%) of your monthly household income if your total gross income is classified as “low income” by the U. S. Department of Housing and Urban Fixed Moving Schedule CALIFORNIA (Effective 2012) Occupant Owns Furniture: 1 room $685 2 rooms $880 3 rooms $1,100 4 rooms $1,295 5 rooms $1,570 6 rooms $1,815 7 rooms $2,090 8 rooms $2,365 Each additional room $250 Occupant does NOT Own Furniture: 1 room $450 Each additional room $85 381 Development’s (HUD) Annual Survey of Income Limits for Public Housing and Section 8 Programs. You will be required to provide your relocation agent with monthly rent and household income verification prior to the determination of your eligibility for this payment. - OR – B. Down-payment Assistance. If you qualify, and wish to purchase a home as a replacement dwelling, you can apply up to the total amount of your rental assistance payment towards the down-payment and non-recurring incidental expenses. Your relocation agent will clarify procedures necessary to apply for this payment. 5. SECTION 8 TENANTS If you do move, you may be eligible to transfer your Section 8 eligibility to a replacement site. In such cases, a comparable replacement dwelling will be determined based on your family composition at the time of displacement and the current housing program criteria. This may not be the size of the unit you currently occupy. Your relocation agent will provide counseling and other advisory services along with moving benefits. 6. REPLACEMENT HOUSING PAYMENT - HOMEOWNERS A. If you own and occupy a dwelling to be purchased by the Displacing Agency for at least 90 days prior to the initiation of negotiation, you may be eligible to receive a payment of up to $31,000.00 to assist you in purchasing a comparable replacement unit. This payment is intended to cover the following items: 1. Purchase Price Differential - An amount which, when added to the amount for which the Displacing Agency purchased your property, equals the lesser of the actual cost of your replacement dwelling; or the amount determined by the Displacing Agency as necessary to purchase a comparable replacement dwelling. Your relocation agent will explain both methods to you. 2. Mortgage Interest Differential - The amount which covers the increased interest costs, if any, required to finance a replacement dwelling. Your relocation agent will explain limiting conditions. 3. Incidental Expenses - Those one time incidental costs related to purchasing a replacement unit, such as escrow fees, recording fees, and credit report fees. Recurring expenses such as prepaid taxes and insurance premiums are not compensable. 382 B. Rental Assistance Option - If you are an owner-occupant and choose to rent rather than purchase a replacement dwelling, you may be eligible for a rental assistance payment of up to the amount that you could have received under the Purchase Price Differential, explained above. The payment will be based on the difference between the fair market rent of the dwelling you occupy and the rent you must pay for a comparable replacement dwelling. If you receive a rental assistance payment, as described above, and later decide to purchase a replacement dwelling, you may apply for a payment equal to the amount you would have received if you had initially purchased a comparable replacement dwelling, less the amount you have already received as a rental assistance payment. 7. QUALIFICATION FOR, AND FILING OF, RELOCATION CLAIMS To qualify for a Replacement Housing Payment, you must rent or purchase and occupy a comparable replacement unit within one year from the following: • For a tenant, the date you move from the displacement dwelling. • For an owner-occupant, the latter of: a. The date you receive final payment for the displacement dwelling, or, in the case of condemnation, the date the full amount of estimated just compensation is deposited in court; or b. The date the Displacing Agency fulfills its obligation to make available comparable replacement dwellings. All claims for relocation benefits must be filed with the Displacing Agency within eighteen (18) months from the date on which you receive final payment for your property, or the date, on which you move, whichever is later. 8. LAST RESORT HOUSING ASSISTANCE If comparable replacement dwellings are not available when you are required to move, or if replacement housing is not available within the monetary limits described above, the Displacing Agency will provide appropriate Last Resort Housing assistance to enable you to rent or purchase a replacement dwelling on a timely basis. Last Resort Housing assistance is based on the individual circumstances of the displaced person. Your relocation agent will explain the process for determining whether or not you qualify for Last Resort assistance. 383 If you are a tenant, and you choose to purchase rather than rent a comparable replacement dwelling, the entire amount of your rental assistance and Last Resort eligibility must be applied toward the down-payment and eligible incidental expenses of the home you intend to purchase. 9. RENTAL AGREEMENT As a result of the Displacing Agency's action to purchase the property where you live, you may become a tenant of the Displacing Agency. If this occurs, you will be asked to sign a rental agreement which will specify the monthly rent to be paid, when rent payments are due, where they are to be paid and other pertinent information. 10. EVICTIONS Eviction for cause must conform to applicable State and local law. Any person who occupies the real property and is not in unlawful occupancy on the date of initiation of negotiations, is presumed to be entitled to relocation benefits, unless the Displacing Agency determines that: • The person received an eviction notice prior to the initiation of negotiations and, as a result, was later evicted; or • The person is evicted after the initiation of negotiations for serious or repeated violation of material terms of the lease; and • The eviction was not undertaken for the purpose of evading relocation assistance regulations. Except for the causes of eviction set forth above, no person lawfully occupying property to be purchased by the Displacing Agency will be required to move without having been provided with at least 90 days written notice from the Displacing Agency. 11. APPEAL PROCEDURES - GRIEVANCE Any person aggrieved by a determination as to eligibility for, or the amount of, a payment authorized by the Displacing Agency’s Relocation Assistance Program may have the appeal application reviewed by the Displacing Agency in accordance with its appeals procedure. Complete details on appeal procedures are available upon request from the Displacing Agency. 12. TAX STATUS OF RELOCATION BENEFITS 384 California Government Code Section 7269 indicates no relocation payment received shall be considered as income for the purposes of the Personal Income Tax Law, Part 10 (commencing with Section 170 01) of Division 2 of the Revenue and Taxation Code, or the Bank and Corporation Tax law, Part 11 (commencing with Section 23001) of Division 2 of the Revenue and Taxation Code. Furthermore, federal regulations (49 CFR Part 24, Section 24.209) also indicate that no payment received under this part (Part 24) shall be considered as income for the purpose of the Internal Revenue Code of 1954, which has been re-designated as the Internal Revenue Code of 1986. The preceding statement is not tendered as legal advice in regard to tax consequences, and displacees should consult with their own tax advisor or legal counsel to determine the current status of such payments. (IRS Circular 230 disclosure: To ensure compliance with requirements imposed by the IRS, we inform you that any tax advice contained in this communication (including any attachments) was not intended or written to be used, and cannot be used, for the purpose of (i) avoiding tax-related penalties under the Internal Revenue Code or (ii) promoting marketing or recommending to another party any matters addressed herein) 13. LAWFUL PRESENCE REQUIREMENT In order to be eligible to receive relocation benefits in federally-funded relocation projects, all members of the household to be displaced must provide information regarding their lawful presence in the United States. Any member of the household who is not lawfully present in the United States or declines to provide this information may be denied relocation benefits, unless such ineligibility would result in an exceptional and extremely unusual hardship to the alien’s spouse, parent, or child, any of whom is a citizen or an alien admitted for permanent residence. Exceptional and extremely unusual hardship is defined as significant and demonstrable adverse impact on the health or safety, continued existence of the family unit, and any other impact determined by the Displacing Agency to negatively affect the alien’s spouse, parent or child. Relocation benefits will be prorated to reflect the number of household members with certified lawful presence in the US. For this Project, the City has determined it will fund eligible payments for persons otherwise eligible for them, except for residency status, firm non-federal funds. Your relocation agent can explain this more fully. 14. NON-DISCRIMINATION AND FAIR HOUSING No person shall on the grounds of race, color, national origin or sex, be excluded from participation in, be denied the benefits of, or be subjected to discrimination under the Displacing Agency’s relocation assistance program pursuant to Title VI of the Civil Rights Act of 1964, Title VIII of the Civil Rights Act of 1968, and other applicable state and federal anti-discrimination and 385 fair housing laws. You may file a complaint if you believe you have been subjected to discrimination. For details contact the Displacing Agency. 15. ADDITIONAL INFORMATION AND ASSISTANCE AVAILABLE Those responsible for providing you with relocation assistance hope to assist you in every way possible to minimize the hardships involved in relocating to a new home. Your cooperation will be helpful and greatly appreciated. If you have any questions at any time during the process, please do not hesitate to contact your relocation agent at OPC. 386 EXHIBIT E Relocation Assistance Informational Statement For Business, Farm & Nonprofit City of La Quinta Project Name: Dune Palms Road Low Water Crossing Bridge Project City Representative: Overland, Pacific & Cutler, LLC. 2280 Market Street, Suite 200 Riverside, CA 92501 Phone: (951) 683-2353 Spanish speaking agents are available. Si necesita esta información en español, por favor llame a su agente. 387 Introduction The property on which you now conduct your business is in an area proposed to be improved by, or financed through, the City of La Quinta (City) using federal funds. If and when the project proceeds, and it is necessary for you to move your business, you may be eligible for certain benefits. You will be notified in a timely manner as to the date by which you must move. Please read this information, as it will be helpful to you in determining your eligibility and the amount of the relocation benefits you may receive under the law. You will need to provide adequate and timely information to determine your relocation benefits. The information is voluntary, but if you don’t provide it, you may not receive the benefits or it may take longer to pay you. We suggest you save this informational statement for reference. The City has retained the professional firm of Overland, Pacific & Cutler, LLC. (OPC) to provide relocation assistance to you. The firm is available to explain the program and benefits. Their address and telephone number is listed on the cover. PLEASE DO NOT MOVE PREMATURELY. THIS IS NOT A NOTICE TO VACATE THE PROPERTY. However, if you desire to move sooner than required, you must contact your relocation agent at Overland, Pacific & Cutler, LLC., so you will not jeopardize any benefits. This is a general informational brochure only, and is not intended to give a detailed description of either the law or regulations pertaining to the City relocation assistance program. Please continue to pay your rent to your current landlord, otherwise you may be evicted and jeopardize the relocation benefits to which you may be entitled to receive. Once the City acquires the property, you will also be required to pay rent to the City. Summary of Available Relocation Assistance: A. Advisory assistance to explain the relocation process, the related eligibility requirements, the procedures for obtaining reimbursement for moving expenses and referrals to suitable replacement locations B. Payment for your moving expenses. You may receive one of the following options: Option 1: A Payment for Actual Reasonable Moving and Related Expenses; or Option 2: A Fixed Payment In Lieu of a Payment for Actual Moving and Related Expenses 388 C. Other help to reestablish your business and minimize the impact of the move including help in preparing claim forms to request relocation payments. If you disagree with the City decision as to your right to a relocation payment, or the amount of the payment, you may appeal that decision. GENERAL RELOCATION QUESTIONS 1. How Will I Know I Am Eligible for Relocation Assistance? Ordinarily, eligibility begins on the date the owner of the property receives the City’s initial written offer to purchase the property. Therefore, you should not move before that date or receiving a notice of eligibility. If you do, you may not be eligible for relocation assistance. 2. How Will the City Know How Much Help I Need? You will be contacted at an early date and personally interviewed by an agent of the City. The interviewer will want to get information about your current operation, as well as identify movable personal property and non-movable improvements, determine your needs and preferences for a replacement location, estimate the time required to vacate the premises and your need for advance payments. During the interview, you may want to discuss other issues relative to your move. It is to your advantage to provide as much information as possible so that the City, through its relocation agent, can assist you in moving with a minimum of hardship. The information you give will be kept in confidence. 3. How Soon Will I Have to Move? Every reasonable effort will be made to provide you with sufficient time to find a suitable replacement location and reestablish your business. If possible, a mutually agreeable date for the move will be worked out. Unless there is an urgent need for the property (e.g., your occupancy would present a health or safety emergency), you will not be required to move without at least 90 days advance written notice. It is important, however, that you keep in close contact with the City so that you are aware of the time schedule for carrying out the project and the approximate date by which you will have to move. 389 4. I Own the Property. Will I Be Paid for It Before I Have to Move? If you reach a voluntary agreement to sell your property to the City, you will not be required to move before you receive the agreed purchase price. If the property is acquired through an eminent domain proceeding, you cannot be required to move before the estimated fair market value of the property has been deposited with the court. (You should be able to withdraw this amount immediately, less any amounts necessary to pay off any mortgage or other liens on the property and to resolve any special ownership problems. Withdrawal of your share of the money will not affect your right to seek additional compensation for your property, but may affect other legal rights). 5. Will I Have to Pay Rent to the City Before I Move? You may be required to pay a fair rent to the City for the period between the acquisition of your property and the date that you move. Your rent and the terms of your tenancy will be generally the same as in the prior arrangement. 6. How Will I Find a Replacement Location? Your relocation agent will provide you with current and continuing information on available replacement locations that meet your needs. You will also be provided with the names of local real estate agents and brokers who can assist you in finding the type of replacement location you require. However, you are urged to take an active role in identifying, and relocating to, a location of your choice. No one knows your needs better than you do. You will want a facility that provides sufficient space for your planned activities. You will also want to ensure that there are no zoning or other requirements which will unduly restrict your planned operations. Your relocation agent will explain which kind of moving costs are eligible for reimbursement and which are not eligible. That will enable you to carry out your move in the most advantageous manner. 7. What Other Assistance Will Be Available to Help Me? In addition to help in finding a suitable replacement location, your relocation agent will help you secure the services of outside specialists, as necessary, to plan the move, as well as provide assistance during the actual move and in the reinstallation of machinery and/or other personal property. The range of services depends on the needs of the business being displaced. You 390 should ask the City relocation agent to tell you about the specific services that will be available to you. 8. I Have a Replacement Location and Want to Move. What Should I Do? Before you make any arrangements to move, notify the City relocation agent, in writing, of your intention to move. This should be done at least 30 days before the date you begin your move. The City will discuss the move with you and advise you of the relocation payment(s) for which you may be eligible, the requirements to be met, and how to obtain a payment. 9. I Plan to Discontinue My Business Rather than Move. What Should I Do? If you have decided to discontinue your business rather than reestablish it, you may still be eligible to receive a relocation payment, though discontinuing the business may impact other claims for compensation you may be eligible to make in other contexts. Contact the City relocation agent and discuss your decision to discontinue your business. You will be informed of the payment, if any, for which you may be eligible, the requirements to be met, and how to obtain your payment. 10. What Kinds of Payments for Moving Expenses Will I Receive? Every business is eligible for a relocation payment to cover the reasonable cost of moving. Assuming you meet certain eligibility criteria, you may choose one of the following options: Option 1: A Payment for Actual Reasonable Moving and Related Expenses; or Option 2: A Fixed Payment In Lieu of Moving and Related Expenses These payment options are described below: Option 1: Payment for Actual Reasonable Moving and Related Expenses If you choose a Payment for Actual Reasonable Moving and Related Expenses, you may claim the cost of: 391 1. Transportation of personal property. Transportation costs for a distance beyond 50 miles are not eligible, unless the City determines that relocation beyond 50 miles is justified. 2. Packing, crating, unpacking, and uncrating of the personal property. 3. Disconnecting, dismantling, removing, reassembling, and reinstalling relocated machinery, equipment, and other personal property, and certain substitute personal property. This includes connection to utilities available within the building. It also includes modifications to the personal property, including those mandated by Federal, State or local law, code or ordinance, necessary to adapt it to the replacement structure, the replacement site, or the utilities at the replacement site, and modifications necessary to adapt the utilities at the replacement site to the personal property. 4. Storage of the personal property determined to be necessary by the City, not to exceed 12 months, unless the City determines that a longer period is warranted. 5. Insurance for the replacement value of the personal property in connection with the move and necessary storage. 6. The replacement value of property lost, stolen or damaged in the process of moving (not through fault or negligence of the displaced person, his or her agent or employee), where insurance covering such loss, theft or damage is not reasonably available. 7. Any license, permit, fees or certification required of your business at the replacement location. However, the payment may be based on the remaining useful life of the existing license, permit, fees or certification. 8. Reasonable and preauthorized (by the City) professional services, the City determines to be necessary for (i) planning the move of the personal property, (ii) moving the personal property, and (iii) installing the relocated personal property at the replacement location. 9. Re-lettering signs and replacing stationary on hand at the time of displacement that is made obsolete as a result of the move. 10. Actual direct loss of tangible personal property incurred as a result of moving or discontinuing your business. The payment will consist of the lesser of: 392 (i) The fair market value in place of the item, as is for continued use at the displacement site, less the proceeds from its sale. (To be eligible for payment, you must make a good faith effort to sell the personal property, unless the City determines that such effort is not necessary. When payment for property loss is claimed for goods held for sale, the fair market value will be based on the cost of the goods to the business, not the potential selling price.); or (ii) The estimated cost of moving the item as is, but with no allowance for storage; or for reconnecting a piece of equipment if the equipment is in storage or not being used at the acquired site. (If you elect to discontinue your business, the estimated cost will be based on a moving distance of 50 miles.) 11. Purchase of substitute personal property. If an item of personal property which is used as part of your business is not moved but is promptly replaced with a substitute item that performs a comparable function at the replacement site, you will be entitled to payment for the lesser of: (i) The cost of the substitute item, including installation costs at the replacement site, minus any proceeds from the sale or trade-in of the replaced item; or (ii) The estimated cost of moving and reinstalling the replaced item but with no allowance for storage. At the City discretion, the estimated cost for a low cost or uncomplicated move may be based on a single bid or estimate. 12. The reasonable cost incurred in attempting to sell an item that is not to be relocated. 13. Searching for a replacement location. Your business is entitled to reimbursement for actual expenses, not to exceed $2,500 as the City determines to be reasonable, which are incurred in searching for a replacement location including: i) Transportation ii) Meals and lodging away from home iii) Time spent searching, based on reasonable salary or earnings 393 iv) Fees paid to a real estate agent or broker to locate a replacement site, exclusive of any fees or commissions related to the purchase of such site v) Time spent in obtaining permits and attending zoning hearings; and vi) Time spent negotiating the purchase of a replacement site based on a reasonable salary or earnings. 14. When the personal property to be moved is of low value and high bulk, and the cost of moving the property would be disproportionate to its value in the judgment of the City, the allowable moving cost payment shall not exceed the lesser of: the amount which would be received if the property were sold at the site or the replacement cost of a comparable quantity delivered to the new business location. 15. Other related moving expenses as the City determines to be reasonable and necessary, including: i) Connection to available nearby utilities from the right-of-way to improvements at the replacement site. ii) Pre-approved professional services performed prior to the purchase or lease of a replacement site to determine its suitability for your business operation, including but not limited to soil testing, feasibility and marketing studies (excluding any fees or commissions directly related to the purchase or lease of such site). At the City discretion, a reasonable pre-approved hourly rate may be established. iii) Impact fees or one-time assessments for anticipated heavy utility usage, as determined by the City. The City relocation agent will explain all eligible moving costs, as well as, those which are not eligible. You must be able to account for all costs that you incur, so keep all your receipts. The City will inform you of the documentation needed to support your claim. You may minimize the amount of documentation needed to support your claim, if you elect to "self-move" your property. Payment for a self-move is based on the amount of an acceptable low bid or estimate obtained by the City. If you self-move, you may move your personal property using your own employees and equipment or a commercial mover. If you and the City cannot agree on an acceptable amount to cover the cost of the self-move, you will have to submit full documentation in support of your claim. 394 You may elect to pay your moving costs yourself and be reimbursed by the City or, if you prefer, you may have the City pay the mover directly. In either case, let the City relocation agent know before you move. The City agent can help you select a reliable and reputable mover. When a payment for "actual direct loss of personal property" or "substitute personal property" is made for an item, the estimated cost of moving the item may be based on the lowest acceptable bid or estimate obtained by the City. If not sold or traded-in, the item must remain at the old location and ownership of the item must be transferred to the City before you may receive the payment. In addition to the reimbursable expenses described above, a small business, farm or non-profit organization may be eligible to receive a payment of up to $25,000 for expenses actually incurred in relocating and reestablishing its operation at a replacement site. Eligible expenses must be reasonable and necessary, as determined by the City. They may include but are not limited to the following: 1. Repairs or improvements to the replacement real property as required by federal, state or local law, code or ordinance. 2. Modifications to the replacement property to accommodate the business operation or make replacement structures suitable for conducting the business. 3. Construction and Installation costs for exterior signage to advertise the business. 4. Redecoration or replacement of soiled or worn surfaces at the replacement site, such as paint, paneling or carpeting. 5. Advertising of replacement location. 6. Estimated increased costs of operation during the first 2 years at the replacement site, for such items as: a. Lease or rental charges b. Personal or real property taxes 395 c. Insurance premiums, and d. Utility charges (excluding Impact fees) 7. Other items that the City considers essential to the reestablishment of the business. The following is a non-exclusive listing of reestablishment expenditures not considered to be reasonable, necessary or otherwise eligible:  Purchase of capital assets, such as, office furniture, filing cabinets, and machinery or trade fixtures.  Purchase of manufacturing materials, production supplies, product inventory, or other items used in the normal course of the business operation.  Interest costs associated with any relocation expense or the purchase of replacement property.  Payment to a part-time business in the home which does not contribute materially to the household income. Option 2: Fixed Payment In Lieu of a Payment for Actual Reasonable Moving and Related Expenses A displaced business, non-profit organization or farm may be eligible to choose a fixed payment in lieu of the payments for actual moving and related expenses and actual reasonable reestablishment expenses. The payment may not be less than $1,000.00 or more than $40,000.00. For a business or farm, the payment is based on the average annual net earnings before Federal, State and local income taxes during the 2 taxable years immediately prior to the taxable year in which it was displaced. For a non-profit organization, the payment is based on the average of 2 years annual gross revenues less administrative expenses. In order to qualify for this payment, the City must determine that: 1. The business owns or rents personal property which must be moved in connection with the displacement and for which an expense would be incurred in such move, and the business vacates or relocates from its displacement site. 2. The business cannot be relocated without a substantial loss of existing patronage (clientele or net earnings). 396 3. The business is not a part of a commercial enterprise having more than three other entities which are not being acquired by the City, and which are engaged in the same or similar business activities. 4. The business is not operated at the displacement dwelling/site solely for the purpose of renting such dwelling/site to others. 5. The business contributed materially to the income of the displaced person during the two (2) taxable years prior to displacement. If the business or farm was not in operation for the full two years prior to displacement, the net earnings are based on the actual period of operation at the acquired site projected to an annual rate. Average net earnings may be based on a different period of time when the City determines it to be more equitable. Net earnings include any compensation paid to the owners of the business, a spouse or dependents. Proof of net earnings must be furnished to the City through income tax returns, certified financial statements, or other reasonable evidence which the City determines is satisfactory. For a qualified non-profit organization, gross earnings may include membership fees, class fees, cash donations, tithes and receipts from sales or other forms of fund collection that enables the non-profit organization to operate. Administrative expenses are those for administrative support such as rent, utilities, salaries, advertising and other like items as well as fund raising expenses. Operating expenses for carrying out the purposes of the non-profit organization are not included in administrative expenses. The monetary receipts and expense amounts may be verified with certified financial statements or financial documents required by public agencies. The City will inform you as to your eligibility for this payment option and the documentation you must submit to support your claim. Remember, when you elect to take this payment option you are not entitled to reimbursement for any other moving expenses, i.e. Option A described above. 11. I Own an Outdoor Advertising Display. What Relocation Payment Will I Receive? 397 As the owner of an outdoor advertising display, you are eligible for a Relocation Payment For Actual Reasonable Moving and Related Expenses. You are not eligible to receive a Payment In Lieu of a Payment For Actual Reasonable Moving and Related Expenses. If you choose not to relocate or replace the sign, the payment for "direct loss of personal property" would be the lesser of: (1) the depreciated reproduction cost of the sign, as estimated by the City, less the proceeds from its sale, or (2) the estimated cost of moving the sign without temporary storage. The City will inform you as to the exact costs that may be reimbursed. 12. How do I Receive a Relocation Payment? You must file a claim for a relocation payment. The City relocation agent will provide you with the required claim forms, assist you in completing them, and explain the type of documentation that you must submit in order to receive your relocation payments. If you must pay any relocation expenses before you move (e.g., because you must provide a security deposit if you lease your new location), discuss your financial needs with the City. You may be able to obtain an advance payment. An advance payment may be placed in "escrow" to ensure that the move will be completed on a timely basis. If you are a tenant, you must file your claim within 18 months after the date you move. If you own the property, you must file within 18 months after the date you move, or the date you receive the final acquisition payment, whichever is later. However, it is to your advantage to file as soon as possible after you move. The sooner you submit your claim, the sooner it can be processed and paid. If you are unable to file your claim within 18 months, the City may extend this period. You will be paid promptly after you file an acceptable claim. If there is any question regarding your right to a relocation payment or the amount of the payment, you will be notified, in writing, of the problem and the action you may take to resolve the matter. 13. Non-Discrimination No person shall on the grounds of race, color, national origin or sex, be excluded from participation in, be denied the benefits of, or be subjected to discrimination under the City relocation assistance program pursuant to Title VI of the Civil Rights Act of 1964, Title VIII of the Civil Rights Act of 1968, and other applicable state and federal anti-discrimination laws. You may file a complaint if you believe you have been subjected to discrimination. For details contact the City. 398 14. Appeals Any person aggrieved by a determination as to eligibility for, or the amount of, a payment authorized by the City Relocation Assistance Program may have the appeal application reviewed by the City accordance with its appeals procedure. Complete details on appeal procedures are available upon request from the City. 15. Tax Status of Relocation Benefits California Government Code Section 7269 indicates no relocation payment received shall be considered as income for the purposes of the Personal Income Tax Law, Part 10 (commencing with Section 170 01) of Division 2 of the Revenue and Taxation Code, or the Bank and Corporation Tax law, Part 11 (commencing with Section 23001) of Division 2 of the Revenue and Taxation Code. Furthermore, federal regulations (49 CFR Part 24, Section 24.209) also indicate that no payment received under this part (Part 24) shall be considered as income for the purpose of the Internal Revenue Code of 1954, which has been re-designated as the Internal Revenue Code of 1986. The preceding statement is not tendered as legal advice in regard to tax consequences, and displacees should consult with their own tax advisor or legal counsel to determine the current status of such payments. (IRS Circular 230 disclosure: To ensure compliance with requirements imposed by the IRS, we inform you that any tax advice contained in this communication (including any attachments) was not intended or written to be used, and cannot be used, for the purpose of (i) avoiding tax- related penalties under the Internal Revenue Code or (ii) promoting marketing or recommending to another party any matters addressed herein). 16. Lawful Presence Requirement Pursuant to the Public Law 105-117, in order to be eligible to receive non-residential relocation benefits in federally-funded projects, in the case of an unincorporated business, each owner must be either a citizen or national of the United States, or an alien who is lawfully present in the United States. The owner of a sole proprietorship and all owners of a partnership must provide information regarding their lawful presence in the United States, and a for-profit or a non-profit corporation must certify that it is authorized to conduct business within the United States. Owners of sole proprietorships or partnerships, who are not lawfully present in the United States, or who decline to provide this information, are not eligible for relocation assistance, unless such ineligibility would result in an exceptional and extremely unusual hardship to the alien’s spouse, parent, or child, any of whom is a citizen or an alien admitted for permanent residence. 399 Exceptional and extremely unusual hardship is defined as significant and demonstrable adverse impact on the health or safety, continued existence of the family unit, and any other impact determined by the City to negatively affect the alien’s spouse, parent or child. Relocation benefits will be prorated to reflect the number of owners with certified lawful presence in the United States. 17. Additional Information If you have further questions after reading this brochure, please contact the City relocation agent at Overland, Pacific & Cutler, LLC. 400 EXHIBIT F List of Mobile Homes for Sale 2 Bedroom Mobile Homes for Sale Number Address Purchase Price Pad Rent 1 80-00 Ave 48, Indio Sp. 3 $10,000.00 $850- $950 2 80-00 Ave 48, Indio Sp. 296 $14,000.00 $850- $950 3 80-00 Ave 48, Indio Sp. 141 $35,000.00 $850- $950 4 80-00 Ave 48, Indio Sp. 157 $39.000.00 $850- $950 5 80-00 Ave 48, Indio Sp. 176 $60,000.00 $850- $950 6 80-00 Ave 48, Indio Sp. 202 $40.000.00 $850- $950 7 50001 Hwy 74, Palm Desert Sp. 6 Lazy B $32,500.00 $700.00 3 Bedroom Mobile Homes for Sale Number Address Purchase Price Pad Rent 1 80-000 Ave 48, Indio Sp. 50 $65,000.00 $850-$950 2 80-000 Ave 48, Indio Sp. 152 $83,000.00 $850-$950 3 80-000 Ave 48, Indio Sp. 218 $80,000.00 $850-$950 4 80-000 Ave 48, Indio Sp. 229 $55,000.00 $850-$950 5 80-000 Ave 48, Indio Sp. 244 $58.500.00 $850-$950 6 5001 Hwy 74, Palm Desert Sp. 4 Bar D $109,000.00 $700.00 7 5001 Hwy 74, Palm Desert Sp. 40 $75,900.00 $700.00 8 12 Diamond E, Palm Desert $60,000.00 $700.00 9 80-000 Ave 48, Indio Sp. 273 $55,000.00 $850-$950 10 17555 Corkill Road, Desert Hot Springs Sp. 26 $69,900.00 Unknown 11 8000 Ave 48, Indio Sp. N/A $45,000.00 $850-$950 12 8000 Ave 48, Indio Sp. N/A $50,000.00 $850-$950 13 22840 Sterling Ave, Desert Hot Springs Sp. 94 $70,000.00 Unknown 14 74711 Dillon Rd. Desert Hot Springs, Sp. 354 $64,500.00 Unknown 401 EXHIBIT G Single Family Residential Rentals Number Address City Bed/Bath Rent 1 52975 Avenida Ramirez LQ 3/2 $1,600 2 52255 Avenida Obregon LQ 3/2 $1,895 3 53945 Avenida Martinez LQ 3/2 $1,675 4 78245 Desert Falls Way LQ 4/2 $2,100 5 79180 Diane Dr. LQ 4/2 $2,200 6 79385 Horizon Palms Cir. LQ 3/3 $1,750 7 53080 Avenida Alvarado LQ 3/2 $1,850 8 52255 Avenida Obregon LQ 3/2 $1,895 9 78245 Desert Fall Way LQ 4/3 $2,100 10 43910 Diane Dr. LQ 4/2 $2,200 11 785625 Carnes Cir. LQ 3/2 $2,200 12 43910 Milan Ct. LQ 3/2 $2,200 13 787541 Torino Dr. LQ 3/2 $2,300 14 54912 Shoal LQ 3/2 $2,300 15 79105 Cindy Ct. LQ 3/2 $2,395 16 54040 Avenida Ramirez LQ 3/2 $2,400 17 48101 Vista Cielo LQ 3/2 $2,400 18 61524 Topaz Dr. LQ 3/3 $2,500 19 49429 Guijarro Dr. LQ 4/4 $2,500 20 48527 Via Encanto LQ 3/2 $2,500 21 80043 Silver Sage Ln. LQ 3/3 $2,600 22 78865 Meridian Way LQ 3/2 $2,700 23 43688 Bordeaux Dr. LQ 4/3 $2,700 24 78560 Via Melodia LQ 4/3 $2,800 25 51842 Avenida Diaz LQ 3/2 $2,800 402 EXHIBIT H PUBLIC COMMENTS & RESPONSES The Plan was available to the community for public comment for a minimum of 30 days. The City of La Quinta received no comments from the community during this period. The Relocation Plan (Draft) for The Dune Palms Road Low Water Crossing Bridge Project was made available to the project displaced occupants via Certified and Regular Mail for a minimum of 30 days. The City received no comments from the displacees or the community during this period. Spanish speaking occupants were also provided advisory and translation services of the Plan during this comment period. This is the final Relocation Plan for the Dune Palms Road Low Water Crossing Bridge Project in the City of La Quinta, County of Riverside. 403 404 From:GRSC-West-Legals mbx To:Julie Mignogna Cc:Bryan McKinney; Wanda Wise-Latta Subject:RE: 0000464138 RE: LQ CC PHN DUNE PALMS BRIDGE RELOCATION PLAN Date:Wednesday, August 21, 2019 6:59:22 AM Attachments:image001.png ** EXTERNAL: This message originated outside of the City of La Quinta. Please use proper judgement and caution when opening attachments, clicking links or responding to requests for information. ** Hi Julie, I’m very sorry but there was some confusion on our part which led to this notice not being published. We had the ad approved on time but I think what happened is that we had incorrect or outdated information on the deadlines from our pagination team. When I looked up the deadlines it said I needed to have the ad ordered and approved by 3:00 pm PST on Thursday for a Friday publication, but we’ve since gotten the correct information from our pagination team and the ads need to ordered by 3:00 pm PST on Wednesdays and approved by 3:00 pm PST on Thursdays for Friday publications. I think this ad was ordered on Thursday, July 25th based on the incorrect deadline we had and because it was ordered after the deadline, it didn’t end up publishing. I’ve put in a request to credit the $462.00 off of your account for this. I saw that the ad was for a public meeting on August 6th so I’m not sure if you’d need this reran or if you need something else ran in its place now, but if you do need to run something in its place or just run the same ad, let me know and I can get something set up for you. I’m sorry once again for this inconvenience, Derek Lindberg Public Notice Representative Desert Sun | LOCALiQ PART OF THE USA TODAY NETWORK Office: 760-322-2222 option 3 legals@thedesertsun.com desertsun.com From: Julie Mignogna <jmignogna@laquintaca.gov> Sent: Thursday, July 25, 2019 1:18 PM To: GRSC-West-Legals mbx <GRSC-West-Legals@gannett.com> Cc: Bryan McKinney <Bmckinney@laquintaca.gov>; Wanda Wise-Latta <wlatta@laquintaca.gov> Subject: RE: 0000464138 RE: LQ CC PHN DUNE PALMS BRIDGE RELOCATION PLAN Thank you, Derek! Please find the attached approval of the proof. Much appreciation, Julie Julie Mignogna | Management Analyst Design and Development City of La Quinta 78495 Calle Tampico | La Quinta, CA 92253 Ph. 760.777.7041 www.laquintaca.gov www.playinlaquinta.com From: GRSC-West-Legals mbx <GRSC-West-Legals@gannett.com> Sent: Thursday, July 25, 2019 9:50 AM To: Julie Mignogna <jmignogna@laquintaca.gov> Cc: Bryan McKinney <Bmckinney@laquintaca.gov>; Wanda Wise-Latta <wlatta@laquintaca.gov> Subject: RE: 0000464138 RE: LQ CC PHN DUNE PALMS BRIDGE RELOCATION PLAN ** EXTERNAL: This message originated outside of the City of La Quinta. Please use proper judgement and caution when opening attachments, clicking links or responding to requests for information. ** ATTACHMENT 1 405 Hi Julie, Attached is a proof for your review. The total cost is $462.00. The ad is scheduled to run in the Desert Sun on July 26th. Please review the attached proof, let us know if changes or corrections are required. If we do not receive a response by 3:00 pm PST today we will run the notice as is. Thank you, Derek Lindberg Public Notice Representative Desert Sun | LOCALiQ PART OF THE USA TODAY NETWORK Office: 760-322-2222 option 3 legals@thedesertsun.com desertsun.com From: Julie Mignogna <jmignogna@laquintaca.gov> Sent: Wednesday, July 24, 2019 7:05 PM To: Email, TDS-Legals <legals@thedesertsun.com>; Email, TDS-Legals <legals@thedesertsun.com> Cc: Bryan McKinney <Bmckinney@laquintaca.gov>; Wanda Wise-Latta <wlatta@laquintaca.gov> Subject: 0000464138 RE: LQ CC PHN DUNE PALMS BRIDGE RELOCATION PLAN Good afternoon, again! We would like to publish as a 1/8 page display ad, please! Please let me know if you have any additional questions. Much appreciation, Julie Julie Mignogna | Management Analyst Design and Development City of La Quinta 78495 Calle Tampico | La Quinta, CA 92253 Ph. 760.777.7041 www.laquintaca.gov www.playinlaquinta.com From: Julie Mignogna Sent: Wednesday, July 24, 2019 5:01 PM To: Email, TDS-Legals <legals@thedesertsun.com>; legals@thedesertsun.com Cc: Bryan McKinney <Bmckinney@laquintaca.gov>; Wanda Wise-Latta <wlatta@laquintaca.gov> Subject: LQ CC PHN DUNE PALMS BRIDGE RELOCATION PLAN Good afternoon, Attached is the City of La Quinta City Council Public Hearing Notice regarding Dune Palms Road Bridge Relocation Plan. Is it possible to publish once on Friday, July 26, 2019? Could you also provide me the cost of publication? Thank you for your help! Much appreciation, Julie Julie Mignogna | Management Analyst Design and Development City of La Quinta 78495 Calle Tampico | La Quinta, CA 92253 Ph. 760.777.7041 www.laquintaca.gov 406 City of La Quinta CITY COUNCIL MEETING: September 17, 2019 STAFF REPORT AGENDA TITLE: ADOPT RESOLUTIONS DECLARING THE PUBLIC INTEREST AND NECESSITY TO ACQUIRE PORTIONS OF PROPERTIES LOCATED AT: (1) 46400 DUNE PALMS ROAD; (2) 79440 CORPORATE CENTER DRIVE; AND (3) ASSESSOR PARCEL NUMBER 600-030-018, FOR THE DUNE PALMS ROAD BRIDGE PROJECT (PROJECT NO. 2011-05/111205) THROUGH EMINENT DOMAIN RECOMMENDATION Adopt resolutions declaring that the public interest and necessity require the acquisition of portions of properties through eminent domain located on three properties: A. (1) 46400 Dune Palms Road; APN 600-030-010 (portion); Owner: Chin Family; (2) 46400 Dune Palms Road; APN 600-030-010 (Space 1 Mobile Home Coach); Owner: Yvette Ontiveros; (3) 46400 Dune Palms Road; APN 600-030-010 (Space 31 Mobile Home Coach); Owner: Hilda Bedolla; B. APN 600-030-018 (portion); Owner: DWCG1, LLC; and C. 79440 Corporate Center Drive; APN 600-390-033 (portion); Owner: James R. Paul and Sharon L. Paul, Trustees. EXECUTIVE SUMMARY • The City has been negotiating with the owners of certain real properties listed below since June 2019 to acquire the right-of-way for the Dune Palms Bridge project (Project). • The Project for which the properties are sought to be acquired entails replacing the existing low water crossing with an all-weather access bridge on Dune Palms Road at the Coachella Valley Storm Water Channel and building the adjacent roadway to its ultimate right-of-way. • The rights-of-way being sought consist of permanent roadway and public utility easements, a non-exclusive permanent slope easement, and PUBLIC HEARING ITEM NO. 2 407 temporary construction easements; two (2) mobile home units, one (1) single-family dwelling. • The City has negotiated to acquire the mobile homes and portion of commercial property through agreements; negotiations with the remaining mobile home park owner, and vacant land owner have reached an impasse. • The Project environmental documents are complete, design work is underway, and right-of-way must be cleared to secure construction funding and implement the project. FISCAL IMPACT The current Project budget is $17,510,000. The City’s appraised value for the properties to be acquired (the amount offered) is $850,274, the estimated relocation costs are $ 227,000, and the appraised value of the two coaches is $79,100; the total amount of just compensation will be determined through administrative and court proceedings. The Project costs are allocated as follows: 1) a Federal Highway Administration (FHWA) grant - 88.53% of the eligible Project costs; 2) CVAG -75% of the Project’s local share (approximately 9% of the total cost); and the City - remaining 25% of the local share (approximately 3% of the total cost). The current projected right-of-way cost is higher than originally budgeted, the City is requesting additional grant funding from FHWA for the increased project costs and from CVAG for the increased local share. BACKGROUND/ANALYSIS The City has secured funding and is designing the Project to replace the existing low water crossing with an all-weather access bridge on Dune Palms Road at the Coachella Valley Storm Water Channel, and to improve Dune Palms Road to its General Plan designated roadway width. The Project will widen Dune Palms Road to its ultimate right-of-way. The final configuration of the roadway will consist of 72 feet of street section curb-to-curb, with two 11-foot travel lanes in both directions, a 12-foot wide raised median, an 8-foot bicycle/golf cart lane along each side of the road (adjacent to the curb), and a 6-foot sidewalk. The Project requires additional right-of-way from portions of property located at 46400 Dune Palms Road, the site of Dune Palms Mobile Estates (Park); APN 600-030-018; and 79440 Corporate Center Drive. The right-of-way being sought consist of various permanent roadway and public utility easements, a non-exclusive permanent slope easement, and temporary construction easements; all as more specifically described and depicted in the exhibits to the respective resolutions. The scope of the rights proposed to be acquired under the easements is also described in detail in the proposed resolutions. Over the 408 three properties at issue, the proposed rights-of-way impacts two (2) mobile home units, Spaces 1 and 31, and one (1) single-family dwelling within the Dune Palms Mobile Home Park; portion of one (1) vacant parcel; and portion of one (1) commercial property. Negotiation efforts were undertaken with the Park owner and with each of the individual mobile unit holders, vacant land owner, and commercial property owner. Offer letters pursuant to Government code section 7267.2 went out to all such owners on or about June 10, 2019, and City representatives, including its right-of-way consultant, conducted negotiations following that written offer. The City, through its right-of-way consultant, Overland Pacific & Cutler, was successful in negotiating an acquisition for both mobile home units, and one (1) commercial property owner. Those properties are currently in escrow, and should they close, no action will be taken on them pursuant to the resolutions of necessity, and the property transfers will occur through escrow, as contemplated. On these properties, the resolution is being sought only in the event escrow complications arise. Negotiations with the mobile home Park owner and remaining vacant land owner proved less successful. Staff evaluated potential alternatives to the scope of the taking, and solicited counteroffers from the mobile home Park owner to the value of the appraisal-based offer, but in neither respect received any productive response. The passage of a resolution of necessity will not preclude further negotiations with such owner, which Staff intends to continue to pursue. Staff is now prepared to recommend the City Council go forward with implementing the Project, and is recommending that the City Council consider and adopt a resolution of necessity that authorizes the use of eminent domain to acquire the permanent street and utility easements, slope easement, and temporary construction easements at issue. A resolution of necessity is required under the Code of Civil Procedure prior to the time any public entity utilizes its power of eminent domain. Passage requires a four-fifth’s vote of the City Council. The resolution involves City Council making findings on the following matters: A. Whether the public interest and necessity require the Project; B. Whether the Project is planned or located in a manner which is most compatible with the greatest public good and the least private injury; C. Whether the property proposed to be acquired is necessary for the Project; D. Whether the offer required by Government Code § 7267.2 had been given to the owners of record; and 409 E. Whether the City had properly exercised all of its statutory responsibilities and duties antecedent to the exercise of eminent domain against the Property including review under CEQA. Staff believes appropriate facts exist for each of the proposed findings. The public interest and necessity require the Project, because the City’s General Plan Circulation Element calls for improvement of Dune Palms Road to its ultimate right-of-way width and replacement of the existing low water crossing with an all-weather access bridge on Dune Palms Road at the Coachella Valley Storm Water Channel. This all-weather crossing will make the public right-of- way less susceptible to flooding, and potential interruptions of access due to flow conditions in the channel. This Project will accomplish that within the Project boundaries. It will allow for two lanes of travel along Dune Palms Road in either direction and provide other streetscape improvements in addition to replacing the existing low water crossing with an all-weather access bridge on Dune Palms Road at the Coachella Valley Storm Water Channel. In addition to enhanced circulation along Dune Palms Road, the Project will provide bicycle/golf cart lanes along each side of the road, encouraging these alternate modes of energy-efficient transportation, and will also provide a 6- foot sidewalk. The Project will result in the least private injury because the right-of-way takings proposed are limited to the installation of the all-weather bridge and roadway widening project boundaries, which will minimize potential impacts to mobile home owners and residents. The scope of the temporary construction easements has been restricted to define reserved uses for the owners to minimize disruptions, and to limit the City’s uses to activities necessary or beneficial to Project construction. The Project also calls for enhancement of a number of streetscape features along the frontage of 46400 Dune Palms road, and will include new curb, gutter, underground utilities, and new street landscaping and irrigation. The property proposed to be acquired is necessary for the Project because the bridge and roadway widening aspects of the Project must of necessity occupy land immediately adjacent to the prior existing right-of-way, and the channel to be bridged. In this instance, the roadway on the northwest side of the channel has already been configured to its ultimate right-of-way, in connection with the construction of the adjacent high school, by the local school district. The roadway on the southwest side of the channel has been configured to its ultimate right-of-way, in connection with construction of a commercial development. Therefore, the right-of-way need only be widened on the east side of the roadway. In addition, during construction, a bypass road on the east side of the channel will be installed to allow the roadway to remain open to traffic while the bridge is being constructed. 410 The Project has been reviewed under the California Environment Quality Act, and a Mitigated Negative Declaration, EA 2017-0013, and was approved on February 14, 2018. The limitations period for any direct legal challenge to that mitigated negative declaration has passed. In addition, City staff has identified no substantial changes to the proposed Project since that time, no substantial changes with respect to the circumstances under which the Project is proposed to be undertaken, nor any new information of substantial importance indicating any new significant effects, additional severity of previously identified effects, or new or newly-feasible mitigation measures which might substantially reduce identified significant effects since that time, which would require major revisions of the negative declaration. As such, City staff recommends that the City Council find that the previous mitigated negative declaration adequately analyzes the Project, including the property acquisition proposed through this resolution of necessity. The owner has an opportunity to address the City Council regarding all of the findings proposed under the resolution of necessity, the CEQA finding, and the potential acquisition of the property by eminent domain in general. Mailed notice of tonight’s resolution of necessity hearing was provided to all owners on August 16, 2019. That notice indicated that the City Council will hold a public hearing for the resolution of necessity on September 17, 2019. As of the time of this writing, correspondence regarding the proposed resolution was received by the City from the DWCG1, LLC and mobile home Park owners, dated August 28th and 30th, 2019 respectively; and will be added to the record of proceedings on the resolution. The DWCG1, LLC letter requested to reserve the right to be heard during the public hearing. The mobile home Park owner letter objected to the environmental review, and raised objections based on access and circuity of travel, as well as potential noise and dust impacts form closer lanes of travel. The letter also makes objections to the City’s offer. The City believes that any impairment of access to the affected properties falls below a level of substantial impairment of access necessary to trigger actionable damages, and provides improvements to the existing property’s driveway access. Further, the City believes there are no new impacts or mitigation measures, or changes in the underlying circumstances under which the Project is being pursued, that would trigger the need for additional environmental review. The City’s pre-condemnation offer was accompanied by an appraisal summary statement indicating the basis for the appraisal judgments upon which the offer was based. To the extent the 46-400 Dune Palms owners are dissatisfied with the amount of the offer, such issues are not implicated in a resolution of necessity, and in any event, the City attempted to solicit the owner’s position on value or where it felt the City’s appraisal was lacking through the negotiation process, but the owner declined to provide any input. 411 ALTERNATIVES 1. Consider redesign of the Project to modify or eliminate the areas of proposed taking, or restrict currently planned public improvements from the Project. 2. Defer any decision on use of eminent domain to acquire the property interests identified, and direct staff to continue negotiating with owners who to date have not been responsive. 3. Decide not to implement the Project; thereby eliminating the need for right of way acquisitions. Prepared by: William H. Ihrke, City Attorney Approved by: Jon McMillen, City Manager 412 RESOLUTION NO. 2019 – xxx A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF LA QUINTA, CALIFORNIA, DECLARING THE PUBLIC INTEREST AND NECESSITY TO ACQUIRE PORTIONS OF PROPERTY LOCATED AT 46400 DUNE PALMS ROAD, AND APPROVING AND ADOPTING A RESOLUTION OF NECESSITY PROJECT NO. 2011-05 / 111205 APN: 600-030-010 WHEREAS, the City of La Quinta, has been investigating the acquisition of portions of property located at 46400 Dune Palms Road for the purposes of making public roadway improvements pursuant to the circulation element of the General Plan of the City of La Quinta; and WHEREAS, on September 17, 2019, after no less than fifteen (15) days written notice to the owners of the Property referenced above, and more specifically described in the legal descriptions and plat maps attached hereto as Exhibit 1, Exhibit 2, Exhibit 3, and Exhibit 4, which legal descriptions and plat maps are incorporated herein by reference (“Property”), the City Council of the City of La Quinta held a hearing for the purposes of allowing the record owners and occupants of such property reasonable opportunity to appear and be heard regarding the City's identification of the “Project” as the Dune Palms Bridge Project (“Project”), and on the following matters: A. Whether the public interest and necessity require the project; B. Whether the Project is planned or located in a manner which is most compatible with the greatest public good and the least private injury; C. Whether the Property proposed to be acquired is necessary for the Project; D. Whether the offer required by Government Code § 7267.2 had been given to the owners of record; and E. Whether the City had properly exercised all of its statutory responsibilities and duties antecedent to the exercise of eminent domain against the Property including environmental review under NEPA and CEQA; and WHEREAS, the City Council, as a result of such hearing, has determined that the public health, safety and welfare require that the City acquire the 413 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; 46400 Dune Palms Rd Adopted: September XX, 2019 Page 2 of 7 Property more particularly described herein for the purposes of the Project; and WHEREAS, the Project for which the Property to be acquired is sought has previously been reviewed under applicable environmental review procedures, including the Mitigated Negative Declaration (“MND”), EA 2017- 0013, approved on February 14, 2018, in accordance with the California Environmental Quality Act (“CEQA”) and a National Environmental Policy Act (“NEPA”) Categorical Exclusion, approved by the Federal Highway Administration (“FHWA”) on January 17, 2018; and WHEREAS, the City of La Quinta is authorized to acquire the Property under authority of its own charter, and Government Code §§ 37350.5 and 40404. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of La Quinta, California, that the City Council does hereby find, determine and declare upon evidence presented to the City Council as follows: SECTION 1. The Project for which the Property is being acquired is the Dune Palms Bridge Project, a project to replace the existing low water crossing with an all-weather access bridge on Dune Palms Road at the Coachella Valley Storm Water Channel, and to improve Dune Palms Road to its General Plan designated roadway width. The Project will widen Dune Palms Road to its ultimate right-of-way. The final configuration of the roadway will consist of 72 feet of street section curb-to-curb, with two 11-foot travel lanes in both directions, a 12-foot wide raised median, an 8-foot bicycle/golf cart lane along each side of the road (adjacent to the curb), and a 6-foot sidewalk to allow for two lanes of travel along Dune Palms Road in either direction and provide other streetscape improvements. SECTION 2. The Property to be acquired is located within the City at 46400 Dune Palms Road (Assessor Parcel No. 600-030-010). The Property interest the City seeks to consists of: A. A permanent easement for street and public utility purposes over some approximately 3,040 square feet, as more specifically described in Exhibit 1 hereto, and depicted in Exhibit 2 hereto, which easement shall consist of the following: A perpetual exclusive easement for public right of way, street, drainage, pedestrian and utility purposes, including all use of the Easement Area for purposes incident to public right-of-way use, including but not limited to the construction, maintenance, and operation of a roadway, or other transportation facilities, underground and above ground utilities and appurtenances, cable communication 414 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; 46400 Dune Palms Rd Adopted: September XX, 2019 Page 3 of 7 or telecommunication facilities; directional, street identification, or roadway informational signage; traffic control devices; curbs; gutters; sidewalks; drainage and sewage facilities; and transportation facilities such as bus bays, benches, bus or train stops, bicycle pathways, or facilities for railway or other public transportation vehicles or manners of conveyance. B. A temporary construction easement over approximately 13,508 square feet, as more specifically described in Exhibit 3 hereto, and depicted in Exhibit 4 hereto, which easement shall consist of the following: The temporary construction is a nonexclusive easement which permits City of La Quinta, its officers, agents, employees, and contractors, to enter upon, occupy, and pass over the temporary construction easement area more specifically described in the legal description, attached as Exhibit C and Exhibit D, from adjacent public rights of way, as reasonably necessary for purposes incidental to the construction of the Project in the manner proposed. The temporary construction easement shall include the right to perform within the temporary construction easement area, all such necessary activities which are reasonably incidental to the construction work being performed on said property in connection with the Project in the manner proposed, including any necessary excavation; grading; earth fill; compaction; slough or perimeter wall construction; installation of concrete forms; landscaping; irrigation, utility, and sign relocation; accommodation of private drainage facilities; and deposit of tools, equipment, and material. Such incidental activities shall include, but not be limited to, utilizing the temporary construction easement area for adjusting grade differentials between the street and the adjoining real property, and/or matching existing concrete and/or asphalt paved areas, and/or natural grade areas, or such work as may pertain to on-site improvements by the City of La Quinta to render the temporary construction easement area in the same functional condition as reasonably practicable to the condition before the Project in terms of access, irrigation, and relation of public right of way improvements to the larger parcel. The temporary construction easement shall not include the right to store any materials or park any vehicles which are not incidental to the work to be performed on site in connection with the Project, nor to block all vehicular access to the larger parcel of property of which the temporary construction easement area is a part, nor exercise the uses of the easement outside of the temporary 415 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; 46400 Dune Palms Rd Adopted: September XX, 2019 Page 4 of 7 construction easement area, nor to exclude the owner or occupant of the larger parcel from the temporary construction easement area, except as reasonably necessary under standard public works construction safety practices, to ensure public safety. In connection with the exercise of the temporary construction easement rights hereunder, and except as otherwise shown in the approved plans for the Project, City shall protect all structures on the temporary construction easement area in place, and shall protect or restore all improvements thereon. The rights granted hereunder shall commence the date the Project right of way is certified and shall continue in full force and effect until written notice to the owner of record that the temporary construction easement is no longer needed by the City, or forty- eight (48) months after notice of the initiation of the temporary construction easement, whichever is earlier. In no event shall the temporary construction easement remain in effect after December 31, 2025. Upon termination of the temporary construction easement, the temporary construction easement area shall be restored to a condition that is as functionally equivalent as is practicable to its condition prior to the commencement of the work, consistent with the Project as designed and as to be construed in the manner proposed. City shall in the exercise of its non-exclusive rights under this Temporary Construction Easement not unreasonably interfere with pedestrian or vehicular access to the larger parcel of which the Property is a part. C. The mobile home and single-family residence improvements, and appurtenant improvements, to Space 1 and Space 31 of 46400 Dune Palms Road. SECTION 3. The public interest and necessity require the Project, in that the City's General Plan, and specifically the Circulation Element, calls for the improvement of Dune Palms Road in the manner contemplated by the Project. The Project is designed to relieve regional traffic congestion and improve the ability of traffic to navigate over areas prone to flooding, which will enhance the traffic handling capacity of the streets. SECTION 4. The Project is located in a manner most compatible with the greatest public good and least private injury, in that the design of the roadway widening must of necessity occupy land which is immediately adjacent to the existing roadway, in order to maintain the continuity of the alignment of the 416 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; 46400 Dune Palms Rd Adopted: September XX, 2019 Page 5 of 7 road for all users. The Project is designed in a manner compatible with the greatest public good, in that the Project will involve improvements to allow for two lanes of travel along Dune Palms Road in either direction, and provide other streetscape improvements, in addition to constructing a low water crossing over the Whitewater River at Dune Palms Road. In addition to enhanced circulation along Dune Palms Road, the Project will provide bicycle/golf cart lanes along each side of the road, encouraging these alternate modes of energy-efficient transportation, and will also provide a 6-foot sidewalk. This will enhance the utility of the area and help improve traffic circulation. The Project is designed in a manner compatible with the least private injury in that the acquisition has been limited to the Project boundaries, so as to minimize disruption to private property. The scope of the temporary construction easements has been restricted to define reserved uses for the owners to minimize disruptions, and to limit the City’s uses to activities necessary or beneficial to Project construction. The Project provides streetscape upgrades along the remaining property's frontage, including a new block wall, new landscape and irrigation, relocation and undergrounding of existing utilities, and improved driveway access. SECTION 5. The Property is necessary for the proposed Project, in that the bridge must of necessity be constructed on property immediately adjacent to the existing flood channel, and the roadway improvements must occur adjacent to the existing roadway, to maintain continuity. SECTION 6. The offer required by Government Code § 7267.2 has been made to the record owners, by way of letter dated June 10, 2019. In addition, on the same date offer letters were sent to the owners of the individual coaches included within the area of the proposed easement. Staff has attempted to negotiate with the record owners subsequent to this offer, but such negotiations have not proved successful in finally securing all the necessary property interests required for the Project, outside of more formal proceedings. SECTION 7. To the extent any of the property to be taken herein is devoted to a public use, the City finds that the proposed use for the Project is compatible with, or more necessary to, such public use, and that the City is authorized to acquire the Property pursuant to Code of Civil Procedure§§ 1240.510 and 1240.610. SECTION 8. The Project has been reviewed and approved under the Mitigated Negative Declaration, EA 2017-0013, approved on February 14, 2018. The Project was the subject of a Categorical Exclusion approved by the FHWA on January 17, 2018. The City Council finds and determines that since the time of the adoption of that MND, there have been no subsequent changes with 417 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; 46400 Dune Palms Rd Adopted: September XX, 2019 Page 6 of 7 respect to the circumstances under which the Project is to be undertaken, no new information of substantial importance regarding significant effects or mitigation measures or alternative which has become available, and no subsequent changes have been proposed in the Project which would require important revisions to the MND such that no further environmental review attending this proposed acquisition is necessary. SECTION 9. The law firm of Rutan & Tucker, LLP, which serves as the Office of the City Attorney for the City of La Quinta, is hereby authorized to prepare and prosecute in the name of the City, such special proceedings in the proper court having jurisdiction thereof, as are necessary for acquisition of the Property described herein, to prepare and file such pleadings, documents, and otherwise prosecute such actions as may be necessary in the opinion of such attorneys to acquire for the City the Property. Such attorneys are specifically authorized to take whatever steps and/or procedures are available to them under the Eminent Domain Law of the State of California, including, but not limited to, seeking orders for prejudgment possession of the property. The City Attorney is authorized to assign any work in such action to other attorneys as the City Attorney may deem appropriate, and in the event it is possible to settle and compromise such proceedings, the City Attorney may take all actions necessary to complete the acquisition, including preparing and filing stipulations as to judgment, final orders of condemnation, and arranging for the deposit or other payment of just compensation as may be agreed to. PASSED, APPROVED, and ADOPTED at a regular meeting of the La Quinta City Council held on this ___ day of September, 2019 by the following vote: AYES: NOES: ABSENT: ABSTAIN: _____________________________ LINDA EVANS, Mayor City of La Quinta, California 418 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; 46400 Dune Palms Rd Adopted: September XX, 2019 Page 7 of 7 ATTEST: __________________________ MONIKA RADEVA, City Clerk City of La Quinta, California (CITY SEAL) APPROVED AS TO FORM: ___________________________ WILLIAM H. IHRKE, City Attorney City of La Quinta, California 419 RESOLUTION NO. 2019-XXX EXHIBIT 1 420 RESOLUTION NO. 2019-XXX EXHIBIT 2 421 RESOLUTION NO. 2019-XXX EXHIBIT 3 422 RESOLUTION NO. 2019-XXX EXHIBIT 3 423 RESOLUTION NO. 2019-XXX EXHIBIT 4 424 RESOLUTION NO. 2019 – xxx A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF LA QUINTA, CALIFORNIA, DECLARING THE PUBLIC INTEREST AND NECESSITY TO ACQUIRE PORTIONS OF PROPERTY LOCATED ON DUNE PALMS ROAD, ASSESSOR PARCEL NO. 600-030-018, AND APPROVING AND ADOPTING A RESOLUTION OF NECESSITY PROJECT NO. 2011-05 / 111205 APN: 600-030-018 WHEREAS, the City of La Quinta, has been investigating the acquisition of portions of property located at 46-400 Dune Palms Road for the purposes of making public roadway improvements pursuant to the circulation element of the General Plan of the City of La Quinta; and WHEREAS, on September 17, 2019, after no less than fifteen (15) days written notice to the owners of the Property referenced above, and more specifically described in the legal descriptions and plat maps attached hereto as Exhibits 1-6, which legal descriptions and plat maps are incorporated herein by reference (“Property”), the City Council of the City of La Quinta held a hearing for the purposes of allowing the record owners and occupants of such property reasonable opportunity to appear and be heard regarding the City's identification of the “Project” as the Dune Palms Bridge Project (“Project”), and on the following matters: A. Whether the public interest and necessity require the project; B. Whether the Project is planned or located in a manner which is most compatible with the greatest public good and the least private injury; C. Whether the Property proposed to be acquired is necessary for the Project; D. Whether the offer required by Government Code § 7267.2 had been given to the owners of record; and E. Whether the City had properly exercised all of its statutory responsibilities and duties antecedent to the exercise of eminent domain against the Property including environmental review under NEPA and CEQA; and WHEREAS, the City Council, as a result of such hearing, has determined that the public health, safety and welfare require that the City acquire the 425 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; APN: 600-030-018 Adopted: September XX, 2019 Page 2 of 8 Property more particularly described herein for the purposes of the Project; and WHEREAS, the Project for which the Property to be acquired is sought has previously been reviewed under applicable environmental review procedures, including the Mitigated Negative Declaration (“MND”), EA 2017- 0013, approved on February 14, 2018, in accordance with the California Environmental Quality Act (“CEQA”) and a National Environmental Policy Act (“NEPA”) Categorical Exclusion, approved by the Federal Highway Administration (“FHWA”) on January 17, 2018; and WHEREAS, the City of La Quinta is authorized to acquire the Property under authority of its own charter, and Government Code§§ 37350.5 and 40404. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of La Quinta, California, that the City Council does hereby find, determine and declare upon evidence presented to the City Council as follows: SECTION 1. The project for which the property is being acquired is the Dune Palms Bridge Project, a project to replace the existing low water crossing with an all-weather access bridge on Dune Palms Road at the Coachella Valley Storm Water Channel, and to improve Dune Palms Road to its General Plan designated roadway width. The Project will widen Dune Palms Road to its ultimate right-of-way. The final configuration of the roadway will consist of 72 feet of street section curb-to-curb, with two 11-foot travel lanes in both directions, a 12-foot wide raised median, an 8-foot bicycle/golf cart lane along each side of the road (adjacent to the curb), and a 6-foot sidewalk to allow for two lanes of travel along Dune Palms Road in either direction and provide other streetscape improvements. SECTION 2. The Property to be acquired is located within the City at Dune Palms Road and bears Assessor Parcel No. 600-030-018. The Property interest the City seeks to consists of: (1) a permanent roadway and public utilities easement over approximately 9,926 square feet, as more specifically described in Exhibit 1 hereto, and depicted in Exhibit 2 hereto, as follows: A perpetual exclusive easement for public right-of-way, street, drainage, pedestrian and utility purposes, including all use of the permanent roadway and public utilities easement area for purposes incident to public right-of-way use, including but not 426 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; APN: 600-030-018 Adopted: September XX, 2019 Page 3 of 8 limited to the construction, maintenance, and operation of a roadway, or other transportation facilities, underground and above ground utilities and appurtenances, cable communication or telecommunication facilities; directional, street identification, or roadway informational signage; traffic control devices; curbs; gutters; sidewalks; drainage and sewage facilities; and transportation facilities such as bus bays, benches, bus or train stops, bicycle pathways, or facilities for railway or other public transportation vehicles or manners of conveyance. (2) a non-exclusive permanent slope easement over approximately 2,848 square feet of the property, more specifically described in Exhibit 3, and depicted in Exhibit 4 hereto, as follows: The slope easement is a permanent, nonexclusive easement allowing the holder thereof to place, maintain, landscape, irrigate, grade, protect, and utilize slopes on and over the property more specifically described and depicted in Exhibit 3 and 4 hereto (“slope easement area”), for the purposes of providing and maintaining lateral and subjacent support of bridge, roadway, and related improvements to be constructed consistent with the approved construction plans for the Dune Palms Bridge Project (“Project’). The holder of the slope easement shall access the slope easement area only from adjacent public rights of way, shall limit all construction, maintenance, or grading activity to the slope easement area, and except in cases of emergency posing an immediate threat to public health and safety, shall provide not less than seventy two (72) hours’ notice to the owner of the underlying property of any entry for any construction, maintenance, or grading activity on the slope easement area. (3) a temporary construction easement over approximately 1,536 square feet of the property, more specifically described in Exhibit 5, and depicted in Exhibit 6 hereto (“Property”), as follows: The temporary construction is a nonexclusive easement which permits City of La Quinta, its officers, agents, employees, and contractors, to enter upon, occupy, and pass over the temporary construction easement area more specifically described in the legal description, attached as Exhibit 5 and Exhibit 6, from adjacent public rights of way, as reasonably necessary for purposes incidental to the construction of the Project in the manner proposed. The temporary construction easement shall 427 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; APN: 600-030-018 Adopted: September XX, 2019 Page 4 of 8 include the right to perform within the temporary construction easement area, all such necessary activities which are reasonably incidental to the construction work being performed on said property in connection with the Project in the manner proposed, including any necessary excavation; grading; earth fill; compaction; slough or perimeter wall construction; installation of concrete forms; landscaping; irrigation, utility, and sign relocation; accommodation of private drainage facilities; and deposit of tools, equipment, and material. Such incidental activities shall include, but not be limited to, utilizing the temporary construction easement area for adjusting grade differentials between the street and the adjoining real property, and/or matching existing concrete and/or asphalt paved areas, and/or natural grade areas, or such work as may pertain to on-site improvements by the City of La Quinta to render the temporary construction easement area in the same functional condition as reasonably practicable to the condition before the Project in terms of access, irrigation, and relation of public right- of-way improvements to the larger parcel. The temporary construction easement shall not include the right to store any materials or park any vehicles which are not incidental to the work to be performed on site in connection with the Project, nor to block all vehicular access to the larger parcel of property of which the temporary construction easement area is a part, nor exercise the uses of the easement outside of the temporary construction easement area, nor to exclude the owner or occupant of the larger parcel from the temporary construction easement area, except as reasonably necessary under standard public works construction safety practices, to ensure public safety. In connection with the exercise of the temporary construction easement rights hereunder, and except as otherwise shown in the approved plans for the Project, City shall protect all structures on the temporary construction easement area in place, and shall protect or restore all improvements thereon. The rights granted hereunder shall commence on the date the Project right-of-way is certified and shall continue in full force and effect until written notice to the owner of record that the temporary construction easement is no longer needed by the City, or forty eight (48) months after notice of the initiation of the temporary construction easement, whichever is earlier. In no 428 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; APN: 600-030-018 Adopted: September XX, 2019 Page 5 of 8 event shall the temporary construction easement remain in effect after December 31, 2025. Upon termination of the temporary construction easement, the temporary construction easement area shall be restored to a condition that is as functionally equivalent as is practicable to its condition prior to the commencement of the work, consistent with the Project as designed and as to be construed in the manner proposed. City shall in the exercise of its non-exclusive rights under this Temporary Construction Easement not unreasonably interfere with pedestrian or vehicular access to the larger parcel of which the Property is a part. A permanent easement for street and public utility purposes over some approximately 3,040 square feet, as more specifically described in Exhibit A hereto, and in Exhibit B hereto, which easement shall consist of the following: A perpetual exclusive easement for public right-of-way, street, drainage, pedestrian and utility purposes, including all use of the Easement Area for purposes incident to public right-of-way use, including but not limited to the construction, maintenance, and operation of a roadway, or other transportation facilities, underground and above ground utilities and appurtenances, cable communication or telecommunication facilities; directional, street identification, or roadway informational signage; traffic control devices; curbs; gutters; sidewalks; drainage and sewage facilities; and transportation facilities such as bus bays, benches, bus or train stops, bicycle pathways, or facilities for railway or other public transportation vehicles or manners of conveyance. The permanent roadway easement, slope easement, and temporary construction easement are referred to collectively as the “Property.” SECTION 3. The public interest and necessity require the Project, in that the City's General Plan, and specifically the Circulation Element, calls for the improvement of Dune Palms Road in the manner contemplated by the Project. The Project is designed to relieve regional traffic congestion and improve the ability of traffic to navigate over areas prone to flooding, which will enhance the traffic handling capacity of the streets. SECTION 4. The Project is located in a manner most compatible with the greatest public good and least private injury, in that the design of the roadway widening must of necessity occupy land which is immediately adjacent to the 429 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; APN: 600-030-018 Adopted: September XX, 2019 Page 6 of 8 existing roadway, in order to maintain the continuity of the alignment of the road for all users. The Project is designed in a manner compatible with the greatest public good, in that the Project will involve improvements to allow for two lanes of travel along Dune Palms Road in either direction, and provide other streetscape improvements, in addition to constructing a low water crossing over the Whitewater River at Dune Palms Road. In addition to enhanced circulation along Dune Palms Road, the Project will provide bicycle/golf cart lanes along each side of the road, encouraging these alternate modes of energy-efficient transportation, and will also provide a 6-foot sidewalk. This will enhance the utility of the area and help improve traffic circulation. The Project is designed in a manner compatible with the least private injury in that the acquisition has been limited to the Project boundaries, so as to minimize disruption to private property. The scope of the temporary construction easements has been restricted to define reserved uses for the owners to minimize disruptions, and to limit the City’s uses to activities necessary or beneficial to Project construction. SECTION 5. The Property is necessary for the proposed Project, in that the bridge must of necessity be constructed on property immediately adjacent to the existing flood channel, and the roadway improvements must occur adjacent to the existing roadway, to maintain continuity. SECTION 6. The offer required by Government Code§ 7267.2 has been made to the record owners, by way of letter dated June 10, 2019. Staff has attempted to negotiate with the record owners subsequent to this offer, but such negotiations have not proved successful in securing all the necessary property interests required for the Project, outside of more formal proceedings. SECTION 7. To the extent any of the property to be taken herein is devoted to a public use, the City finds that the proposed use for the Project is compatible with, or more necessary to, such public use, and that the City is authorized to acquire the Property pursuant to Code of Civil Procedure§§ 1240.510 and 1240.610. SECTION 8. The Project has been reviewed and approved under the Mitigated Negative Declaration, EA 2017-0013, approved on February 14, 2018. The Project was the subject of a Categorical Exclusion approved by the FHWA on January 17, 2018. The City Council finds and determines that since the time of the adoption of that MND, there have been no subsequent changes with respect to the circumstances under which the Project is to be undertaken, no new information of substantial importance regarding significant effects or mitigation measures or alternative which has become available, and no 430 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; APN: 600-030-018 Adopted: September XX, 2019 Page 7 of 8 subsequent changes have been proposed in the Project which would require important revisions to the MND such that no further environmental review attending this proposed acquisition is necessary. SECTION 9. The law firm of Rutan & Tucker, LLP, which serves as the Office of the City Attorney for the City of La Quinta, is hereby authorized to prepare and prosecute in the name of the City, such special proceedings in the proper court having jurisdiction thereof, as are necessary for acquisition of the Property described herein, to prepare and file such pleadings, documents, and otherwise prosecute such actions as may be necessary in the opinion of such attorneys to acquire for the City the Property. Such attorneys are specifically authorized to take whatever steps and/or procedures are available to them under the Eminent Domain Law of the State of California, including, but not limited to, seeking orders for prejudgment possession of the property. The City Attorney is authorized to assign any work in such action to other attorneys as the City Attorney may deem appropriate, and in the event it is possible to settle and compromise such proceedings, the City Attorney may take all actions necessary to complete the acquisition, including preparing and filing stipulations as to judgment, final orders of condemnation, and arranging for the deposit or other payment of just compensation as may be agreed to. PASSED, APPROVED, and ADOPTED at a regular meeting of the La Quinta City Council held on this ___ day of September, 2019 by the following vote: AYES: NOES: ABSENT: ABSTAIN: _____________________________ LINDA EVANS, Mayor City of La Quinta, California 431 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; APN: 600-030-018 Adopted: September XX, 2019 Page 8 of 8 ATTEST: __________________________ MONIKA RADEVA, City Clerk City of La Quinta, California (CITY SEAL) APPROVED AS TO FORM: ___________________________ WILLIAM H. IHRKE, City Attorney City of La Quinta, California 432 RESOLUTION NO. 2019-XXX EXHIBIT 1 433 RESOLUTION NO. 2019-XXX EXHIBIT 1 434 RESOLUTION NO. 2019-XXX EXHIBIT 2 435 RESOLUTION NO. 2019-XXX EXHIBIT 3 436 RESOLUTION NO. 2019-XXX EXHIBIT 3 437 RESOLUTION NO. 2019-XXX EXHIBIT 4 438 RESOLUTION NO. 2019-XXX EXHIBIT 5 439 RESOLUTION NO. 2019-XXX EXHIBIT 5 440 RESOLUTION NO. 2019-XXX EXHIBIT 6 441 442 RESOLUTION NO. 2019 – xxx A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF LA QUINTA, CALIFORNIA, DECLARING THE PUBLIC INTEREST AND NECESSITY TO ACQUIRE PORTIONS OF PROPERTY LOCATED AT 79440 CORPORATE CENTER DRIVE, ASSESSOR PARCEL NO. 600-390-033, AND APPROVING AND ADOPTING A RESOLUTION OF NECESSITY PROJECT NO. 2011-05 / 111205 APN: 600-390-033 WHEREAS, the City of La Quinta, has been investigating the acquisition of portions of property located at 79440 Corporate Center Drive for the purposes of making public roadway improvements pursuant to the circulation element of the General Plan of the City of La Quinta; and WHEREAS, on September 17, 2019, after no less than fifteen (15) days written notice to the owners of the Property referenced above, and more specifically described in the legal descriptions and plat maps attached hereto as Exhibits 1-2, which legal descriptions and plat maps are incorporated herein by reference (“Property”), the City Council of the City of La Quinta held a hearing for the purposes of allowing the record owners and occupants of such property reasonable opportunity to appear and be heard regarding the City's identification of the “Project” as the Dune Palms Bridge Project (“Project”), and on the following matters: A. Whether the public interest and necessity require the project; B. Whether the Project is planned or located in a manner which is most compatible with the greatest public good and the least private injury; C. Whether the Property proposed to be acquired is necessary for the Project; D. Whether the offer required by Government Code § 7267.2 had been given to the owners of record; and E. Whether the City had properly exercised all of its statutory responsibilities and duties antecedent to the exercise of eminent domain against the Property including environmental review under NEPA and CEQA; and 443 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; 79440 Corporate Center Drive Adopted: September XX, 2019 Page 2 of 5 WHEREAS, the City Council, as a result of such hearing, has determined that the public health, safety and welfare require that the City acquire the Property more particularly described herein for the purposes of the Project; and WHEREAS, the Project for which the Property to be acquired is sought has previously been reviewed under applicable environmental review procedures, including the Mitigated Negative Declaration (“MND”), EA 2017- 0013, approved on February 14, 2018, in accordance with the California Environmental Quality Act (“CEQA”) and a National Environmental Policy Act (“NEPA”) Categorical Exclusion, approved by the Federal Highway Administration (“FHWA”) on January 17, 2018; and WHEREAS, the City of La Quinta is authorized to acquire the Property under authority of its own charter, and Government Code§§ 37350.5 and 40404. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of La Quinta, California, that the City Council does hereby find, determine and declare upon evidence presented to the City Council as follows: SECTION 1. The project for which the property is being acquired is the Dune Palms Bridge Project, a project to replace the existing low water crossing with an all-weather access bridge on Dune Palms Road at the Coachella Valley Storm Water Channel, and to improve Dune Palms Road to its General Plan designated roadway width. The Project will widen Dune Palms Road to its ultimate right-of-way. The final configuration of the roadway will consist of 72 feet of street section curb-to-curb, with two 11-foot travel lanes in both directions, a 12-foot wide raised median, an 8-foot bicycle/golf cart lane along each side of the road (adjacent to the curb), and a 6-foot sidewalk to allow for two lanes of travel along Dune Palms Road in either direction and provide other streetscape improvements. SECTION 2. The Property to be acquired is located within the City at 79440 Corporate Center Drive and bears Assessor Parcel No. 600-390-033. The Property interest the City seeks to consists of a non-exclusive permanent slope easement over approximately 1,947 square feet of the property, more specifically described in Exhibit 1, and depicted in Exhibit 2 hereto, as follows: The slope easement is a permanent, nonexclusive easement allowing the holder thereof to place, maintain, landscape, irrigate, grade, protect, and utilize slopes on and over the property more 444 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; 79440 Corporate Center Drive Adopted: September XX, 2019 Page 3 of 5 specifically described and depicted in Exhibit 3 and 4 hereto (“slope easement area”), for the purposes of providing and maintaining lateral and subjacent support of bridge, roadway, and related improvements to be constructed consistent with the approved construction plans for the Dune Palms Bridge Project (“Project’). The holder of the slope easement shall access the slope easement area only from adjacent public rights of way, shall limit all construction, maintenance, or grading activity to the slope easement area, and except in cases of emergency posing an immediate threat to public health and safety, shall provide not less than seventy two (72) hours’ notice to the owner of the underlying property of any entry for any construction, maintenance, or grading activity on the slope easement area. The permanent slope easement, is referred to as the “Property.” SECTION 3. The public interest and necessity require the Project, in that the City's General Plan, and specifically the Circulation Element, calls for the improvement of Dune Palms Road in the manner contemplated by the Project. The Project is designed to relieve regional traffic congestion and improve the ability of traffic to navigate over areas prone to flooding, which will enhance the traffic handling capacity of the streets. SECTION 4. The Project is located in a manner most compatible with the greatest public good and least private injury, in that the design of the roadway widening must of necessity occupy land which is immediately adjacent to the existing roadway, in order to maintain the continuity of the alignment of the road for all users. The Project is designed in a manner compatible with the greatest public good, in that the Project will involve improvements to allow for two lanes of travel along Dune Palms Road in either direction, and provide other streetscape improvements, in addition to constructing a low water crossing over the Whitewater River at Dune Palms Road. In addition to enhanced circulation along Dune Palms Road, the Project will provide bicycle/golf cart lanes along each side of the road, encouraging these alternate modes of energy-efficient transportation, and will also provide a 6-foot sidewalk. This will enhance the utility of the area and help improve traffic circulation. The Project is designed in a manner compatible with the least private injury in that the acquisition has been limited to the Project boundaries, so as to minimize disruption to private property. SECTION 5. The Property is necessary for the proposed Project, in that the bridge must of necessity be constructed on property immediately adjacent to 445 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; 79440 Corporate Center Drive Adopted: September XX, 2019 Page 4 of 5 the existing flood channel, and the roadway improvements must occur adjacent to the existing roadway, to maintain continuity. SECTION 6. The offer required by Government Code§ 7267.2 has been made to the record owners, by way of letter dated June 10, 2019. Staff has attempted to negotiate with the record owners subsequent to this offer, but such negotiations have not proved successful in securing all the necessary property interests required for the Project, outside of more formal proceedings. SECTION 7. To the extent any of the property to be taken herein is devoted to a public use, the City finds that the proposed use for the Project is compatible with, or more necessary to, such public use, and that the City is authorized to acquire the Property pursuant to Code of Civil Procedure§§ 1240.510 and 1240.610. SECTION 8. The Project has been reviewed and approved under the Mitigated Negative Declaration, EA 2017-0013, approved on February 14, 2018. The Project was the subject of a Categorical Exclusion approved by the FHWA on January 17, 2018. The City Council finds and determines that since the time of the adoption of that MND, there have been no subsequent changes with respect to the circumstances under which the Project is to be undertaken, no new information of substantial importance regarding significant effects or mitigation measures or alternative which has become available, and no subsequent changes have been proposed in the Project which would require important revisions to the MND such that no further environmental review attending this proposed acquisition is necessary. SECTION 9. The law firm of Rutan & Tucker, LLP, which serves as the Office of the City Attorney for the City of La Quinta, is hereby authorized to prepare and prosecute in the name of the City, such special proceedings in the proper court having jurisdiction thereof, as are necessary for acquisition of the Property described herein, to prepare and file such pleadings, documents, and otherwise prosecute such actions as may be necessary in the opinion of such attorneys to acquire for the City the Property. Such attorneys are specifically authorized to take whatever steps and/or procedures are available to them under the Eminent Domain Law of the State of California, including, but not limited to, seeking orders for prejudgment possession of the property. The City Attorney is authorized to assign any work in such action to other attorneys as the City Attorney may deem appropriate, and in the event it is possible to settle and compromise such proceedings, the City Attorney may take all actions necessary to complete the acquisition, including preparing and filing 446 Resolution No. 2019-XXX Dune Palms Bridge Project – Resolution of Necessity; 79440 Corporate Center Drive Adopted: September XX, 2019 Page 5 of 5 stipulations as to judgment, final orders of condemnation, and arranging for the deposit or other payment of just compensation as may be agreed to. PASSED, APPROVED, and ADOPTED at a regular meeting of the La Quinta City Council held on this ___ day of September, 2019 by the following vote: AYES: NOES: ABSENT: ABSTAIN: _____________________________ LINDA EVANS, Mayor City of La Quinta, California ATTEST: __________________________ MONIKA RADEVA, City Clerk City of La Quinta, California (CITY SEAL) APPROVED AS TO FORM: ___________________________ WILLIAM H. IHRKE, City Attorney City of La Quinta, California 447 RESOLUTION NO. 2019-XXX EXHIBIT 1 448 RESOLUTION NO. 2019-XXX EXHIBIT 2 449 450 D E S I G N A N D D E V E L O P M E N T D E P A R T M E N T R E P O R T -   J U L Y   2 0 1 9 J U L Y 2 0 1 9 R E P O R T T H E D E S I G N A N D D E V E L O P M E N T D E P A R T M E N T R E P R E S E N T S O N E O F S I X C I T Y D E P A R T M E N T S , A N D C O N S I S T S O F S I X D I V I S I O N S : T H E H U B , P L A N N I N G , B U I L D I N G , P U B L I C W O R K S D E V E L O P M E N T , E N G I N E E R I N G S E R V I C E S , A N D A D M I N I S T R A T I O N .     Design and Development Department the HUB The Hub serves as a one-stop shop for La Quinta patrons.  It is the central location for obtaining permits for planning, building, engineering, garage sales, and special events.  The Hub assists customers through the permitting process from initial questions and pre-application meetings through inspections and final certificate of occupancy.  Below are some July 2019 metrics: CUSTOMER SATISFACTION Permit and Project Fees Collected $196,587 $244,896 927 4,626 60 277 Total Active Business License Total Customers Served Total Issued Permits  Total  E-TRAKiT Permits TOT Collected In July 2016, The Hub launched a survey to measure the satisfaction of its customers.  The  survey  uses a one to five point rating system, with five points being 100% excellent. The Hub Customer Satisfaction survey results for the month of July 2019 averaged 94.5%. 0 25 50 75 100 Wait TimeHelpfulnessQualityWeekly Average Calls Received 320 DEPARTMENTAL REPORT ITEM NO. 5-A DEPARTMENTAL REPORT ITEM NO. 5-A451 D E S I G N A N D D E V E L O P M E N T D E P A R T M E N T R E P O R T -   J U L Y   2 0 1 9 J U L Y 2 0 1 9 R E P O R T Design and Development Department PLANNING ACTIVITY BUILDING The Building Division administers all building permit applications for compliance with entitlement plan approvals, La Quinta Municipal Code, and the California Building Codes. Planning Permits The Planning Division works with residential and commercial property/business owners and developers to ensure that land uses and development in the City is consistent with the City’s goals and policies. Planning Permits Includes sign applications, temporary use permits, minor use permits, final landscaping plans, etc. 452 D E S I G N A N D D E V E L O P M E N T D E P A R T M E N T R E P O R T -   J U L Y   2 0 1 9 J U L Y 2 0 1 9 R E P O R T Design and Development Department TRAFFIC & CIP The Public Works Development provides engineering assistance with a variety of permits. During the month of July 2019, the following number of permits were issued and projects were reviewed: The Engineering Services Division provides engineering design, construction oversight, and traffic support on a variety of infrastructure projects that help keep La Quinta safe and beautiful.  Highlighted below are some activities for July 2019:     ENGINEERING SERVICES SHORT-TERM VACATION RENTAL THE PROGRAM As of July 2019, there are 1,268 active, registered short term vacation rental (STVR) permits. Transient occupancy tax (TOT) is collected for hotels, Bed and Breakfast (B&B) stays and for STVR. Monthly TOT collected from January 2019 to July 2019 (with 2018 comparison) is as follows: PUBLIC WORKS DEVELOPMENT TRAFFIC On-site construction continues at private development projects including Andalusia, Griffin Ranch, Monterra, Codorniz, The Citrus, Floresta, and Washington Street Apartments.  The contractor for the Eisenhower Drive Drainage Improvements project continues to install storm drain and has begun excavating the retention basin. The contractor for the Dune Palms Road Widening project is locating the existing utilities and installing survey stakes in preparation for the widening of the east side of Dune Palms Road at Westward Ho. The contractor for the La Quinta Landscape Renovation Improvements - La Quinta Highlands project continues to remove shrubs and prepare for turf removal. 17 requests for service were recorded in City’s GORequest system in July 2019.  The Traffic Team responded to 11 repair requests and 6 preventative maintenance work orders. CIP Projects - In Progress 453 454 D E S I G N A N D D E V E L O P M E N T D E P A R T M E N T R E P O R T - A U G U S T 2 0 1 9 A U G U S T 2 0 1 9 R E P O R T T H E D E S I G N A N D D E V E L O P M E N T D E P A R T M E N T R E P R E S E N T S O N E O F S I X C I T Y D E P A R T M E N T S , A N D C O N S I S T S O F S I X D I V I S I O N S : T H E H U B , P L A N N I N G , B U I L D I N G , P U B L I C W O R K S D E V E L O P M E N T , E N G I N E E R I N G S E R V I C E S , A N D A D M I N I S T R A T I O N .     Design and Development Department the HUB The Hub serves as a one-stop shop for La Quinta patrons.  It is the central location for obtaining permits for planning, building, engineering, garage sales, and special events.  The Hub assists customers through the permitting process from initial questions and pre-application meetings through inspections and final certificate of occupancy.  Below are some August 2019 metrics: CUSTOMER SATISFACTION Permit and Project Fees Collected $196,587 $244,896 970 5,071 59 241 Total Active Business License Total Customers Served Total Issued Permits  Total  E-TRAKiT Permits TOT Collected In July 2016, The Hub launched a survey to measure the satisfaction of its customers.  The  survey  uses a one to five point rating system, with five points being 100% excellent. The Hub Customer Satisfaction survey results for the month of August 2019 averaged 94.5%. 0 25 50 75 100 Wait TimeHelpfulnessQualityWeekly Average Calls Received 259 DEPARTMENTAL REPORT ITEM NO. 5-B DEPARTMENTAL REPORT ITEM NO. 5-B455 D E S I G N A N D D E V E L O P M E N T D E P A R T M E N T R E P O R T -   A U G U S T   2 0 1 9 A U G U S T 2 0 1 9 R E P O R T Design and Development Department PLANNING ACTIVITY BUILDING The Building Division administers all building permit applications for compliance with entitlement plan approvals, La Quinta Municipal Code, and the California Building Codes. Planning Permits The Planning Division works with residential and commercial property/business owners and developers to ensure that land uses and development in the City is consistent with the City’s goals and policies. Planning Permits Includes sign applications, temporary use permits, minor use permits, final landscaping plans, etc. 456 D E S I G N A N D D E V E L O P M E N T D E P A R T M E N T R E P O R T -   A U G U S T   2 0 1 9 A U G U S T 2 0 1 9 R E P O R T Design and Development Department TRAFFIC & CIP The Public Works Development provides engineering assistance with a variety of permits. During the month of August 2019, the following number of permits were issued and projects were reviewed: The Engineering Services Division provides engineering design, construction oversight, and traffic support on a variety of infrastructure projects that help keep La Quinta safe and beautiful.  Highlighted below are some activities for August 2019:     ENGINEERING SERVICES SHORT-TERM VACATION RENTAL THE PROGRAM As of August 2019, there are 1,290 active, registered short term vacation rental (STVR) permits. Transient occupancy tax (TOT) is collected for hotels, Bed and Breakfast (B&B) stays and for STVR. Monthly TOT collected from January 2019 to August 2019 (with 2018 comparison) is as follows: PUBLIC WORKS DEVELOPMENT TRAFFIC On-site construction continues at private development projects including Andalusia, Griffin Ranch, Monterra, Codorniz, The Citrus, Floresta, and Washington Street Apartments.  The contractor for the Eisenhower Drive Drainage Improvements project continues to haul dirt to SilverRock Resort. The contractor for the Dune Palms Road Widening project poured foundation for the new traffic signal pole and has begun construction of the masonry block wall; the utility companies have pulled electrical and communication cables into the new conduits along Dune Palms Road. The contractor for the La Quinta Landscape Renovation Improvements - La Quinta Highlands project has installed irrigation piping and boulders in the South parkway on Fred Waring Drive. 29 requests for service were recorded in City’s GORequest system in August 2019.  The Traffic Team responded to 18 repair requests and 11 preventative maintenance work orders. CIP Projects - In Progress 457 458 FACILITIES DEPARTMENT –JULY 2019 The Facilities Department is responsible for maintenance of City buildings, parks and lighting & landscape (L&L) and streets. The Department manages three Divisions; Buildings, Parks and L & L, and Public Works Maintenance. FACILITES DEPARTMENT MONTHLY REPORT FOR JULY 2019 BUILDINGS TASKS 130 HOURS 375 EXPENDITURES $14,509 (Attachment 1) PARKS and L & L TASKS 150 HOURS 498 EXPENDITURES $18,766 (Attachment 2) PUBLIC WORKS MAINTENANCE TASKS 118 HOURS 597 EXPENDITURES $30,327 (Attachment 3) TOTAL: TASKS: 398 HOURS: 1,470 EXPENDITURES: $63,602 The Department utilizes Gorequest to track monthly maintenance requests received from residents and staff for each division, as well as the number of tasks, hours and expenditures. SURVEY RESULTS (Attachment 4) POSITIVE FEEDBACK FROM RESIDENTS:  “Great service. Thank you for the timely response. Exceeding my expectations!”.  “Ease of reporting issues is great! Much better than calling and getting no response”. Top Requests in July:  Buildings - Facilities Maintenance  Parks– Landscape Contract Management  Public Works - Concrete Sidewalk Repairs  Buildings - Personnel Requests  Parks– Graffiti  Public Works - Street Signs PARKS UPDATE: Aerification and fertilization of the parks and sports fields is underway. The focus this month is to prepare the sports fields for the fall season. L & L UPDATE: Heavy pruning is in progress throughout the City to bring plants and weeds under control. Irrigation systems are being monitored for efficiency, repaired and replaced. DEPARTMENTAL REPORT ITEM NO. 6-A 459 460 Electrcial $195 Facilities Maint $2,892 Classes $138 Pest Control $46 Plumbing $1,030Preventative Maint $448 Security/Alarms/Doors $138 Paint $1,384 Janitorial $144 General Repairs $893 Carpentry/Hardware $162 HVAC $167 Personnel Requests $2,796 Meeting $646 Library $1,322 Museum $52 Fire Stations $2,056 Buildings Maintenance Expenditures for the Month of July 2019 ATTACHMENT 1 Total Monthly Expenses: $14,509 ATTACHMENT 1461 462 BEFORE AFTER BEFORE AFTER BEFORE AFTER AFTER 463 464 Amenities Preservation $357 Pest Control $93 FB Pool Inspection $481 Meeting $1,509 Civic Center Lake Insp. $175 Debris/Litter Removal $654 Playground Inspection $2,210 Insp. Maintenance $544 Landscape Improvements $1,138 Office Administration $126 Tree Issues $690 Landscape Insp. $1,442 Playground Equip Maint $51 Seminars/Training $102 Lighting/Electrical $96 Landscape Contract Mgt $3,892 Vehicle/Equipment Maint $348 Vandalism Repair $392 Hardscape Maint $1.429, Irrigation Check/Repair $582 Gate/Fence Repair $309 Graffiti $2,146 Parks and L&L Monthly Maintenance Expenditures for July 2019 ATTACHMENT 2 Total Monthly Expenditures: $18,766 ATTACHMENT 2465 466 BEFORE AFTER BEFORE 467 468 AFTER BEFORE 469 470 BEFORE AFTER 471 472 AFTER BEFORE 473 474 AFTER BEFORE 475 476 477 478 Graffiti $1,604 Gutter/Sand Removal $161 Office Work $989 Inspection $1,946 Street Sweeping $450 Debris/Litter Removal $2,980 Vehicle Equipment $332 Street Signs $5,688 Storm Drain Maint $797 Concrete Sidewalk Repairs $10,058 Meeting $919 Seminars/Training $380 Yard Maintenance $690 Pothole or Street Repair $3,617 Public Works Maintenance Expenditures for the Month of July 2019 ATTACHMENT 3 Total Monthly Expenditures: $ 30,327 ATTACHMENT 3479 480 BEFORE AFTER BEFORE AFTER 481 482 AFTER AFTER BEFORE AFTER CONCRETE SIDEWALK REPAIRS 483 484 AFTER AVENIDA LA FONDA 485 486 Customer Satisfaction Survey Details 07/01/2019 to 07/31/2019 Request: 38538 Survey Entered: 07-03-2019 Request Entered: 06/10/2019 Closed: 07/03/2019 Days Open: 23 Topic: Sidewalk Repair/Concrete C&G- 1007 Location: 49740 Althea Court La Quinta CA 92253 Employee: James Lindsey Customer: Susan Abeles Description: I live in the Althea development on Avenue 50. I saw recently that the City completed the sidewalk gap along Jefferson between Avenue 50 and the entrance to the Renaissance development. There is also a sidewalk gap along Avenue 50 between our development and Jefferson that has not been completed. Since it is difficult to get to the light and crosswalk at Jefferson and Avenue 50 due to the lack of sidewalk and uneven ground, this lack of sidewalk creates a walking hazard as it encourages people to try to jaywalk across Avenue 50, which is extremely dangerous due to the high speeds that cars travel on this road. Please make finishing this sidewalk a priority as you did on Jefferson. Reason Closed: This is NOT a maintenance issue. Please contact The City of La Quinta Design and Engineering Division for additional construction information: Danny Castro (760-777-7099); Bryant McKinney (760-777-7045) How pleased were you with the helpfulness of the city employee who initially took your service request?: Below Average Rate our knowledge and ability to process your request timely: Below Average Were we courteous and professional?: Below Average In general, how pleased are you with the city services you received during the past year?: Below How can the City improve?: The message I received was rude and it was over ten days late. I doubt I would have even received a response except that I updated my request asking what happened to the response. I would have expected a more complete explanation regarding why the sidewalk gap on Avenue 50 is not getting the same attention as the one that was just completed on Jefferson. Request: 38676 Survey Entered: 07-01-2019 Request Entered: 06/20/2019 Closed: 06/21/2019 Days Open: 1 Topic: Sidewalk Repair/Concrete C&G- 1007 Location: 51350 Desert Club Drive Ste 4 La Quinta CA 92253 Employee: James Lindsey Customer: Veronica Delgado Description: buckled sidewalk See Go-Request 38627, dated 617/19 Reason Closed: Cut out and Leveled uplifting sidewalk on ave 48 between Dune Palms and Adams going W/B. How pleased were you with the helpfulness of the city employee who initially took your service request?: No answer Rate our knowledge and ability to process your request timely: Superior Were we courteous and professional?: No answer In general, how pleased are you with the city services you received during the past year?: Met ATTACHMENT 4 ATTACHMENT 4487 Request: 38709 Survey Entered: 07-18-2019 Request Entered: 06/21/2019 Closed: 07/11/2019 Days Open: 20 Topic: Street Sign Repair & Maint Location: Employee: James Lindsey Customer: Edward Burkhardt Description: When do you anticipate the new La Quinta Cove sign to be replaced on the roundabout on Eisenhower? Reason Closed: The sign has been repaired by Best sign company. How pleased were you with the helpfulness of the city employee who initially took your service request?: Superior Rate our knowledge and ability to process your request timely: Superior Were we courteous and professional?: Superior In general, how pleased are you with the city services you received during the past year?: Exceeded How can the City improve?: Great service. Thank you for the timely response. Exceeding my expectations! Request: 38710 Survey Entered: 07-02-2019 Request Entered: 06/23/2019 Closed: 06/25/2019 Days Open: 2 Topic: Landscape/Irrigation Contract Management - 1050 Location: 44215 Calico Cir La Quinta CA 92253 Employee: James Lindsey Customer: Margaret Hoesterey Description: Leaking sprinkler. Has been leaking so long sidewalk is slippery with algae. This is dangerous. Reason Closed: Conserve landcare fixed leaking sprinkler How pleased were you with the helpfulness of the city employee who initially took your service request?: Average Rate our knowledge and ability to process your request timely: Superior Were we courteous and professional?: Average In general, how pleased are you with the city services you received during the past year?: Met How can the City improve?: The city has a contract with Conserve. Conserve should maintain the property without people having to submit work that should be taken care of if the city is properly maintaining their contracts. Request: 38737 Survey Entered: 07-05-2019 Request Entered: 06/24/2019 Closed: 06/28/2019 Days Open: 4 Topic: Parks and L&L Maintenance Location: La Quinta CA Employee: Dianne Hansen Customer: C Barron Description: No lights on at all. It’s 9:19pm. Did the light schedule changed? There’s people walking or running around the park. It’s very dangerous. Reason Closed: Work done adjusted the timer. How pleased were you with the helpfulness of the city employee who initially took your service request?: Superior Rate our knowledge and ability to process your request timely: Superior Were we courteous and professional?: Superior In general, how pleased are you with the city services you received during the past year?: Exceeded 488 Request: 38743 Survey Entered: 07-05-2019 Request Entered: 06/25/2019 Closed: 06/27/2019 Days Open: 2 Topic: Vandalism Repairs - 1070 Location: Employee: Dianne Hansen Customer: Laura green Description: Not sure 🤔 if this is anything but this looks like someone is digging a small grave 🤷🏻‍♀️ maybe to bury an animal 🐕:-(( Reason Closed: Covered up hole. How pleased were you with the helpfulness of the city employee who initially took your service request?: Superior Rate our knowledge and ability to process your request timely: Superior Were we courteous and professional?: Superior In general, how pleased are you with the city services you received during the past year?: Exceeded Request: 38759 Survey Entered: 07-08-2019 Request Entered: 06/26/2019 Closed: 07/01/2019 Days Open: 5 Topic: Landscape/Irrigation Contract Management - 1050 Location: Employee: Dianne Hansen Customer: Melissa Pillsbury Description: Broken irritation flooding side of house and into street several days Reason Closed: The repairs were made by others. How pleased were you with the helpfulness of the city employee who initially took your service request?: Good Rate our knowledge and ability to process your request timely: Average Were we courteous and professional?: Good In general, how pleased are you with the city services you received during the past year?: Met How can the City improve?: Ease of reporting issues is great! Much better than calling and getting no response. Request: 38793 Survey Entered: 07-18-2019 Request Entered: 06/27/2019 Closed: 07/11/2019 Days Open: 14 Topic: Tree Issues Location: Employee: Dianne Hansen Customer: Jan Description: There is a tree that hangs into the street that is in major need of trimming. We have to almost walk in the middle of the street to walk around it, which puts pedestrians in harms way if a car comes around the corner. Reason Closed: Trimmed overgrown tree and Palm tree. How pleased were you with the helpfulness of the city employee who initially took your service request?: Good Rate our knowledge and ability to process your request timely: Good Were we courteous and professional?: Good In general, how pleased are you with the city services you received during the past year?: Met How can the City improve?: We didn’t have any interaction with an employee. The issue was handled in a timely manner. 489 Request: 38796 Survey Entered: 07-09-2019 Request Entered: 06/28/2019 Closed: 07/02/2019 Days Open: 4 Topic: Graffiti in Parks - 1030 Location: Employee: Dianne Hansen Customer: Tokiyo Ochi Description: Soccer complex Reason Closed: Removed graffiti How pleased were you with the helpfulness of the city employee who initially took your service request?: No answer Rate our knowledge and ability to process your request timely: Good Were we courteous and professional?: No answer In general, how pleased are you with the city services you received during the past year?: Met Request: 38797 Survey Entered: 07-09-2019 Request Entered: 06/28/2019 Closed: 07/02/2019 Days Open: 4 Topic: Graffiti in Parks - 1030 Location: Employee: Dianne Hansen Customer: Tokiyo Ochi Description: Photo submitted Reason Closed: Removed/painted graffiti How pleased were you with the helpfulness of the city employee who initially took your service request?: No answer Rate our knowledge and ability to process your request timely: Good Were we courteous and professional?: No answer In general, how pleased are you with the city services you received during the past year?: Met Request: 38871 Survey Entered: 07-22-2019 Request Entered: 07/02/2019 Closed: 07/22/2019 Days Open: 20 Topic: Sidewalk Repair/Concrete C&G- 1007 Location: 42600 Caroline Court Suite 102 Palm Desert CA 92211 Employee: James Lindsey Customer: Robin Coulson Description: Sidewalk along Avenue 47 has lifted and is a trip & fall hazard. Please advise if this is the City of La Quinta responsibility or the property owner's. Thank you. Robin Coulson Reason Closed: We cut uplifted sidewalk we are waiting to see if water districts going to replace sidewalk in front of there fire highdrent How pleased were you with the helpfulness of the city employee who initially took your service request?: Good Rate our knowledge and ability to process your request timely: Good Were we courteous and professional?: Good In general, how pleased are you with the city services you received during the past year?: Met 490 Request: 38996 Survey Entered: 07-23-2019 Request Entered: 07/11/2019 Closed: 07/16/2019 Days Open: 5 Topic: Library/Janitorial Location: Employee: Alfred Berumen Customer: Natalie Description: Trash can still smells bad after 2 attempts by staff to clean with 2 different cleaners. Please replace if cannot get rid of smell? Reason Closed: work done How pleased were you with the helpfulness of the city employee who initially took your service request?: Superior Rate our knowledge and ability to process your request timely: Superior Were we courteous and professional?: Superior In general, how pleased are you with the city services you received during the past year?: Met Request: 39064 Survey Entered: 07-18-2019 Request Entered: 07/16/2019 Closed: 07/18/2019 Days Open: 2 Topic: Library/Electical Location: 78275 Calle Tampico La Quinta CA 92253 Employee: Alfred Berumen Customer: Minerva Ochoa Description: Emergency exit door in children's area does not sound off when opened. Might need batteries. Reason Closed: work done How pleased were you with the helpfulness of the city employee who initially took your service request?: Superior Rate our knowledge and ability to process your request timely: Superior Were we courteous and professional?: Superior In general, how pleased are you with the city services you received during the past year?: Exceeded How can the City improve?: Quick response fixing issue. Request: 39110 Survey Entered: 07-22-2019 Request Entered: 07/18/2019 Closed: 07/22/2019 Days Open: 4 Topic: Library/Preventative Maintenance Location: 78275 Calle Tampico La Quinta CA 92253 Employee: Alfred Berumen Customer: Minerva Ochoa Description: There have been several small cockroaches around library. In need of a exterminator before they multiply. Reason Closed: Work is done. How pleased were you with the helpfulness of the city employee who initially took your service request?: Superior Rate our knowledge and ability to process your request timely: Superior Were we courteous and professional?: Superior In general, how pleased are you with the city services you received during the past year?: Exceeded 491 Request: 39111 Survey Entered: 07-31-2019 Request Entered: 07/18/2019 Closed: 07/24/2019 Days Open: 6 Topic: Library/Janitorial Location: 78275 Calle Tampico La Quinta CA 92253 Employee: Dianne Hansen Customer: Minerva Ochoa Description: There are several dried urine puddles (with a strong odor) on sidewalk walkway going to Creation station back entrance. This is an ongoing issue. Maintenance has power washed it in the past, but it looks like this area is used for urinating by public. Area needs to be constantly washed to keep it clean. Reason Closed: Preassure washed, picked up human feces. Work done How pleased were you with the helpfulness of the city employee who initially took your service request?: Superior Rate our knowledge and ability to process your request timely: Superior Were we courteous and professional?: Superior In general, how pleased are you with the city services you received during the past year?: Exceeded How can the City improve?: They did a great job in cleaning up area, but this is an ongoing issue. There is now new additional urine stains and odor after the cleaning was done. It looks like this area is used as a living space for homeless individuals. Request: 39134 Survey Entered: 07-31-2019 Request Entered: 07/22/2019 Closed: 07/24/2019 Days Open: 2 Topic: Landscape/Irrigation Contract Management - 1050 Location: Employee: Dianne Hansen Customer: Tokiyo Ochi Description: Photo submitted Reason Closed: Plant was trimmed and sprinkler fixed. How pleased were you with the helpfulness of the city employee who initially took your service request?: No answer Rate our knowledge and ability to process your request timely: No answer Were we courteous and professional?: No answer In general, how pleased are you with the city services you received during the past year?: Met Request: 39136 Survey Entered: 07-31-2019 Request Entered: 07/22/2019 Closed: 07/24/2019 Days Open: 2 Topic: Parks and L&L Irrigation Check/Repair Location: Employee: Dianne Hansen Customer: Tokiyo Ochi Description: Between Desert Crest and Desert Stream. Reason Closed: Sprinkler was replaced. How pleased were you with the helpfulness of the city employee who initially took your service request?: No answer Rate our knowledge and ability to process your request timely: No answer Were we courteous and professional?: No answer In general, how pleased are you with the city services you received during the past year?: Met 492 FACILITIES DEPARTMENT –August 2019 The Facilities Department is responsible for maintenance of City buildings, parks and lighting & landscape (L & L), and streets. The Department manages three Divisions; Buildings, Parks and L&L, and Public Works Maintenance. FACILITES DEPARTMENT MONTHLY REPORT FOR AUGUST 2019 BUILDINGS TASKS 129 HOURS 439 EXPENDITURES $16,643 (Attachment 1) PARKS and L & L TASKS 120 HOURS 757 EXPENDITURES $30,215 (Attachment 2) PUBLIC WORKS MAINTENANCE TASKS 113 HOURS 553 EXPENDITURES $31,192 (Attachment 3) TOTAL: TASKS: 362 HOURS: 1,749 EXPENDITURES: $78,050 The Department utilizes Gorequest to track monthly maintenance requests received from residents and staff for each division, as well as the number of tasks, hours and expenditures. SURVEY RESULTS (Attachment 4) POSITIVE FEEDBACK FROM RESIDENTS:  “I love the response times on requests submitted. It shows the City cares about water being wasted”. Top Requests in August:  Buildings - Fire Stations  Parks – Graffiti  Public Works - Concrete Sidewalk Repairs  Buildings - Facilities Maintenance  Parks – Landscape Contract Management  Public Works - Debris/Litter Removal PARKS UPDATE: The contractor is making progress in the parks and retention basins with weed removal. Irrigation adjustments were made to ensure adequate water distribution of turf. Rodent control is performed weekly in the parks, sports fields and retention basins. L & L UPDATE: An assessment of the irrigation clocks is being performed, and four irrigation clocks have been replaced. The contractor is continuing heavy pruning in the medians to bring the shrubs under control and herbicides are being applied to control weeds. DEPARTMENTAL REPORT ITEM NO. 6-B 493 494 Pest Control $149 Painting $979 Carpentry/Hardware $687 HVAC $657 Electrical $1,314 Facilities Maint $2,683 Security/Fobs/Alarms $81 General Repairs $1,159 Training/Classes $112 Personnel Requests $1,617 Janitorial $322 Uplevel Project $2,329 Plumbing $907 Preventative Maint $231 Library $267 Museum $138 Fire Stations $3,011 Buildings Monthly Maintenance for August 2019 ATTACHMENT 1 Total Monthly Expenditures: $16,643 ATTACHMENT 1495 496 BEFORE AFTER BEFORE AFTER BEFORE BEFORE AFTER AFTER 497 498 BEFORE AFTER 499 500 BEFORE AFTER AFTER AFTER BEFORE BEFORE 501 502 Gate/Fence Repairs $200 Playground Insp & Equip Maint $2,069 Fritz Burns Pool $33 Landscape/Irrigation Mgt $4,450 Sign Maint $1,052 Parks and L&L Maint $851 Meeting $1,282 Pest Control $423 Hardscape Maint $1,708 Debris/Litter Removal $263 Irrigation Check/Repair $2,384 Civic Center Lake Insp. $236 Landscape Insp. $1,112 Tree Issues $515 Lighting Electrical $1,492 Vehicle Equip Maint $67 Landscape Improvements $3,186 Skate Park Maint $689 Vandalism Repair $256 Graffiti Parks and L&L Monthly Maintenance Expenditures for August 2019 ATTACHMENT 2 Total Maintenance Expenditures: $30,215 ATTACHMENT 2503 504 BEFORE BEFORE AFTER AFTER SPORTS COMPLEX LA QUINTA PARK 505 506 BEFORE AFTER 507 508 AFTER SPORTS COMPLEX ENTRY LANDSCAPE BEFORE AFTER AFTER BEFORE 509 510 AFTER BEFORE BEFORE AFTER AFTER 511 512 AFTER BEFORE AFTER 513 514 AFTER BEFORE BEFORE AFTER BEFORE AFTER 515 516 BEFORE BEFORE AFTER AFTER 517 518 Graffiti $1,066 Office Work $483 Debris/Litter Removal $4,036 Street Sweeping $634 Yard Maintenance $581 Accident Damage $2,552 Curb Painting $159 Concrete Sidewalk Repairs $11.041 Vandalism Repair $312 Meetings $1,122 Vehicle Equipment $801 Pothole or Street Repair $1,886 Pavement Marking $380 Storm Drain Maint $1,770 Street Signs $3,497 Inspection $872 Public Works Monthly Maintenance Expenditures for August 2019 ATTACHMENT 3 Total Maintenance Expenditures: $31,192 ATTACHMENT 3519 520 AFTER AFTER AFTER CONCRETE SIDEWALK REPAIRS BEFORE DURING AFTER 521 522 Customer Satisfaction Survey Details 08/01/2019 to 08/31/2019 Request: 39238 Survey Entered: 08-15-2019 Request Entered: 07/30/2019 Closed: 08/08/2019 Days Open: 9 Topic: Parks and L&L Irrigation Check/Repair Location: Employee: Dianne Hansen Customer: Tokiyo Ochi Description: Wash basin Desert Stream Reason Closed: Irrigation has been repaired. How pleased were you with the helpfulness of the city employee who initially took your service request?: No answer Rate our knowledge and ability to process your request timely: Good Were we courteous and professional?: No answer In general, how pleased are you with the city services you received during the past year?: Met Request: 39307 Survey Entered: 08-19-2019 Request Entered: 08/02/2019 Closed: 08/12/2019 Days Open: 10 Topic: Parks and L&L Pest Control Location: 51485 Calle Guatemala La Quinta CA 92253 Employee: Dianne Hansen Customer: Mary Jennings Description: There are mole hills on the side of the street next to my house along the wall bordering Ave. 52. Now I have miles in my yard too. I have already spent $$ on this problem. Reason Closed: Staff went to the residence and met with the homeowner, they will rake the mole hills and set traps. How pleased were you with the helpfulness of the city employee who initially took your service request?: Average Rate our knowledge and ability to process your request timely: Below Average Were we courteous and professional?: Superior In general, how pleased are you with the city services you received during the past year?: Below How can the City improve?: I had to reach out twice. They never addressed the problems it caused in my yard or even said anything about it. Request: 39438 Survey Entered: 08-24-2019 Request Entered: 08/13/2019 Closed: 08/21/2019 Days Open: 8 Topic: Landscape/Irrigation Contract Management - 1050 Location: Employee: Dianne Hansen Customer: Tokiyo Ochi Description: Have not seen landscape company in months outer perimeter of Topaz community on Miles and Dune Palms. Really needs trees and bushes pruned. Debris raked. Have seen them more frequently on Adam's,but not around Topaz. Reason Closed: PWLC are working at Topaz perimeter. How pleased were you with the helpfulness of the city employee who initially took your service request?: Good Rate our knowledge and ability to process your request timely: Average Were we courteous and professional?: No answer In general, how pleased are you with the city services you received during the past year?: Met ATTACHMENT 4 ATTACHMENT 4523 Request: 39439 Survey Entered: 08-24-2019 Request Entered: 08/13/2019 Closed: 08/22/2019 Days Open: 9 Topic: Landscape/Irrigation Contract Management - 1050 Location: Employee: Dianne Hansen Customer: Tokiyo Ochi Description: Photo submitted Reason Closed: PWLC is working on the perimeter of TOPaz. How pleased were you with the helpfulness of the city employee who initially took your service request?: Good Rate our knowledge and ability to process your request timely: Average Were we courteous and professional?: No answer In general, how pleased are you with the city services you received during the past year?: Met Request: 39440 Survey Entered: 08-24-2019 Request Entered: 08/13/2019 Closed: 08/21/2019 Days Open: 8 Topic: Landscape/Irrigation Contract Management - 1050 Location: Employee: Dianne Hansen Customer: Tokiyo Ochi Description: Landscaping company must had missed our rotation for Tpoaz community. Reason Closed: PWLC are working on To Paz perimeter. How pleased were you with the helpfulness of the city employee who initially took your service request?: Good Rate our knowledge and ability to process your request timely: Average Were we courteous and professional?: No answer In general, how pleased are you with the city services you received during the past year?: Met Request: 39441 Survey Entered: 08-24-2019 Request Entered: 08/13/2019 Closed: 08/22/2019 Days Open: 9 Topic: Parks and L&L Irrigation Check/Repair Location: Employee: Dianne Hansen Customer: Tokiyo Ochi Description: Missing cover. Reason Closed: Got irrigation box from High-tech for To Pasz perimeter. How pleased were you with the helpfulness of the city employee who initially took your service request?: Good Rate our knowledge and ability to process your request timely: Average Were we courteous and professional?: No answer In general, how pleased are you with the city services you received during the past year?: Met 524 Request: 39479 Survey Entered: 08-26-2019 Request Entered: 08/15/2019 Closed: 08/19/2019 Days Open: 4 Topic: Graffiti Removal (Right-of-Way) - 1071 Location: Employee: Dianne Hansen Customer: Tokiyo Ochi Description: Wash basin Reason Closed: Removed trash can lid because it was broken. How pleased were you with the helpfulness of the city employee who initially took your service request?: Good Rate our knowledge and ability to process your request timely: No answer Were we courteous and professional?: No answer In general, how pleased are you with the city services you received during the past year?: Met Request: 39516 Survey Entered: 08-27-2019 Request Entered: 08/17/2019 Closed: 08/20/2019 Days Open: 3 Topic: Landscape/Irrigation Contract Management - 1050 Location: Employee: Dianne Hansen Customer: Tammy Martin Description: Looks like underground valve is broken Reason Closed: Area belongs to Lake La Quinta and irrigation has been fixed already. How pleased were you with the helpfulness of the city employee who initially took your service request?: Superior Rate our knowledge and ability to process your request timely: Superior Were we courteous and professional?: Superior In general, how pleased are you with the city services you received during the past year?: Exceeded How can the City improve?: I love the response times on request submitted. It shows the city cares about water being wasted. Request: 39523 Survey Entered: 08-27-2019 Request Entered: 08/18/2019 Closed: 08/20/2019 Days Open: 2 Topic: Parks and L&L Maintenance Location: 44365 Monticello ave. La Quinta CA 92253 Employee: Dianne Hansen Customer: Nancy Arriaga Description: We try to go to the park when the sun isn’t as strong and there is still some sunlight. However, it is at that time that the sprinklers turn on and my family can’t be there anymore. Is it possible to change the setting for the sprinklers to turn on when there is no sunlight and the park is likely to be empty? Maybe 9:00 pm? This hasn’t always been happening this way. It was changed not too long ago. Reason Closed: Raphael, followed up with the landscape contractor to adjust the sprinklers. How pleased were you with the helpfulness of the city employee who initially took your service request?: Superior Rate our knowledge and ability to process your request timely: Superior Were we courteous and professional?: Superior In general, how pleased are you with the city services you received during the past year?: Exceeded 525 Request: 39524 Survey Entered: 08-21-2019 Request Entered: 08/18/2019 Closed: 08/21/2019 Days Open: 3 Topic: Debris/Litter Removal/Right of Way Maint - 1011 Location: 81878 Seabiscuit Way La Quinta CA 92253 Employee: James Lindsey Customer: Rick Morelli Description: Debris curb side east bound ave 52 & continuing south bound Monroe (LQ side)... flunks LQ std for street cleanliness... includes bottles, thrash, box, etc Reason Closed: Swept by M and M Street Sweeping work done How pleased were you with the helpfulness of the city employee who initially took your service request?: Superior Rate our knowledge and ability to process your request timely: Superior Were we courteous and professional?: Superior In general, how pleased are you with the city services you received during the past year?: Met 526 FINANCIAL ADVISORY COMMISSION MINUTES 1 JUNE 5, 2019 SPECIAL MEETING FINANCIAL ADVISORY COMMISSION SPECIAL MEETING MINUTES WEDNESDAY, JUNE 5, 2019 CALL TO ORDER A special meeting of the La Quinta Financial Advisory Commission (Commission) was called to order at 4:00 p.m. by Chair Mills. PRESENT: Commissioners: Batavick, Hunter, Lopez, Rosen, Twohey, and Chair Mills ABSENT:Commissioner Turbow PLEDGE OF ALLEGIANCE Commissioner Hunter led the audience in the Pledge of Allegiance. PUBLIC COMMENT ON MATTERS NOT ON THE AGENDA – None CONFIRMATION OF AGENDA – Confirmed ANNOUNCEMENTS, PRESENTATIONS, AND WRITTEN COMMUNICATIONS – None CONSENT CALENDAR ITEMS 1.APPROVE FINANCIAL ADVISORY COMMISSION MINUTES DATED MAY 15, 2019 2. RECEIVE AND FILE REVENUE AND EXPENDITURE REPORT DATED APRIL 30, 2019 Motion – A motion was made and seconded by Commissioners Twohey/Lopez to approve the Consent Calendar, as submitted. Motion passed: ayes 6, noes 0, absent 1 (Turbow). BUSINESS SESSION 1.APPROVE WRITE-OFF OF OUTSTANDING INTERFUND LOANS Finance Director Romero presented the staff report, which is on file in the Finance Department. The Commission and Staff discussed the outstanding loans for the SilverRock Resort Fund; the three Development Impact Fee (DIF) loans; the history and overview of these outstanding loans that are due to the General Fund; DIF revenue projections; and pending DIF fees for the SilverRock Resort event site. REPORTS AND INFORMATIONAL ITEM NO. 28 527 HAND OUTS CITY COUNCIL MEETING SEPTEMBER 17, 2019 1 Monika Radeva From:Monika Radeva Sent:Monday, September 16, 2019 11:21 AM Cc:Jon McMillen; Teresa Thompson; Nichole Romane; Tania Flores; 'William H. Ihrke'; Bryan McKinney; Amy Yu; Monika Radeva Subject:09/17/2019 City Council Consent Calendar Item 9 - Partial Release of Griffin Ranch Street Improvements Attachments:LOTS M.S.T.U.W.X.AC.AD.AE.AL.pdf; ATT00001.htm Good morning Mayor and Councilmembers, Enclosed for your review and consideration is the email correspondence below providing written comments from Mr. and Mrs. Wilson in opposition of granting approval of Consent Calendar Item No. 9 requesting a time extension to complete on-site improvements for Griffin Ranch residential development (Tract Map 32879), was received by staff on Sunday, September 15, 2019. This email will be made part of the record, and copies will be available for the public at the September 17, 2019, Council meeting. Regards, Monika Radeva, CMC | City Clerk City of La Quinta  78495 Calle Tampico, La Quinta, CA 92253  Tel: (760) 777‐7035  MRadeva@laquintaca.gov  From: "Debra Wilson" <dswilson777@hotmail.com>  To: "Amy Yu" <Ayu@laquintaca.gov>, "Bryan McKinney" <Bmckinney@laquintaca.gov>  Subject: 09/17/2019 City Council Consent Calendar Item 9 ‐ Partial Release of Griffin Ranch Street  Improvements  ** EXTERNAL: This message originated outside of the City of La Quinta. Please use proper judgement and caution  when opening attachments, clicking links or responding to requests for information. **  Dear Ms. Yu and Mr. McKinney,  We respectfully request that the City of La Quinta NOT approve partial release of  “Street Improvements” On‐Site Improvement Bonds for Griffin Ranch Tract 32879  as requested by the builder, Lennar Homes, on page 131 of the  agenda/attachments:  https://www.laquintaca.gov/home/showdocument?id=40308 Our rationale and justification for this request are as follows:  COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY RODNEY & DEBRA WILSON CONSENT CALENDAR ITEM NO. 9 - OPPOSITION OF TIME EXTENSION FOR GRIFFIN RANCH (TR 32879) 2 1.Apollo Court (Lot T) completed all new home construction October 2018; however, our pre‐existing street was not completed to City of La Quinta standards (i.e. 4 inches of base and 3 inches of asphalt/concrete). We measured one inch of top material for our eroded and crumbling street. 2.Our street continues to deteriorate as it can’t be maintained even though it was conveyed by Lennar to the Griffin Ranch Home Owners Association blindly December 17, 2017 (see attached Deed). NOTE: For the Deed transfer there was one grantor from Lennar, one grantee and one notary all from Lennar. No homeowner representation on our board signed these deeds. a.Our HOA governing documents (i.e., Bylaws) state that a quorum is required for the board to conduct business; however, only one of five HOA board members executing this agreement as the grantee does not appear compliant. b.The Griffin Ranch Homebuyer Disclosure Statement October, 2018 page 9 of 23 states: i.Streets and Temporary Easements.  The streets in the Community are private and will be owned and maintained by the Association, commencing in a later phase of the Community.  The original Declarant recorded a "Declaration Establishing Access Easement Rights", that provided access easements for the private streets to be available for use by Owners and occupants of Griffin Ranch, and to be owned and maintained by the Declarant until the completion of construction of the Community at which time the private streets would be conveyed in fee to the Association. Summary: We are requesting that reconstruction of our street Apollo Court according  to City of La Quinta standards shall be completed prior to approval of any  partial release of Street Improvement Bond funds.  Could you please  forward this message to the City Council prior to your meeting Tuesday  Sept. 17, 2019.  NOTE: We are very concerned that the Performance Bond Improvement  Agreement has only allocated $1,213,651 for street improvements;  however, Mr. Hellebrand has stated that the AEC estimate for  reconstruction and repair of Griffin Ranch is approximately $1.7million. Thank you and Sincerely,  Rodney and Debra Wilson COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY RODNEY & DEBRA WILSON CONSENT CALENDAR ITEM NO. 9 - OPPOSITION OF TIME EXTENSION FOR GRIFFIN RANCH (TR 32879) 3 54815 Apollo Court La Quinta, CA 92253 COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY RODNEY & DEBRA WILSON CONSENT CALENDAR ITEM NO. 9 - OPPOSITION OF TIME EXTENSION FOR GRIFFIN RANCH (TR 32879) COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY RODNEY & DEBRA WILSON CONSENT CALENDAR ITEM NO. 9 - OPPOSITION OF TIME EXTENSION FOR GRIFFIN RANCH (TR 32879) COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY RODNEY & DEBRA WILSON CONSENT CALENDAR ITEM NO. 9 - OPPOSITION OF TIME EXTENSION FOR GRIFFIN RANCH (TR 32879) COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY RODNEY & DEBRA WILSON CONSENT CALENDAR ITEM NO. 9 - OPPOSITION OF TIME EXTENSION FOR GRIFFIN RANCH (TR 32879) COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY RODNEY & DEBRA WILSON CONSENT CALENDAR ITEM NO. 9 - OPPOSITION OF TIME EXTENSION FOR GRIFFIN RANCH (TR 32879) COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY RODNEY & DEBRA WILSON CONSENT CALENDAR ITEM NO. 9 - OPPOSITION OF TIME EXTENSION FOR GRIFFIN RANCH (TR 32879) COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY RODNEY & DEBRA WILSON CONSENT CALENDAR ITEM NO. 9 - OPPOSITION OF TIME EXTENSION FOR GRIFFIN RANCH (TR 32879) COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY RODNEY & DEBRA WILSON CONSENT CALENDAR ITEM NO. 9 - OPPOSITION OF TIME EXTENSION FOR GRIFFIN RANCH (TR 32879) COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY RODNEY & DEBRA WILSON CONSENT CALENDAR ITEM NO. 9 - OPPOSITION OF TIME EXTENSION FOR GRIFFIN RANCH (TR 32879) COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY RODNEY & DEBRA WILSON CONSENT CALENDAR ITEM NO. 9 - OPPOSITION OF TIME EXTENSION FOR GRIFFIN RANCH (TR 32879) COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY RODNEY & DEBRA WILSON CONSENT CALENDAR ITEM NO. 9 - OPPOSITION OF TIME EXTENSION FOR GRIFFIN RANCH (TR 32879) 1 Monika Radeva From:Monika Radeva Sent:Tuesday, September 17, 2019 10:05 AM Cc:Jon McMillen; Teresa Thompson; Nichole Romane; Tania Flores; Bryan McKinney; Amy Yu; William H. Ihrke (bihrke@rutan.com); Monika Radeva Subject:09/17/2019 Council Meeting - Consent Calendar Item 9 - Griffin Ranch SIA Extension Attachments:Letter 2 to Bryan McKinney Re Griffin Ranch Streets.pdf Good morning Mayor and Councilmembers, Attached for your review is a letter authored by Mr. Stuart Hellenbrand, Chairperson of the Griffin Ranch Streets Improvement Committee, dated September 16, 2019, providing information regarding Consent Calendar Item No. 9 on tonight’s agenda regarding the proposed time extension to complete on-site improvements for the Griffin Ranch residential development. Mr. Hellenbrand is not able to attend tonight’s meeting, and is submitting the letter as written comments for this item to be considered by Council. This email and the attached correspondence will be incorporated into the record, and copies will be available for the public at tonight’s Council meeting. Regards, Monika Radeva, CMC | City Clerk City of La Quinta  78495 Calle Tampico, La Quinta, CA 92253  Tel: (760) 777‐7035  MRadeva@laquintaca.gov  From: Bryan McKinney <Bmckinney@laquintaca.gov>   Sent: Monday, September 16, 2019 5:42 PM  To: Monika Radeva <mradeva@laquintaca.gov>  Cc: Jon McMillen <jmcmillen@laquintaca.gov>  Subject: Griffin Ranch SIA Extension    Monika,  I received the attached letter from the head of the streets committee for the Griffin Ranch HOA  for the item on the  Council Agenda.    He can’t make the meeting personally, so wanted to report out on discussions between the HOA and  the developer.  Thanks,    Bryan McKinney, P.E. | City Engineer City of La Quinta 78495 Calle Tampico ◦ La Quinta, CA 92253 760.777.7045 Email: bmckinney@laquintaca.gov Website: www.la-quinta.org   COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY STUART HELLENBRAND CONSENT CALENDAR ITEM NO. 9 - COMMENT LETTER COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY STUART HELLENBRAND CONSENT CALENDAR ITEM NO. 9 - COMMENT LETTER COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY STUART HELLENBRAND CONSENT CALENDAR ITEM NO. 9 - COMMENT LETTER Wake up La Quinta!! Maria L. Puente La Quinta, CA Short Term Rentals 9-17-19 -cLet's be clear and honest: Short term rentals are the good excuse and fa�ade for wild parties. That is the real truth. Do not look any further or deeper. STRs create an unhealthy environment and a loss of quality of life from any point of view. STRs for the weekend are a very negative trend that destroy the peace and residential character of our neighborhoods. STRs do not have a place nor belong in a residential neighborhood. STRs are not for quiet visitors who just want to enjoy the peace of La Quinta. 6S/t ( -Short term rentals are catered for young people (usually in the early twenties), irresponsible, who have never owned a house and do not understand the hard work it takes to invest in a house. These STRs find themselves in charge of a house for a weekend, and they do party during the whole long weekend, with total disregard and disrespect for the neighbors. They do not reside and live in the neighborhood; they are transients and strangers. They do not care / consider the right of peace and quiet of the residents and neighbors. Let's be real: people renting a house for a weekend are getting together with friends and bringing more people so they can party. Party means: long hours of loud music (way past the 60 decibels which is the legally level of noise acceptable, equitable to a normal conversation), loud screams, yelling, getting high on drugs and behaving out of control, setting camping tents in the backyard, throwing firecrackers at my property in the middle of the night! ~because they are drunk~, drinking alcohol, making incredible loud noises jumping in the pool with full force to make more noise (the louder the better) again in the middle of the night, having excessive loud noise and music during the day to the point that it pounds the walls of my house, having a crowd of people in and out during the night, having up to ten cars parked outside one STR with the obvious increase in safety issues, etc. Nobody rents a house for a weekend unless the renters are going to party. They actually rent a house because their disruptive behavior and loud noise is not allowed in a hotel (quiet hours, swimming pool hours, parking restrictions, number of guests checking in and other regulations and restrictions, etc.). State Beach and other Camping areas demand that radios and other COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY MARIA PUENTE STUDY SESSION ITEM NO. 1 - COMMENT LETTER ,· long term rental. Their renters had to move. That long term rental is vacant. Who would want to live next to a mad house? Who would like to buy my house knowing they can't enjoy their backyard because of all the madness and disturbances in the house behind m property? Should I lower the price of my property and sell it at a loss in order to get out of this horrible environment? The house in my back yard has recently turned into a STR. I have had to call the police six times in less than a month because of super loud music and parties still going on at 2 AM even during the work week!!! After contacting officials at City Hall it turned out the property was operating without any permits or licenses. They were fined and seriously warned. Code Enforcement told me the property has now video cameras to survey the activity going on ... ??? This becomes a real safety issue!! The owners of these STRs do not reside in the area. They have property managers renting the property for them. They live away and go on with their merry lives meanwhile we have to face and endure the problems their renters cause. We can't allow STRs in the residential neighborhoods because these will be turned into party districts and those residential neighborhoods will be destroyed. When I bought my house, the neighborhood was advertised as a residential area, not a short term / weekend rental area for parties going on every weekend. La Quinta City Council has a serious responsibility to protect the residents who have invested in the long-term residency. STRs need to be eliminated. Our entire community is affected negatively by having STRs in our neighborhood. This is a quality of life, health, safety and an overall unhealthy environment issue. Let's keep La Quinta the Gem of the Desert. Let's not turn La Quinta into the hell of the desert. COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY MARIA PUENTE STUDY SESSION ITEM NO. 1 - COMMENT LETTER Neeta Quinn La Quinta, CA Sept. 1 7, 2019 LQ City Council: Hello to you. It has been awhile since I have appeared before you. Over the years, I have brought to your attention concerns over Agenda 21 / Sustainable Development and my last visit-­ Information regarding Affirmatively Furthering Fair Housing (AFFH). Now, there are advocates calling zoning for single-family neighborhoods Racist!! Minneapolis, Minn. became the first city to end single-family zoning, as the Mayor called such protections "self-segregation". Seattle followed .. and now Oregon. All pushing for AFFH-city after city are taking HUD grants that force them to impose such plans. Some of you may recall, I was asking you to NOT take such grants. Well, you have begun to reconstruct our neighborhoods. By allowing Short Term Vacation Rentals. On my street alone, there are 6 within a 3 block radius. (15 in my immediate area-most occurring since Mar. 2019-this year)!!! I have two right beside me-one to the left, one to the right. Different music at the same time coming from the two properties-along with the parties. And its not just for Coachella Fest or the Tennis Tournament-but week after week, weekend after weekend-non-stop. Where are our rights and protection. On our North LaQuinta website, one person told us to move. YOU are destroying our sense of community, knowing each neighbor, helping each other, whether to look out for our home while away, or watching over and feeding our pets. The home east of me was unknowingly sold to a non-occupant owner, who lied to the original owner, and to my face, that he would be living there. The home to my west, was my friend, who did watch over our home and cat-sharing the fruits from our trees-and get-togethers. COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY NEETA QUINN STUDY SESSION NO. 1 - COMMENT LETTER Now, our friendship is ruined due to the allowance of STVRs. She has defriended me, which is very sad. She saw an opportunity to make money, and took it-in spite of our many texts/ calls regarding the noise and intrusion to our comfort and enjoyment of our home, and backyard. Strangers are coming into my community, in and out, every week. Many cars parked in the long drive-ways they have, with some on the street ... 6-7-8 cars ... !! We moved to a "residential" area-not hotel row. My husband and I have lived here since 2004, and have done many improvements. We love our home and do not want to move--and why should we have to??? If you will go online and read the comm en ts from the North La Quinta website, there are too many STVRs. I know some of you have been made aware of this problem. I plead with you not to follow in the footsteps of, Oregon, Minneapolis or Seattle ... do not destroy our neighborhoods-change our zoning-which appears you are doing by infiltrating these rentals into our residential communities. For your information, I have enclosed a recent article from American Policy Center for your review. Check the facts, do your own research, and see where you stand. Thank you, ��� Neeta Quinn La Quinta COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY NEETA QUINN STUDY SESSION NO. 1 - COMMENT LETTER ADDRESS LICENSE# ISSUE DATE EXP DATE FORBES CIR 78685 FORBES CIR LIC-0110784 JL21;2019 1/31/2020 78635 FORBES CIR LIC-764858 ......3&2019 3/31/2020 78610 FORBES CIR LIC-767613 2/20/2018 1/31/2019 78640 FORBES CIR LIC-768007 12/18/2018 1/31/2020 SEELEY DR 44950 SEELEY DR LIC-766776 11/20/2018 11/30/2019 VIA CALIENTE 78345 VIA CALIENTE UC-763961 �Lll/2019 3/31/2020 78365 VIA CALIENTE LIC-767147 3/13/2019 3/31/2020 VIA CORONADO 44290 VIA CORONADO LIC-0103604 -2/J,5.L20l_9 3/31/2020 44325 VIA CORONADO LIC-767937 4/22/2019 3/31/2020 VIA DEL MONTE None VIA DEL SOL None VIA SEVILLA 78340 VIA SEVILLA LIC-0108473 • 3L22l2019 3/31/2020 78430 VIA SEVILLA LIC-0110722 3L21L2019 3/31/2020 78485 VIA SEVILLA LIC-763192 � 3L22L20lt 3/31/2020 78390 VIA SEVILLA LIC-765699 u2s/2019 3/31/2020 78450 VIA SEVILLA LIC-765778 -3./25/.20.19 3/31/2020 78380 VIA SEVILLA LIC-767868 3/25/2019 3/31/2020 VIA VENICE None COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY NEETA QUINN STUDY SESSION NO. 1 - COMMENT LETTER Agend� 21 advocates are now calling single-family neighborhood ... https ://mail.ao l.com/webmail-std/en-us/PrintMessage I of6 From: American Policy Center <contact@americanpolicy.org> To: Neeta Quinn <cnquinn@aol.com> Subject: Agenda 21 advocates are now calling single-family neighborhoods RACIST! Date: Wed, Sep 11, 201910:38 am Hello Neeta, View this emall In your browser cd,._merican ®Eio Center 30 Years Leading the Fight For American Property Rights & Sovereignty The attack on private property is growing across the country at a frightening rate. And the target is single-family homes -most likely·· your home. I have warned in recent weeks that Sustainable Development/ Agenda 21 advocates are now calling zoning for single-family neighborhoods RACIST! Minneapolis, Minnesota became the first city to end single-family zoning as the Mayor called such protections "self-segregation" devised as a legal way to keep black Americans and other minorities from moving into certain neighborhoods. Unbelievable! Seattle, Washington followed Minneapolis. Other cities are looking into such plans. The federal agency HUD is pushing such plans under the Obama program called Affirmatively Furthering Fair Housing (AFFH). And city after , city are taking HUD grants that force them to impose such plans. So, attacks on single-family homes are racing acrnss the nation. Now Q[egon is about to become the first state to eliminate single family zoning across the state ... Please help me continue to lead the fight to protect private property rights! DONATE NOW The speaker of the Oregon House, Rep. Tina Kotek, says this action is urgent because Oregon has a "housing crisis." That is bunk! Oregon has a government-made crisis. For over 20 years Oregon has been enforcing "Urban Growth Boundaries" (UGB) around its cities. This is part of the Sustainable "Smart Growth" policy. As I have told my audiences around the nation, under Smart Growth, planners put an artificial line around the city and declare NO GROWTH will 9/12/2019. 9:46 AM COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY NEETA QUINN STUDY SESSION NO. 1 - COMMENT LETTER Agenda 21 advocates are now calling single-family neighborhood ... https :/ Imai I. ao I. com/webmai I-std/en-us/ PrintMessage 2 of6 take place outside that line. That's "Urban Sprawl!" And the planners insist that urban sprawl is a danger to the environment because it encourages the use of automobiles, strip malls, and the need for infrastructure like roads and power. We used to call that building an economy until the Sustainablists declared war on human society! Here's what they didn't count on. The UGBs assure the area of the city doesn't expand. But what happens when the population does? The only way to grow is UP! That means there is no room for single family homes with backyards for the kids. According to the rhetoric of the Sustainablists the only solution is to flood single-family neighborhoods with duplexes, triplexes, fourplexes, and "cottage clusters." They call this "up zoning." Says Oregon House Speaker Kotek, "The state's housing crisis requires a combination of bolder strategies." I love how these control freaks always use the words "bolder", "innovative", and "master plan" to make their destructive policies sound urgent and brave! The truth is they are pushing their own political agenda, and when they get caught by their unworkable plans, they pretend to offer a solution to their own idiotic regulations --which they created. For example, Portland Oregon has long been the poster child -the shining example --of the genius of Smart Growth praised in government and environmental meetings across the country. Smart Growth is an utter failure as property rights have been destroyed, housing costs have skyrocketed and now there is a housing crisis! Why? Because over the years, under Smart Growth, Portland's population has grown by over 80%. But legislators have only allowed the Urban Growth Boundary to expand by no more than 6%! NOW PORTLAND HAS A HOUSING CRISIS AND SO WE MUST ABOLISH SELFISH, RACIST, SINGLE-FAMILY HOMES!!! Imagine what these policies will do to your property values -your equity -all that you have worked for? Most people could qu ickly figure out the problem and dump such destructive policies. But WHY can't your city councils and county commissions see the lies? Because they are surrounded -inundated -with special interest Non­ governmental Organizations (NGOs) -private groups with their own private agendas. The worst offender of this-is..t.h.e_�an Planning Association (AP�. They, 9/12/2019, 9:46 Arv COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY NEETA QUINN STUDY SESSION NO. 1 - COMMENT LETTER Agendll: 21 advocates are now calling single-family neighborhood ... https://mail.aol.com/webmail-std/en-us/PrintMessage 3 of6 or affiliated planning groups, are in nearly every single community in the nation. They have the plans and the ability to get your local officials to apply for specific grants from HUD, EPA and other federal agencies to put it all in place. I have fought the APA in city after city. I have exposed their lies and their tactics, exposing their direct ties to Agenda 21. As local citizens heard my warnings and took action to stop such plans in their communities, the APA panicked. Please help me continue to lead the fight to protect private property rlghtsl DONATE NOW The APA rushed to create an "Agenda 21 Myths and Facts" page on their website. They did all they could to hide any connections between their planning and Agenda 21. Their planning was all local, local, local, the APA insisted. They assured communities that planning "protects private property ... preserves and protects its value." They said "planning preserves neighborhoods, providing certainty to homeowners ... " Well, do you think calling single family home owners "racist" and destroying single family zoning protections "preserves" neighborhoods ---or destroys them? When they build an apartment building in your neighborhood will you feel "protected?" The truth is the American Planning Association is part of the Planners Network. The network is officially part of a group called the Organization of Progressive Planners, which is, "an association of professionals, activists, academics, and students involved in physical, social, economic and environmental planning ... " That is Agenda 21 ! On the website. www.plannersnetwork.org, you will find in its Statement of Principles this quote, "We believe planning should be a tool for allocating resources ... and eliminating the great inequalities of wealth and power in our society ... because the free market has proven incapable of doing this ... " That is social justice. Anti-free enterprise. Anti-private property. That is what every planner, working in every American city, believes!! And the APA is digging in to promote more of Agenda 21 /Sustainable Development policy which they deny exists. Right now, the APA is sponsoring a webinar series for planners and elected officials. Here are some of the subjects they are addressing. "New examples of cites approaching the challenge of climate change in creative and innovative ways," including "rethinking transportation, to 9/12/2019, 9:46 AM COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY NEETA QUINN STUDY SESSION NO. 1 - COMMENT LETTER '-\gt:nua L. 1 i:IUVOl:i:llt::S an: now 1:a11111g, :smg,11;;-1arn 11y 11tag,11uu111uuu ... 4 of6 greening city buildings, to protecting against sea-level rise ... " They go on to say the speakers at the webinars will offer guidance which "contextualizes international, national, and state mandates and goals." This is NOT local. This is NOT protection of private property. This is why you are seeing such reorganization of our local communities and counties across the nation. The American Planning Association and its NGO co-conspirators are using their LOCAL planning lies to bring every city in the United States into compliance with UN Agenda 21 /Sustainable Development policy. Let me be very clear about where this is all headed. Single-family homes are the greatest example of private property ownership. Private property is the greatest means for individuals to build personal wealth through the equity earned. That's why America grew so fast! As private property ownership is destroyed, the wealth of the nation is diminishing. Now we are hearing some economists worry about a lack of housing starts in the building industry that could lead to an economic crisis. Yet, these "experts" rarely mention the true culprit -Sustainable Development, Smart Growth government tyranny! Now, as we see more and more housing moving toward the high-rise stack and pack rental properties, a new attack is growing -this time against private owner landlords. New government regulations are raising taxes on landlords, along with higher building costs. But now, many communities are starting to impose rent controls, because it's not "fair" to make people pay so much for their homes! Here is the bottom-line goal of this attack on private property and single-family homes. If we lose this battle against Sustainable Development/Smart Growth policies, then, eventually all housing will become qovernment controlled. There will be no private homes or condos. Only government housing! A free society cannot survive that! This is the tyranny that I have dedicated my life to stopping! The American Policy Center CAPCl is the leading organization in the nation fighting to save private property. I travel the nation alerting local residents to these dangers and teaching them how to fight back. I produce articles and books and I appear on an endless number of radio and television news programs to spread the word. And APC provides tools to help local activists fight back. DONATE NOW The battle is getting intense. But more people are beginning to see the 9/12/2019, 9:46 Al\ COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY NEETA QUINN STUDY SESSION NO. 1 - COMMENT LETTER Agenda 21 advocates are now calling single-family nei ghborhood ... https :/ /mail.ao l .com/webmail-std/en-us/PrintMessage danger. I need to step up APC's efforts. I need to reach more people with the truth and the tools to stop It. I cannot fight this alone. I need you! I especially need your finan2ial support. The American Planning Association and their NGO co-conspirators have massive wealth and political power. I am so grateful for all of the help you have given me over the years. APC would not exist without you. This is the critical time! Will you stay with me now? Neeta, please help me with your immediate gift of $25, $50 or even as much as S 100. I assure you every dollar will be used to help us win this fight. In spite of the APA's power we are winning some battles. I am helping more Americans to understand the threat. I just need more fire power -your continued financial support. Please help! Yours in Freedom, Tom Deweese President DONATE NOW Our malling address Is: American Policy Center 53 Mein Street Box 3640 Warrenton, VA 20188-3640 Add uo \0 your addraa, book Want \o change how you receive these emails? You can update your praferences·or un•ubScrlbe rrnm this 11•1 COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY NEETA QUINN STUDY SESSION NO. 1 - COMMENT LETTER September 17,2019 To whom it may concern This letter is in response to the abundance of short term vacation rentals (STVR) in the North La Quinta area. I live in the Acacia La Quinta housing tract. I have owned and lived in my home for 28 years. To my knowledge there is five licensed STVR out of 20 homes on the street I live on. There is a STVR property on the street behind me kiddy corner to my backyard and STVRs on the street behind it. I am literally surrounded by STVRs. On the street I live on there have been problems with n6ise, trash, parking and to be honest the people renting these properties are strangers to us. I have communicated these issues with the hotline and the code enforcement department. During peak season on many weekends there have been numerous vehicles on the street to the point there is little if any close parking for the residents and their guests. Coachella weekend is especially problematic. Coachella 2019 there was 23-28 extra cars on the street, trash left on curb on Monday when our trash pickup day is Friday, over occupancy and of course the bump, bump, bump of music filtering through the neighborhood from renters partying. One car straddled the sidewalk the entire weekend. Last summer (2018) I left for the weekend late on a Friday morning purposely so I could bring my trash barrels in off the street after pickup. When I returned Monday both my trash barrel and recycle barrel were full! I have been awakened at all hours of the night into the wee hours of the morning from noise and partying from a STVR. There are residents in the Acacia La Quinta tract who are just as dismayed and upset as I am over this matter. Right now 2 homes on the street and a home on a street over are for sale. Two are in close proximity to my home. I'm worried as other neighbors are that these properties will also be sold for STVR properties. At what point will the city step in and limit the licenses for STVR on any given street in North La Quinta? The percentage of STVR to homes on my street at this time is 25%. I feel as do the neighbors I've spoken to that this is a quality of life and a property value issue. I know Acacia La Quinta isn't the only area in North La Quinta dealing with this issue. There are numerous complaints on the NextDoor App from residents in other housing tracks in the area about this topic. I and I'm sure other residents in the North La Quinta area would appreciate the Council, Mayor, City Manager, Planning Committee, Code Enforcement and any other department that deals with STVR to please take a look at the continued problems these properties bring to the neighborhoods including the possible devaluation of property values and to please address the concerns and complaints of the residents. Many of us know in all probability STVRs are here to stay in the city but we would like a defined saturation percentage where licenses will no longer be granted when that saturation point is reach on a street. And I for one would appreciate that number be on the low side. Please address this problem as our residential streets are being turned into Hotel Row. I feel it is blatantly unfair to us full-time residents to allow investors to buy up family homes and turn them into what are basically hotels in residential zones .. Thank you for your time addressing this matter COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY CINDY WARREN STUDY SESSION ITEM NO. 1 - COMMENT LETTER COUNCIL MEETING SEPTEMBER 17, 2019 – WRITTEN COMMENTS BY LAWRENCE BEST STUDY SESSION ITEM NO. 1 – SHORT-TERM VACATION RENTAL PROGRAM From: Lawrence Best <lbest@dc.rr.com>  Date: September 13, 2019 at 4:45:34 PM PDT  To: ssanchez@laquintaca.gov, kfitzpatrick@laquintaca.gov, rradi@laquintaca.gov,  jpena@laquintaca.gov, levans@laquintaca.gov  Subject: Study Session September 17  Honorable Mayor and City Council Members—    I have read Staff’s report regarding Short Term Vacation Rentals, and, in the spirit of  maintaining the balance between residential quality of life and property rights, I respectfully  request the Council consider the following modifications to the ordinance:    A minimum distance between STVRs to prevent a neighborhood from being overwhelmed.    A mandatory minimum rental period of seven days to prevent the problematic party houses.    A notice and opportunity to comment be provided to neighbors during the application process  to ensure the City has all pertinent information during the review process.    Thank you for your time and service.    Respectfully,  Lawrence Best    Sent from my iPhone    Michael H. Leifer Direct Dial (949) 851-7294 Direct Fax (949) 825-5412 mleifer@ptwww.com September 17, 2019 Refer To File No. 39903-000 Document I.D. 2786269.1 VIA E-MAIL Honorable Mayor and City Councilmembers of the City of La Quinta 78-495 Calle Tampico La Quinta, CA 92253 City Clerk, City of La Quinta 78-495 Calle Tampico La Quinta, CA 92253 Re: Resolution of Necessity Hearing Scheduled for September 17, 2019 Regarding Our Client, DWCG1,LLC Dear Honorable Mayor and City Councilmembers: This office represents DWCG1, LLC the owner of the real property known as Riverside County Assessor Parcel No. 600-030-018 (the Subject Property). On behalf of DWCG1, LLC, we submit this letter concerning the adoption of a resolution of necessity to acquire portions of the Subject Property. We have not been fully informed concerning the status of this project. Last week we requested a copy of the current project plans for the project. Those have not been provided in advance of this hearing on the Resolution of Necessity. As such, we are commenting, based on the limited information that we have been able to obtain concerning the proposed takings and this project. Last week, we submitted a letter to the City Manager and City Clerk. A copy of that letter is enclosed herein. As explained in that letter, the City is proposing to take a "Roadway and Public Utilities Easement" and a "Permanent Slope Easement." It is our client's position that the City should not be acquiring permanent easements and instead should acquire fee, subject to a reservation for any and all abutter's and access rights from the Subject Property remainder to and from Dune Palms Road. The proposed permanent easement takings improperly burden the private property with risk and liability. It requires the Subject Property and the private property owner to share with the City risk and liability. The point of eminent domain is for a public agency to undertake obligations and burdens for public benefit. Here, the City is taking property and imposing risk and liability on the servient tenement which is the Subject Property remainder and ownership. COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY MICHAEL LEIFER, PALMIERI TYLER PUBLIC HEARING ITEM NO. 1 - COMMENT LETTER (2) Honorable Mayor and City Councilmembers City Clerk, City of La Quinta September 17, 2019 Page 2 2786269.1 The proposed taking of permanent easements does not comport with the prerequisite that the takings and project have been located or planned in a manner compatible with the greatest public good and least private injury. Very truly yours, Michael H. Leifer MHL:ebn Enclosure cc: Jon McMillen, City Manager, City of La Quinta COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY MICHAEL LEIFER, PALMIERI TYLER PUBLIC HEARING ITEM NO. 1 - COMMENT LETTER (2) COUNCIL MEETING SEPTEMBER 17, 2019 - WRITTEN COMMENTS BY MICHAEL LEIFER, PALMIERI TYLER PUBLIC HEARING ITEM NO. 1 - COMMENT LETTER (1) POWER POINTS CITY COUNCIL MEETING SEPTEMBER 17, 2019 9/18/2019 1 City Council Meeting September 17, 2019 City Council Meeting September 17, 2019 S1 – Short-Term Vacation Rental (STVR) Program and Code Compliance Updates 1 2 9/18/2019 2 Purpose •Provide overview of Short-Term Vacation Rental (STVR) Program •Review Code compliance efforts Summary •Maintain balance between residential quality of life and property owners that host STVRs •August 2018 - Ordinance updated to clarify regulations and streamline process •STVR team formed to review and make program enhancements •Provide online application and reporting 3 4 9/18/2019 3 Background •1,290 active, registered STVRs •5% of total 24,857 dwelling units •16% increase from last year •Maintained high numbers of active, registered STVRs in summer months; attributed to recent improvements to permitting services and compliance efforts JAN FEB MARCH APRIL MAY JUNE JULY AUG 2019 832 1013 1127 1189 1245 1302 1299 1290 2018 908 971 1297 1139 1156 1070 748 750 832 1013 1127 1189 1245 1302 1299 1290 908 971 1297 1139 1156 1070 748 750 ACTIVE SHORT-TERM RENTAL PERMITS 5 6 9/18/2019 4 Background FY 2018/19 •STVR’s transient occupancy tax (TOT) received: $3.5 million •Total TOT received hotels, B&B, resort fees, STVRs: $10.6 million STVR Ordinance Updates •Property owner authorization •Provides 24/7 local contact •Clarified inspection •Increased citation fines 7 8 9/18/2019 5 STVR Program Enhancements •Added permit technician •Website updates •24/7 Hotline •Outreach •Online Services STVR Timeline COMMUNITY OUTREACH 2019 March HOA - RESIDENCE & FAIRWAYS PGA (2 meetings) 2019 April HOA - MASTERS PGA & KMIR NEWS INTERVIEW 2019 April STVR PROPERTY MANAGEMENT WORKSHOP 2019 April STVR RESIDENT WORKSHOP . 2019 May DESERT CITIES COLLABORATON CR1 9 10 9/18/2019 6 Active  Registered  STVRs Code Compliance •Collaborate w/Design & Development •Manage/monitor Hotline calls •Conduct application inspections •Respond and inspect re complaints; •Noise, Parking & Property Maintenance •Issue citations 11 12 9/18/2019 7 Hotline Calls Feburary March April May June July  August Calls 12 80 188 96 106 177 94 0 20 40 60 80 100 120 140 160 180 200 MM5 STVR Cases 2019: 324 STVR Cases2018: 238 STVR Cases 13 14 9/18/2019 8 2019- 71 (82% increase YTD)2018- 39 (63% increase) Administrative Cited Violations Enforcement •Problem properties: 17 •1.3% of total STVRs •Appeals: 10 •Suspensions: 12 Suspensions2019 Problem Properties 15 16 9/18/2019 9 Complaints Action Plan Advancements: •Identify problem properties •Ongoing staff training •Continue education through outreach •Municipal code enforcement by Code and Police •Code Officers monitor Hotline calls Future Advancements: •Refine method / resources to investigate non-licensed STVRs •Encourage program compliance •Establish on-line services •Conduct fee study 17 18 9/18/2019 10 City Council Meeting September 17, 2019 PH1 – Dune Palms Bridge Relocation Plan 19 20 9/18/2019 11 Background •Dune Palms Bridge R/W acquisition •Relocation of 3 residents •Received survey response from 3 residents •Relocation Plan circulated - no comments received •Re-approval of the plan due to non- publication of the 8-6-19 meeting notice by Desert Sun Vicinity Map •APN: 600‐030‐010 •Address: 46400 Dune  Palms Road  21 22 9/18/2019 12 Primary Objectives •Conduct relocation needs assessment •Identified replacement housing •Evaluate property acquisition impacts •Develop viable relocation solutions in accordance with State law Conclusions •Sufficient relocation alternatives exist •Sufficient funding to meet estimated costs of $227,000 23 24 9/18/2019 13 Questions? 25 26 9/18/2019 14 City Council Meeting September 17, 2019 PH2 – Dune Palms Bridge Project Resolution of Necessity Project Information •Dune Palms Bridge Project requires the following right of way: •600-300-010 (46400 Dune Palms Road) –3,040 S.F. of permanent easement –13,508 S.F. of temporary construction easement 27 28 9/18/2019 15 Project Information •Dune Palms Bridge Project requires the following right of way: •APN 600-300-018 –9,926 S.F. of permanent public utilities easement –2,848 S.F. of permanent slope easement –1,536 S.F. of temporary construction easement Project Information •Dune Palms Bridge Project requires the following right of way: •APN 600-390-033 (79440 Corporate Center Drive) –1,947 S.F. of permanent slope easement 29 30 9/18/2019 16 Project Information •2 mobile home residences impacted •1 single family dwelling impacted •Right of way negotiations began June 2019 Vicinity Map •APN: 600-030-010 –Address: 46400 Dune Palms Road •APN: 600-030-018 •APN: 600-390-033 –Address: 79440 Corporate Center Drive 31 32 9/18/2019 17 Insert two exhibit pages here  33 34 9/18/2019 18 Fiscal Impact •Appraisal value of property to be acquired is $850,274 •Appraisal value of two mobile home coaches is $79,100 •Estimated relocation costs are $227,000 •Actual acquisition and relocation expenses now determined by condemnation process Summary •Council to ratify relocation plan adoption from August 6, 2019 •City in escrow for two impacted mobile home units •City in escrow for commercial property easements 35 36 9/18/2019 19 Summary •Resolution of Necessity required for eminent domain proceedings •Project reviewed under a Mitigated Negative Declaration under CEQA •City Council must make the required findings QUESTIONS? 37 38 9/18/2019 20 39