Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
2020 07 07 Council
CITY COUNCIL AGENDA 1 JULY 7, 2020 CITY COUNCIL AGENDA CITY HALL COUNCIL CHAMBER 78495 Calle Tampico, La Quinta REGULAR MEETING ON TUESDAY, JULY 7, 2020 3:00 P.M. CLOSED SESSION | 4:00 P.M. OPEN SESSION ****************************** SPECIAL NOTICE Teleconferencing and Telephonic Accessibility In Effect Pursuant to Executive Orders N-25-20, N-29-20, N-33-20, and N-35-20, executed by the Governor of California in response to the state of emergency relating to novel coronavirus disease 2019 (COVID-19) and enabling teleconferencing accommodations by suspending or waiving specified provisions in the Ralph M. Brown Act (Government Code § 54950 et seq.), members of the City Council, the City Manager, City Attorney, City Staff, and City Consultants may participate in this meeting by teleconference. Members of the public wanting to listen to the open session of this meeting may do so by tuning-in live via http://laquinta.12milesout.com/video/live. Members of the public wanting to address the City Council during the open session, either for public comment or for a specific agenda item, or both, may do so in person or via teleconference by sending an email notification to the La Quinta City Clerk’s Office at CityClerkMail@LaQuintaCA.gov, and specifying the following information: 1) Full Name 4) Public Comment or Agenda Item Number 2) City of Residence 5) Subject 3) Phone Number 6) Written or Verbal Comments The email “subject line” must clearly state “Written Comments” or “Verbal Comments.” City Council agendas and staff reports are available on the City’s web page: www.LaQuintaCA.gov CITY COUNCIL AGENDA 2 JULY 7, 2020 Verbal public comments via teleconference – requests to speak must be emailed to the City Clerk no later than 3:00 p.m. on the day of the meeting; the City will facilitate the ability for a member of the public to be audible to the City Council and general public for the item(s) by contacting him/her via phone and queuing him/her to speak during the discussion. Only one person at a time may speak by telephone and only after being recognized by the Mayor. Written public comments must be received by the City Clerk’s Office no later than 3:00 p.m. on the day of the meeting, and will be distributed to the City Council, incorporated into the agenda packet and public record of the meeting, and will not be read during the meeting unless, upon the request of the Mayor, a brief summary of any public comment is asked to be read, to the extent the City Clerk’s Office can accommodate such request. ****************************** CALL TO ORDER ROLL CALL: Councilmembers: Fitzpatrick, Peña, Radi, Sanchez, Mayor Evans PUBLIC COMMENT ON MATTERS NOT ON THE AGENDA At this time, members of the public may address the City Council on any matter not listed on the agenda. Please complete a "Request to Speak" form and limit your comments to three minutes. The City Council values your comments; however in accordance with State law, no action shall be taken on any item not appearing on the agenda unless it is an emergency item authorized by GC 54954.2(b). CONFIRMATION OF AGENDA CLOSED SESSION 1. THREAT TO PUBLIC SERVICES OR FACILITIES, PURSUANT TO SUBDIVISION (a) OF GOVERNMENT CODE SECTION 54957. CONSULTATION WITH: ALEXANDER JOHNSTON, SENIOR EMERGENCY MANAGEMENT COORDINATOR; WILLIAM H. IHRKE, CITY ATTORNEY 2. CONFERENCE WITH LEGAL COUNSEL – ANTICIPATED LITIGATION; SIGNIFICANT EXPOSURE TO LITIGATION PURSUANT TO PARAGRAPH (2) OR (3) OF SUBDIVISION (d) OF GOVERNMENT CODE SECTION 54956.9 (NUMBER OF POTENTIAL CASES: 1) CITY COUNCIL AGENDA 3 JULY 7, 2020 RECESS TO CLOSED SESSION RECONVENE AT 4:00 P.M. REPORT ON ACTIONS(S) TAKEN IN CLOSED SESSION PLEDGE OF ALLEGIANCE PUBLIC COMMENT ON MATTERS NOT ON THE AGENDA At this time, members of the public may address the City Council on any matter not listed on the agenda. Please complete a "Request to Speak" form and limit your comments to three minutes. The City Council values your comments; however in accordance with State law, no action shall be taken on any item not appearing on the agenda unless it is an emergency item authorized by GC 54954.2(b). ANNOUNCEMENTS, PRESENTATIONS, AND WRITTEN COMMUNICATIONS 1. “HIKES FOR HOPE” CERTIFICATES OF RECOGNITION COMMENDING THE DEDICATION AND COMMITMENT OF JACKSON KULEVICH, ALEXANDRA KULEVICH, AND CAROLINE KULEVICH TO THE LA QUINTA COMMUNITY TO PROMOTE HEALTH AND FITNESS, AND RAISE FUNDS FOR CHARITIES DURING THE COVID-19 PANDEMIC 2. COACHELLA VALLEY MOSQUITO AND VECTOR CONTROL DISTRICT PRESENTATION ON MOSQUITO TREATMENTS IN LA QUINTA BY PUBLIC INFORMATION OFFICER TAMMY GORDON 3. 2019 INDIAN WELLS LA QUINTA IRONMAN 70.3 TRIATHLON ECONOMIC IMPACT SUMMARY PRESENTATION BY PRESIDENT/CEO SCOTT WHITE AND CHIEF SALES/MARKETING OFFICER COLLEEN PACE WITH THE GREATER PALM SPRINGS CONVENTION AND VISITORS BUREAU; AND 2020 INDIAN WELLS LA QUINTA IRONMAN 70.3 TRIATHLON NEW SAFETY RACING GUIDELINES DUE TO COVID-19 PRESENTATION BY SENIOR REGIONAL DIRECTOR PAUL HUDDLE AND RACE DIRECTOR SABRINA HOUSTON WITH IRONMAN 4. PROCLAMATION RECOGNIZING EXECUTIVE ASSISTANT WANDA WISE- LATTA FOR HER 21-YEARS OF DEDICATED PUBLIC SERVICE 5. PROCLAMATION RECOGNIZING ADMINISTRATIVE ASSISTANT ANNA ORTIZ FOR HER 30-YEARS OF DEDICATED PUBLIC SERVICE 6. CITY CLERK ASSOCIATION OF CALIFORNIA 2020 PRESIDENT’S SPECIAL AWARD OF DISTINCTION TO CITY CLERK MONIKA RADEVA FOR BEING A DIFFERENCE MAKER AND KEY INFLUENCER CITY COUNCIL AGENDA 4 JULY 7, 2020 CONSENT CALENDAR NOTE: Consent Calendar items are routine in nature and can be approved by one motion. PAGE 1. AUTHORIZE THE PUBLIC WORKS DEPARTMENT TO UTILIZE CREATIVE LIGHTING & ELECTRICAL, INC., FOR UP TO $100,000 OF ADDITIONAL NON-CONTRACTED MAINTENANCE AND/OR REPAIR ITEMS IN FISCAL YEAR 2020/21 WHEN THEY ARE THE QUALIFIED BIDDER 9 2. AUTHORIZE THE PUBLIC WORKS DEPARTMENT TO UTILIZE VINTAGE ASSOCIATES, INC FOR UP TO $100,000 OF ADDITIONAL NON- CONTRACTED MAINTENANCE AND/OR REPAIR ITEMS IN FISCAL YEAR 2020/21 WHEN THEY ARE THE QUALIFIED BIDDER 11 3. AUTHORIZE THE PUBLIC WORKS DEPARTMENT TO UTILIZE PWLC II, INC. FOR UP TO $100,000 OF ADDITIONAL WORK IN FISCAL YEAR 2020/21, AS A SINGLE SOURCE FOR MEDIAN LANDSCAPE RESTORATION WITHIN THE LIGHTING AND LANDSCAPE ASSESSMENT DISTRICT 89-1 AND FOR EXTRA WORK WHERE THEY ARE THE QUALIFIED BIDDER 13 4. APPROVE AGREEMENT FOR CONTRACT SERVICES WITH VANIR FOR FEDERAL EMERGENCY MANAGEMENT ASSISTANCE PROJECT ADMINISTRATION SERVICES 15 5. APPROVE CHANGE ORDERS NO. 9 AND NO. 10 TO CONTRACT WITH URBAN HABITAT FOR THE SILVERROCK PARK VENUE PROJECT NO. 2016-08 FOR ALONGI BUILDING PAD AND MISCELLANEOUS ADDITIONAL WORK REQUESTS 75 6. APPROVE GRANT OF EASEMENTS TO COACHELLA VALLEY WATER DISTRICT FOR ACCESS AND MAINTENANCE OF WATER PIPELINES AND FIRE HYDRANT FACILITIES LOCATED WITHIN THE SILVERROCK DEVELOPMENT 85 7. ACCEPT HIGHWAY SAFETY IMPROVEMENTS PROGRAM CITYWIDE FIBER OPTIC SIGNAL INTERCONNECT PROJECT NO. 2016-02, FEDERAL PROJECT NO. HSIPL-5433(017) 91 8. ADOPT RESOLUTION DESIGNATING SPEED LIMITS FOR AVENUE 52 FROM DESERT CLUB DRIVE TO AVENIDA BERMUDAS, AND AVENUE 52 FROM AVENIDA BERMUDAS TO EISENHOWER DRIVE [RESOLUTION NO. 2020-024] 95 CITY COUNCIL AGENDA 5 JULY 7, 2020 9. APPROVE DEMAND REGISTER REPORTS FOR JUNE 12, 19, AND 26, 2020 99 10. ADOPT RESOLUTION TO APPROVE A PUBLIC INTEREST FINDING TO RATIFY THE SELECT SOURCE CONTRACT EXTENSION OF BENGAL ENGINEERING TO COMPLETE THE ENGINEERING PHASE OF THE DUNE PALMS ROAD BRIDGE IMPROVEMENT PROJECT NO. 2011-05, FEDERAL AID PROJECT NO. BRLKS 5433 (014) [RESOLUTION NO. 2020-025] 123 BUSINESS SESSION PAGE 1. APPROVE CANCELING THE REGULAR CITY COUNCIL MEETINGS OF AUGUST 18 AND SEPTEMBER 1, 2020 13 2. APPROVE ROUND IV COVID-19 SMALL BUSINESS EMERGENCY ECONOMIC RELIEF PROGRAM FOR LA QUINTA BUSINESSES IMPACTED BY COVID-19 13 STUDY SESSION – NONE PUBLIC HEARINGS – after 5:00 p.m. For all Public Hearings on the agenda, a completed “Request to Speak” form must be filed with the City Clerk prior to consideration of that item. A person may submit written comments to City Council before a public hearing or appear in support or opposition to the approval of a project(s). If you challenge a project(s) in court, you may be limited to raising only those issues you or someone else raised at the public hearing or in written correspondence delivered to the City at, or prior to the public hearing. PAGE 1. CONTINUED FROM MAY 5, 2020: ADOPT RESOLUTIONS TO ADOPT MITIGATED NEGATIVE DECLARATION AND MITIGATED MONITORING AND REPORTING PROGRAM FOR ENVIRONMENTAL ASSESSMENT 2017-0006, AND APPROVE SPECIFIC PLAN 2017-0002 AMENDMENT NO. 2, TENTATIVE PARCEL MAP 2017-0003, AND SITE DEVELOPMENT PERMIT 2017-0009 PROPOSING AN APPROXIMATELY 125,000 SQUARE-FOOT SUPERMARKET WITH ASSOCIATED VEHICLE FUEL CENTER; CEQA: THE DESIGN AND DEVELOPMENT DEPARTMENT HAS PREPARED A MITIGATE NEGATIVE DECLARATION UNDER THE CALIFORNIA ENVIRONMENTAL QUALITY ACT; LOCATION: NORTHWEST CORNER OF AVENUE 50 AND JEFFERSON STREET; 141 CITY COUNCIL AGENDA 6 JULY 7, 2020 PROJECT: PAVILION PALMS SHOPPING CENTER [RESOLUTION NOS. 2020-026 AND 2020-027] DEPARTMENTAL REPORTS 1. CITY MANAGER – MARKETING QUARTERLY REPORT – APRIL THROUGH JUNE 2020 485 2. CITY ATTORNEY 3. CITY CLERK 4. COMMUNITY RESOURCES 5. DESIGN AND DEVELOPMENT 6. FINANCE 7. PUBLIC WORKS MAYOR’S AND COUNCIL MEMBERS’ ITEMS REPORTS AND INFORMATIONAL ITEMS 1. CVAG CONSERVATION COMMISSION (Evans) 2. CVAG ENERGY AND ENVIRONMENTAL RESOURCES COMMITTEE (Evans) 3. CVAG EXECUTIVE COMMITTEE (Evans) 4. GREATER PALM SPRINGS CONVENTION AND VISITORS BUREAU (Evans) 5. LEAGUE OF CALIFORNIA CITIES DELEGATE (Evans) 6. COACHELLA VALLEY WATER DISTRICT JOINT POLICY COMMITTEE (Evans) 7. SOUTHERN CALIFORNIA ASSOCIATION OF GOVERNMENTS (Evans) 8. ECONOMIC DEVELOPMENT SUBCOMMITTEE (Evans & Peña) 9. COACHELLA VALLEY MOUNTAINS CONSERVANCY (Fitzpatrick) 10. DESERT RECREATION DISTRICT COMMITTEE (Fitzpatrick & Radi) 11. COACHELLA VALLEY UNIFIED SCHOOL DISTRICT COMMITTEE (Fitzpatrick & Peña) 12. RIVERSIDE COUNTY TRANSPORTATION COMMISSION (Fitzpatrick) 13. SILVERROCK EVENT SITE AD HOC COMMITTEE (Fitzpatrick) 14. CANNABIS AD HOC COMMITTEE (Peña and Sanchez) 15. CVAG PUBLIC SAFETY COMMITTEE (Peña) 16. CVAG VALLEY-WIDE HOMELESSNESS COMMITTEE (Peña) 17. LEAGUE OF CALIFORNIA CITIES – PUBLIC SAFETY POLICY COMMITTEE (Peña) 18. IMPERIAL IRRIGATION DISTRICT – ENERGY CONSUMERS ADVISORY COMMITTEE (Peña) 19. COVID-19 SMALL BUSINESS EMERGENCY ECONOMIC RELIEF PROGRAM AD HOC COMMITTEE (Peña and Radi) 20. CVAG TRANSPORTATION COMMITTEE (Radi) 21. SUNLINE TRANSIT AGENCY (Radi) 22. CITYWIDE SECURITY CAMERAS AD HOC COMMITTEE (Radi) 23. DESERT SANDS UNIFIED SCHOOL DISTRICT COMMITTEE (Radi & Sanchez) CITY COUNCIL AGENDA 7 JULY 7, 2020 24. ANIMAL CAMPUS COMMISSION (Sanchez) 25. LEAGUE OF CALIFORNIA CITIES – TRANSPORTATION, COMMUNICATION AND PUBLIC WORKS POLICY COMMITTEE (Sanchez) 26. GREATER CV CHAMBER OF COMMERCE INFORMATION EXCHANGE COMMITTEE (Sanchez) 27. RIVERSIDE LOCAL AGENCY FORMATION COMMISSION (Sanchez) 28. PLANNING COMMISSION MEETING MINUTES DATED MAY 26, 2020 489 ADJOURNMENT ********************************* The next regular meeting of the City Council will be held on July 21, 2020 at 4:00 p.m. at the City Hall Council Chambers, 78495 Calle Tampico, La Quinta, CA 92253. DECLARATION OF POSTING I, Monika Radeva, City Clerk, of the City of La Quinta, do hereby declare that the foregoing Agenda for the La Quinta City Council meeting was posted on the City’s website, near the entrance to the Council Chambers at 78495 Calle Tampico, and the bulletin boards at the Stater Brothers Supermarket at 78630 Highway 111, and the La Quinta Cove Post Office at 51321 Avenida Bermudas, on July 3, 2020. DATED: July 2, 2020 MONIKA RADEVA, City Clerk City of La Quinta, California Public Notices xThe La Quinta City Council Chamber is handicapped accessible. If special equipment is needed for the hearing impaired, please call the City Clerk’s office at (760) 777-7092, twenty-four (24) hours in advance of the meeting and accommodations will be made. xIf special electronic equipment is needed to make presentations to the City Council, arrangements should be made in advance by contacting the City Clerk’s office at (760) 777-7092. A one (1) week notice is required. CITY COUNCIL AGENDA 8 JULY 7, 2020 xIf background material is to be presented to the Councilmembers during a City Council meeting, please be advised that eight (8) copies of all documents, exhibits, etc., must be supplied to the City Clerk for distribution. It is requested that this take place prior to the beginning of the meeting. xAny writings or documents provided to a majority of the City Council regarding any item(s) on this agenda will be made available for public inspection at the Community Development counter at City Hall located at 78495 Calle Tampico, La Quinta, California, 92253, during normal business hours. City of La Quinta CITY COUNCIL MEETING: July 7, 2020 STAFF REPORT AGENDA TITLE: AUTHORIZE THE PUBLIC WORKS DEPARTMENT TO UTILIZE CREATIVE LIGHTING & ELECTRICAL, INC., FOR UP TO $100,000 OF ADDITIONAL NON-CONTRACTED MAINTENANCE AND/OR REPAIR ITEMS IN FISCAL YEAR 2020/21 WHEN THEY ARE THE QUALIFIED BIDDER RECOMMENDATION Authorize the Public Works Department to utilize Creative Lighting & Electrical, Inc., for up to $100,000 for additional non-contracted maintenance and/or repair items in fiscal year 2020/21 when they are the qualified bidder. EXECUTIVE SUMMARY x Per the purchasing policy, amounts paid to vendors/contractors over $50,000 must be approved by Council. x On May 19, 2020, Council approved a one-year contract extension with Creative Lighting & Electrical, Inc., (Creative) for Project No 2018-30 Landscape & Lighting Assessment District (L&L) Lighting Maintenance Services. x Staff requests Authority to utilize Creative for up to $100,000 of additional work should they submit a qualified bid. FISCAL IMPACT The $100,000 would be charged in increments, as needed, to the appropriate budgeted account(s) should Creative be awarded any other bid in 2020/21. BACKGROUND/ANALYSIS Creative provides quality work and is contracted with the City for lighting maintenance services. The L&L lighting maintenance contract allows for additional work, such as light fixture replacement, and electrical repairs on request, however, the dollar amount for additional work is dependent on the scope of work identified rather than a specific amount incorporated in the contract. Creative may also submit bids for project and/or additional work which is included in the 2020/21 budget, such as vandalism repair, and/or electrical repairs and upgrades in Citywide parks and buildings which is not included in their contract. CONSENT CALENDAR ITEM NO. 9 Staff requests authorization to utilize Creative for an additional $100,000 for work over the contract price, should they be the qualified bidder. Each project would be subject to the City’s current purchasing policy. Creative could also perform emergency repairs, and/or a variety of other electrical work and comply with prevailing wage requirements. ALTERNATIVES Staff could request approval from Council for any future work awarded to Creative on a per project basis. However, this approach will delay work schedules. Prepared by: Dianne Hansen, Management Analyst Approved by: Bryan McKinney, Public Works Director/City Engineer 10 City of La Quinta CITY COUNCIL MEETING: July 7, 2020 STAFF REPORT AGENDA TITLE: AUTHORIZE THE PUBLIC WORKS DEPARTMENT TO UTILIZE VINTAGE ASSOCIATES, INC FOR UP TO $100,000 OF ADDITIONAL NON-CONTRACTED MAINTENANCE AND/OR REPAIR ITEMS IN FISCAL YEAR 2020/21 WHEN THEY ARE THE QUALIFIED BIDDER RECOMMENDATION Authorize the Public Works Department to utilize Vintage Associates, Inc., for up to $100,000 of additional non-contracted maintenance, and/or repair items in fiscal year 2020/21 when they are the qualified bidder. EXECUTIVE SUMMARY x Per the purchasing policy, amounts paid to vendors/contractors over $50,000 must be approved by Council. x On May 19, 2020, Council approved a one-year contract extension with Vintage Associates, Inc. (Vintage) for Project No 2018-32 Parks Landscape Maintenance Services Contract (Fontract). The Fontract allows for additional work. x Staff requests Authority to utilize Vintage for additional work outside of the Fontract should Vintage submit a qualified bid. FISCAL IMPACT The cost for additional work would be charged in increments up to $100,000, as needed, to the appropriate budgeted account(s) should Vintage be awarded any other bid in 2020/21. BACKGROUND/ANALYSIS Vintage provides quality work and is contracted with the City for Citywide Park Landscape Maintenance. The Fontract allows for additional work, such as top dressing on sports fields, plant replacement on request, and irrigation repairs, however, the dollar amount for additional work is not specified or incorporated in the contract. Vintage may also submit bids for extra work which is included in the 2020/21 budget but is not included in their contract. CONSENT CALENDAR ITEM NO. 11 Staff requests authorization to utilize Vintage for an additional $100,000 for work over the contract price should Vintage be the qualified bidder in 2020/21, each project would be subject to the City’s current purchasing policy. Vintage is able to perform additional work such as irrigation, turf, and landscape restoration, and comply with prevailing wage requirements. ALTERNATIVES Staff could request approval from Council for any extra future work awarded to Vintage on a per project basis. However, this approach will delay work schedules. Prepared by: Dianne Hansen, Management Analyst Approved by: Bryan McKinney, Public Works Director/City Engineer 12 City of La Quinta CITY COUNCIL MEETING: July 7, 2020 STAFF REPORT AGENDA TITLE: AUTHORIZE THE PUBLIC WORKS DEPARTMENT TO UTILIZE PWLC II, INC. FOR UP TO $100,000 OF ADDITIONAL WORK IN FISCAL YEAR 2020/21, AS A SINGLE SOURCE FOR MEDIAN LANDSCAPE RESTORATION WITHIN THE LIGHTING & LANDSCAPE ASSESSMENT DISTRICT 89-1 AND FOR EXTRA WORK WHERE THEY ARE THE QUALIFIED BIDDER RECOMMENDATION Authorize the Public Works Department to utilize PWLC II, Inc. for up to $100,000 of additional work during fiscal year 2020/21, as a single source for median landscape restoration within the Lighting & Landscape Assessment District 89-1, and for extra work where they are the qualified bidder. EXECUTIVE SUMMARY x Per the purchasing policy, amounts paid to vendors/contractors over $50,000 must be approved by Council. x On May 19, 2020, Council approved a one-year contract extension with PWLC II, Inc. (PWLC) for Project No 2018-30 Lighting & Landscape Assessment District 89-1 (L&L) Landscape Maintenance Services. x The current contract allows for the contractor to be paid for additional work. Staff requests authority to utilize PWLC for additional work, and as a single source for landscape renovations within L&L areas. x Staff requests Authority to utilize PWLC for up to $100,000 of additional work. FISCAL IMPACT The $100,000 would be charged in increments, as needed, to the appropriate budgeted account(s) for landscape renovation within the L&L areas, should PWLC be awarded any other bid in 2020/21. BACKGROUND/ANALYSIS PWLC provides quality work and is contracted with the City for L&L landscape maintenance services. &216(17CALENDAR ITEM NO. 13 The landscape contract allows for additional work on request, such as plant replacement, tree removal, irrigation repairs, and emergency callouts. However, the dollar amount for additional work is not specified. To ensure consistency of landscape renovations, staff requests authorization to utilize PWLC as a single source for landscape renovations within the L&L. PWLC may also submit proposals for other City projects such as Capital Improvement Projects, or weed abatement, which are included in the 2020/21 budget but is not included in their contract. Staff requests authorization to utilize PWLC for an additional $100,000 of work over the contract price for median restoration and/or for proposals submitted for work where PWLC would be the qualified bidder in 2020/21. Each project would be subject to the City’s current purchasing policy. PWLC is able to perform additional work for weed abatement, irrigation installation and/or repair, turf renovation, and landscape restoration for any City project, and comply with prevailing wage requirements. ALTERNATIVES Staff could request approval from Council for any future work awarded to PWLC on a per project basis. However, this approach will delay project completion schedules. Prepared by: Dianne Hansen, Management Analyst Approved by: Bryan McKinney, Public Works Director/City Engineer 14 City of La Quinta CITY COUNCIL MEETING: July 7, 2020 STAFF REPORT AGENDA TITLE: APPROVE AGREEMENT FOR CONTRACT SERVICES WITH VANIR FOR FEDERAL EMERGENCY MANAGEMENT ASSISTANCE PROJECT ADMINISTRATION SERVICES RECOMMENDATION Approve Agreement for Contract Services with Vanir for Federal Emergency Management Assistance project administration services; and authorize the City Manager to execute the agreement. EXECUTIVE SUMMARY x As a result of the COVID-19 pandemic, the City declared a local state of emergency and subsequently filed for Federal Emergency Management Assistance (FEMA). x The City issued a Request for Proposals (RFP) for FEMA project administration services on April 24, 2020; six proposals were received. x Two Financial Advisory Commissioners (FAC) and three staff members served on the review and selection committee. x Upon Council approval, Vanir (Consultant) will work with City staff to identify and report all FEMA eligible reimbursements. FISCAL IMPACT Due to the nature of the work, the final contract will be paid for by time and materials not to exceed in accordance with the approved rates. The contract value shall not exceed $200,000 (ceiling price) during the term of the agreement (three years from the date of execution). This Contract will be partially reimbursed by FEMA Public Assistance Funding as authorized under the appropriate Presidential Emergency Declaration. Non-reimbursable costs are anticipated to be up to $50,000 and shall be paid for by the General Fund in the appropriate fiscal year using the Finance departments professional services budget (Account No. 101-1006-60103). BACKGROUND/ANALYSIS The City sought a qualified third-party consulting firm to manage the documentation associated with the COVID-19 pandemic. Following the State of California emergency declaration (March 4, 2020), the City declared a local state of emergency on March 17, 2020 and subsequently filed for CONSENT CALENDAR ITEM NO. 4 15 Federal Emergency Management Assistance (FEMA) on March 22, 2020. In addition, on March 8, 2020, the Riverside County Public Health Officer declared a local health emergency based on an imminent threat to public health from the introduction of COVID-19 in the County of Riverside. The RFP was issued for FEMA Project Administration Services on April 24, 2020 and posted to the City’s website, advertised in the local newspaper, and a municipal finance agency website with a deadline of May 15, 2020. Six proposals were received, and three firms were interviewed on June 11, 2020. The review and selection committee included two Financial Advisory Commission members (Commissioners Mills and Twohey), three City staff members (Finance Director, Account Technician, and Senior Emergency Management Coordinator); the Vanir firm was selected Vanir (Consultant) has a local office in Indio, CA and has demonstrated experience in helping local governments identify and advocate for full federal reimbursements including providing additional auditing support services. Staff training will also be provided as part of the information gathering and reporting process. The City has been tracking payroll, supply expenses, and donations associated with the incident. However, additional follow up documentation and the organization of such documentation is required. City Staff continues to adhere to all current Personnel, Purchasing, Cash Handling, and Accounts Receivables Policies. The Consultant shall not be responsible for verification of Policy adherence. Adherence to Policies will be the responsibility of City Staff. City Staff shall also be responsible for monitoring all FEMA, Federal, State, County and Local pronouncements regarding COVID-19. These pronouncements shall govern the scope of work provided to the Consultant. These services are desired because applicable Federal laws, regulations, executive orders, and FEMA requirements vary vastly from routine reporting and tracking requirements. In addition, the Finance Department does not currently have the staffing capacity to undertake this additional assignment. ALTERNATIVES Council may deny this request or direct staff to prepare a new RFP. However, that may cause a delay in FEMA reimbursements. Prepared by: Karla Romero, Finance Director Approved by: Jon McMillen, City Manager Attachment: 1. Agreement for Contract Services 16 AGREEMENT FOR CONTRACT SERVICES THIS AGREEMENT FOR CONTRACT SERVICES (the “Agreement”) is made and entered into by and between the CITY OF LA QUINTA, (“City”), a California municipal corporation, and Vanir Construction Management, Inc., a California corporation (“Contracting Party”). The parties hereto agree as follows: 1. SERVICES OF CONTRACTING PARTY. 1.1 Scope of Services. In compliance with all terms and conditions of this Agreement, Contracting Party shall provide those services related to Project Management of Federal Emergency Management Agency documentation, as specified in the “Scope of Services” attached hereto as “Exhibit A” and incorporated herein by this reference (the “Services”). Contracting Party represents and warrants that Contracting Party is a provider of first-class work and/or services and Contracting Party is experienced in performing the Services contemplated herein and, in light of such status and experience, Contracting Party covenants that it shall follow industry standards in performing the Services required hereunder, and that all materials, if any, will be of good quality, fit for the purpose intended. For purposes of this Agreement, the phrase “industry standards” shall mean those standards of practice recognized by one or more first-class firms performing similar services under similar circumstances. 1.2 Compliance with Law. All Services rendered hereunder shall be provided in accordance with all ordinances, resolutions, statutes, rules, regulations, and laws of the City and any Federal, State, or local governmental agency of competent jurisdiction. 1.3 Wage and Hour Compliance, Contracting Party shall comply with applicable Federal, State, and local wage and hour laws. 1.4 Licenses, Permits, Fees and Assessments. Except as otherwise specified herein, Contracting Party shall obtain at its sole cost and expense such licenses, permits, and approvals as may be required by law for the performance of the Services required by this Agreement, including a City of La Quinta business license. Contracting Party and its employees, agents, and subcontractors shall, at their sole cost and expense, keep in effect at all times during the term of this Agreement any licenses, permits, and approvals that are legally required for the performance of the Services required by this Agreement. Contracting Party shall have the sole obligation to pay for any fees, assessments, and taxes, plus applicable penalties and interest, which may be imposed by law and arise from or are necessary for the performance of the Services required by this Agreement, and shall indemnify, defend (with counsel selected by City), and hold City, its elected officials, officers, $77$&+0(17 17 -2- employees, and agents, free and harmless against any such fees, assessments, taxes, penalties, or interest levied, assessed, or imposed against City hereunder. Contracting Party shall be responsible for all subcontractors’ compliance with this Section. 1.5 Familiarity with Work. By executing this Agreement, Contracting Party warrants that (a) it has thoroughly investigated and considered the Services to be performed, (b) it has carefully considered how the Services should be performed, and (c) it fully understands the facilities, difficulties, and restrictions attending performance of the Services under this Agreement. Should Contracting Party discover any latent or unknown conditions materially differing from those inherent in the Services or as represented by City, Contracting Party shall immediately inform City of such fact and shall not proceed except at Contracting Party’s risk until written instructions are received from the Contract Officer, or assigned designee (as defined in Section 4.2 hereof). 1.6 Standard of Care. Contracting Party acknowledges and understands that the Services contracted for under this Agreement require specialized skills and abilities and that, consistent with this understanding, Contracting Party’s work will be held to an industry standard of quality and workmanship. Consistent with Section 1.5 hereinabove, Contracting Party represents to City that it holds the necessary skills and abilities to satisfy the industry standard of quality as set forth in this Agreement. Contracting Party shall adopt reasonable methods during the life of this Agreement to furnish continuous protection to the Services performed by Contracting Party, and the equipment, materials, papers, and other components thereof to prevent losses or damages, and shall be responsible for all such damages, to persons or property, until acceptance of the Services by City, except such losses or damages as may be caused by City’s own negligence. The performance of Services by Contracting Party shall not relieve Contracting Party from any obligation to correct any incomplete, inaccurate, or defective work at no further cost to City, when such inaccuracies are due to the negligence of Contracting Party. 1.7 Additional Services. In accordance with the terms and conditions of this Agreement, Contracting Party shall perform services in addition to those specified in the Scope of Services (“Additional Services”) only when directed to do so by the Contract Officer, or assigned designee, provided that Contracting Party shall not be required to perform any Additional Services without compensation. Contracting Party shall not perform any Additional Services until receiving prior written authorization (in the form of a written change order if Contracting Party is a contractor performing the Services) from the Contract Officer, or assigned designee, incorporating therein any 18 -3- adjustment in (i) the Contract Sum, and/or (ii) the time to perform this Agreement, which said adjustments are subject to the written approval of Contracting Party. It is expressly understood by Contracting Party that the provisions of this Section shall not apply to the Services specifically set forth in the Scope of Services or reasonably contemplated therein. It is specifically understood and agreed that oral requests and/or approvals of Additional Services shall be barred and are unenforceable. Failure of Contracting Party to secure the Contract Officer’s, or assigned designee’s written authorization for Additional Services shall constitute a waiver of any and all right to adjustment of the Contract Sum or time to perform this Agreement, whether by way of compensation, restitution, quantum meruit, or the like, for Additional Services provided without the appropriate authorization from the Contract Officer, or assigned designee. Compensation for properly authorized Additional Services shall be made in accordance with Section 2.3 of this Agreement. 1.8 Special Requirements. Additional terms and conditions of this Agreement, if any, which are made a part hereof are set forth in “Exhibits D and G” (the “Special Requirements” and “Terms and Conditions Applicable to Agreement Based on Federal Assistance”), which is incorporated herein by this reference and expressly made a part hereof. In the event of a conflict between the provisions of the Special Requirements and any other provisions of this Agreement, the provisions of the Special Requirements shall govern. 2. COMPENSATION. 2.1 Contract Sum. For the Services rendered pursuant to this Agreement, Contracting Party shall be compensated in accordance with “Exhibit B” (the “Schedule of Compensation”) in a total amount not to exceed One Hundred Ninety-Nine Thousand Nine Hundred Forty Three Dollars and Fifty Eight Cents ($199,943.58) for the life of the Agreement. (the “Contract Sum”), except as provided in Section 1.7. The method of compensation set forth in the Schedule of Compensation will be payment for time and materials not to exceed based upon Contracting Party’s rate schedule, but not exceeding the Contract Sum. The Contract Sum shall include the attendance of Contracting Party at all project meetings reasonably deemed necessary by City; Contracting Party shall not be entitled to any additional compensation for attending said meetings. Compensation may include reimbursement for actual and necessary expenditures for reproduction costs, transportation expense, telephone expense, and similar costs and expenses when and if specified in the Schedule of Compensation. No markup constituting a cost- plus percentage of cost shall be allowed on any term of compensation. Regardless of the method of compensation set forth in the Schedule of 19 -4- Compensation, Contracting Party’s overall compensation shall not exceed the Contract Sum, except as provided in Section 1.7 of this Agreement. 2.2 Method of Billing & Payment. Any month in which Contracting Party wishes to receive payment, Contracting Party shall submit to City no later than the tenth (10th) working day of such month, in the form approved by City’s Finance Director, an invoice for Services rendered prior to the date of the invoice. Such invoice shall (1) describe in detail the Services provided, including time and materials, and (2) specify each staff member who has provided Services and the number of hours assigned to each such staff member. Upon approval in writing by the Contract Officer, o r assigned designee, and subject to retention pursuant to Section 8.3, City will pay Contracting Party for all items stated thereon which are approved by City pursuant to this Agreement no later than thirty (30) days after invoices are received by the City’s Finance Department. 2.3 Compensation for Additional Services. Additional Services, including associated costs, shall be approved in advance of the additional services being rendered by the Contract Officer, or assigned designee, pursuant to Section 1.7 of this Agreement. This compensation shall be agreed to in writing by both City and Contracting Party. Any compensation for Additional Services amounting to five percent (5%) or less of the Contract Sum may be approved by the Contract Officer, or an assigned designee. Any greater amount of compensation for Additional Services must be approved by the La Quinta City Council, the City Manager, or Department Director, depending upon City laws, regulations, rules and procedures concerning public contracting. Under no circumstances shall Contracting Party receive compensation for any Additional Services unless prior written approval for the Additional Services is obtained from the Contract Officer, or assigned designee, pursuant to Section 1.7 of this Agreement. 3. PERFORMANCE SCHEDULE. 3.1 Time of Essence. Time is of the essence in the performance of this Agreement. If the Services not completed in accordance with the Schedule of Performance, as set forth in Section 3.2 and “Exhibit C”, it is understood that the City will suffer damage. 3.2 Schedule of Performance. All Services rendered pursuant to this Agreement shall be performed diligently and within the time period established in “Exhibit C” (the “Schedule of Performance”). Extensions to the time period specified in the Schedule of Performance may be approved in writing by the Contract Officer, or assigned designee. 20 -5- 3.3 Force Majeure. The time period specified in the Schedule of Performance for performance of the Services rendered pursuant to this Agreement shall be extended because of any delays due to unforeseeable causes beyond the control and without the fault or negligence of Contracting Party, including, but not restricted to, acts of God or of the public enemy, fires, earthquakes, floods, epidemic, quarantine restrictions, riots, strikes, freight embargoes, acts of any governmental agency other than City, and unusually severe weather, if Contracting Party shall within ten (10) days of the commencement of such delay notify the Contract Officer, or assigned designee, in writing of the causes of the delay. The Contract Officer, or assigned designee, shall ascertain the facts and the extent of delay, and extend the time for performing the Services for the period of the forced delay when and if in the Contract Officer’s judgment such delay is justified, and the Contract Officer’s determination, or assigned designee, shall be final and conclusive upon the parties to this Agreement. Extensions to time period in the Schedule of Performance which are determined by the Contract Officer, or assigned designee, to be justified pursuant to this Section shall not entitle the Contracting Party to additional compensation in excess of the Contract Sum. Contracting Party acknowledges services are to be rendered in response to the COVID-19 Pandemic. Following the State of California emergency declaration (March 4, 2020), the City declared a local state of emergency on March 17, 2020 and subsequently filed for Federal Emergency Management Assistance (FEMA) on March 22, 2020. In addition, on March 8, 2020, the Riverside County Public Health Officer declared a local health emergency based on an imminent and proximate threat to public health from the introduction of COVID-19 in the County of Riverside. The consultant shall primarily work remotely (City offices are currently closed to the public, including consultants). Under COVID-19 regulations issued by the State and City shelter in place orders shall be abided by until otherwise notified. 3.4 Term. Unless earlier terminated in accordance with the provisions in Article 8.0 of this Agreement, the term of this agreement shall commence on July 7, 2020, and terminate on June 30, 2023. 21 -6- 4. COORDINATION OF WORK. 4.1 Representative of Contracting Party. The following principals of Contracting Party (“Principals”) are hereby designated as being the principals and representatives of Contracting Party authorized to act in its behalf with respect to the Services specified herein and make all decisions in connection therewith: Leslie Barrett, Vanir Vice President/Area Manager 555 W. 5th Street Suite 675, Los Angeles CA 90013 Tel No. (310)266-3633 /213-627-7371 E-mail: leslie.barrett@vanir.com It is expressly understood that the experience, knowledge, capability, and reputation of the foregoing Principals were a substantial inducement for City to enter into this Agreement. Therefore, the foregoing Principals shall be responsible during the term of this Agreement for directing all activities of Contracting Party and devoting sufficient time to personally supervise the Services hereunder. For purposes of this Agreement, the foregoing Principals may not be changed by Contracting Party and no other personnel may be assigned to perform the Services required hereunder without the express written approval of City. 4.2 Contract Officer. The “Contract Officer”, otherwise known as the Karla Romero, Finance Director or assigned designee may be designated in writing by the City Manager of the City. It shall be Contracting Party’s responsibility to assure that the Contract Officer, or assigned designee, is kept informed of the progress of the performance of the Services, and Contracting Party shall refer any decisions, that must be made by City to the Contract Officer, or assigned designee. Unless otherwise specified herein, any approval of City required hereunder shall mean the approval of the Contract Officer, or assigned designee. The Contract Officer, or assigned designee, shall have authority to sign all documents on behalf of City required hereunder to carry out the terms of this Agreement. 4.3 Prohibition Against Subcontracting or Assignment. The experience, knowledge, capability, and reputation of Contracting Party, its principals, and its employees were a substantial inducement for City to enter into this Agreement. Except as set forth in this Agreement, Contracting Party shall not contract or subcontract with any other entity to perform in whole or in part the Services required hereunder without the express written approval of City. In addition, neither this Agreement nor any interest herein may be transferred, assigned, conveyed, hypothecated, or encumbered, voluntarily or by operation of law, without the prior written approval of City. Transfers restricted hereunder shall include the transfer to any person or group of 22 -7- persons acting in concert of more than twenty five percent (25%) of the present ownership and/or control of Contracting Party, taking all transfers into account on a cumulative basis. Any attempted or purported assignment or contracting or subcontracting by Contracting Party without City’s express written approval shall be null, void, and of no effect. No approved transfer shall release Contracting Party of any liability hereunder without the express consent of City. 4.4 Independent Contractor. Neither City nor any of its employees shall have any control over the manner, mode, or means by which Contracting Party, its agents, or its employees, perform the Services required herein, except as otherwise set forth herein. City shall have no voice in the selection, discharge, supervision, or control of Contracting Party’s employees, servants, representatives, or agents, or in fixing their number or hours of service. Contracting Party shall perform all Services required herein as an independent contractor of City and shall remain at all times as to City a wholly independent contractor with only such obligations as are consistent with that role. Contracting Party shall not at any time or in any manner represent that it or any of its agents or employees are agents or employees of City. City shall not in any way or for any purpose become or be deemed to be a partner of Contracting Party in its business or otherwise or a joint venture or a member of any joint enterprise with Contracting Party. Contracting Party shall have no power to incur any debt, obligation, or liability on behalf of City. Contracting Party shall not at any time or in any manner represent that it or any of its agents or employees are agents or employees of City. Except for the Contract Sum paid to Contracting Party as provided in this Agreement, City shall not pay salaries, wages, or other compensation to Contracting Party for performing the Services hereunder for City. City shall not be liable for compensation or indemnification to Contracting Party for injury or sickness arising out of performing the Services hereunder. Notwithstanding any other City, state, or federal policy, rule, regulation, law, or ordinance to the contrary, Contracting Party and any of its employees, agents, and subcontractors providing services under this Agreement shall not qualify for or become entitled to any compensation, benefit, or any incident of employment by City, including but not limited to eligibility to enroll in the California Public Employees Retirement System (“PERS”) as an employee of City and entitlement to any contribution to be paid by City for employer contributions and/or employee contributions for PERS benefits. Contracting Party agrees to pay all required taxes on amounts paid to Contracting Party under this Agreement, and to indemnify and hold City harmless from any and all taxes, assessments, penalties, and interest asserted against City by reason of the independent contractor relationship created by this Agreement. Contracting Party shall fully comply with the workers’ compensation laws regarding Contracting Party and Contracting Party’s employees. Contracting 23 -8- Party further agrees to indemnify and hold City harmless from any failure of Contracting Party to comply with applicable workers’ compensation laws. City shall have the right to offset against the amount of any payment due to Contracting Party under this Agreement any amount due to City from Contracting Party as a result of Contracting Party’s failure to promptly pay to City any reimbursement or indemnification arising under this Section. 4.5 Identity of Persons Performing Work. Contracting Party represents that it employs or will employ at its own expense all personnel required for the satisfactory performance of any and all of the Services set forth herein. Contracting Party represents that the Services required herein will be performed by Contracting Party or under its direct supervision, and that all personnel engaged in such work shall be fully qualified and shall be authorized and permitted under applicable State and local law to perform such tasks and services. 4.6 City Cooperation. City shall provide Contracting Party with any publications, reports, statistics, records, or other data or information pertinent to the Services to be performed hereunder which are reasonably available to Contracting Party only from or through action by City. 5. INSURANCE. 5.1 Insurance. Prior to the beginning of any Services under this Agreement and throughout the duration of the term of this Agreement, Contracting Party shall procure and maintain, at its sole cost and expense, and submit concurrently with its execution of this Agreement, policies of insurance as set forth in “Exhibit E” (the “Insurance Requirements”) which is incorporated herein by this reference and expressly made a part hereof. 5.2 Proof of Insurance. Contracting Party shall provide Certificate of Insurance to Agency along with all required endorsements. Certificate of Insurance and endorsements must be approved by Agency’s Risk Manager prior to commencement of performance. 6. INDEMNIFICATION. 6.1 Indemnification. To the fullest extent permitted by law, Contracting Party shall indemnify, protect, defend (with counsel selected by City), and hold harmless City and any and all of its officers, employees, agents, and volunteers as set forth in “Exhibit F” (“Indemnification”) which is incorporated herein by this reference and expressly made a part hereof. 24 -9- 7. RECORDS AND REPORTS. 7.1 Reports. Contracting Party shall periodically prepare and submit to the Contract Officer, or assigned designee, such reports concerning Contracting Party’s performance of the Services required by this Agreement as the Contract Officer, or assigned designee, shall require. Contracting Party hereby acknowledges that City is greatly concerned about the cost of the Services to be performed pursuant to this Agreement. For this reason, Contracting Party agrees that if Contracting Party becomes aware of any facts, circumstances, techniques, or events that may or will materially increase or decrease the cost of the Services contemplated herein or, if Contracting Party is providing design services, the cost of the project being designed, Contracting Party shall promptly notify the Contract Officer, or assigned designee, of said fact, circumstance, technique, or event and the estimated increased or decreased cost related thereto and, if Contracting Party is providing design services, the estimated increased or decreased cost estimate for the project being designed. 7.2 Records. Contracting Party shall keep, and require any subcontractors to keep, such ledgers, books of accounts, invoices, vouchers, canceled checks, reports (including but not limited to payroll reports), studies, or other documents relating to the disbursements charged to City and the Services performed hereunder (the “Books and Records”), as shall be necessary to perform the Services required by this Agreement and enable the Contract Officer, or assigned designee, to evaluate the performance of such Services. Any and all such Books and Records shall be maintained in accordance with generally accepted accounting principles and shall be complete and detailed. The Contract Officer, or assigned designee, the FEMA Administrator, the Comptroller General of the United States, or any of their authorized representatives shall have full and free access to such Books and Records at all times during normal business hours of City, including the right to inspect, copy, audit, and make records and transcripts from such Books and Records. Such Books and Records shall be maintained for a period of three (3) years following completion of the Services hereunder, and City, the FEMA Administrator, the Comptroller General of the United States, or any of their authorized representatives shall have access to such Books and Records in the event any audit is required. In the event of dissolution of Contracting Party’s business, custody of the Books and Records may be given to City, and access shall be provided by Contracting Party’s successor in interest. Under California Government Code Section 8546.7, if the amount of public funds expended under this Agreement exceeds Ten Thousand Dollars ($10,000.00), this Agreement shall be subject to the examination and audit of the State Auditor, at the request of City or as part 25 -10- of any audit of City, for a period of three (3) years after final payment under this Agreement. In compliance with the Disaster Recovery Act of 2018, the City and the Contracting Party acknowledge and agree that no language in this Contract is intended to prohibit audits or internal reviews by the FEMA Administrator or the Comptroller General of the United States. 7.3 Ownership of Documents. All drawings, specifications, maps, designs, photographs, studies, surveys, data, notes, computer files, reports, records, documents, and other materials plans, drawings, estimates, test data, survey results, models, renderings, and other documents or works of authorship fixed in any tangible medium of expression, including but not limited to, physical drawings, digital renderings, or data stored digitally, magnetically, or in any other medium prepared or caused to be prepared by Contracting Party, its employees, subcontractors, and agents in the performance of this Agreement (the “Documents and Materials”) shall be the property of City and shall be delivered to City upon request of the Contract Officer, or assigned designee, or upon the expiration or termination of this Agreement, and Contracting Party shall have no claim for further employment or additional compensation as a result of the exercise by City of its full rights of ownership use, reuse, or assignment of the Documents and Materials hereunder. Any use, reuse or assignment of such completed Documents and Materials for other projects and/or use of uncompleted documents without specific written authorization by Contracting Party will be at City’s sole risk and without liability to Contracting Party, and Contracting Party’s guarantee and warranties shall not extend to such use, revise, or assignment. Contracting Party may retain copies of such Documents and Materials for its own use. Contracting Party shall have an unrestricted right to use the concepts embodied therein. All subcontractors shall provide for assignment to City of any Documents and Materials prepared by them, and in the event Contracting Party fails to secure such assignment, Contracting Party shall indemnify City for all damages resulting therefrom. 7.4 In the event City or any person, firm, or corporation authorized by City reuses said Documents and Materials without written verification or adaptation by Contracting Party for the specific purpose intended and causes to be made or makes any changes or alterations in said Documents and Materials, City hereby releases, discharges, and exonerates Contracting Party from liability resulting from said change. The provisions of this clause shall survive the termination or expiration of this Agreement and shall thereafter remain in full force and effect. 7.5 Licensing of Intellectual Property. This Agreement creates a non- exclusive and perpetual license for City to copy, use, modify, reuse, or 26 -11- sublicense any and all copyrights, designs, rights of reproduction, and other intellectual property embodied in the Documents and Materials. Contracting Party shall require all subcontractors, if any, to agree in writing that City is granted a non-exclusive and perpetual license for the Documents and Materials the subcontractor prepares under this Agreement. Contracting Party represents and warrants that Contracting Party has the legal right to license any and all of the Documents and Materials. Contracting Party makes no such representation and warranty in regard to the Documents and Materials which were prepared by design professionals other than Contracting Party or provided to Contracting Party by City. City shall not be limited in any way in its use of the Documents and Materials at any time, provided that any such use not within the purposes intended by this Agreement shall be at City’s sole risk. 7.6 Release of Documents. The Documents and Materials shall not be released publicly without the prior written approval of the Contract Officer, or assigned designee, or as required by law. Contracting Party shall not disclose to any other entity or person any information regarding the activities of City, except as required by law or as authorized by City. 7.7 Confidential or Personal Identifying Information. Contracting Party covenants that all City data, data lists, trade secrets, documents with personal identifying information, documents that are not public records, draft documents, discussion notes, or other information, if any, developed or received by Contracting Party or provided for performance of this Agreement are deemed confidential and shall not be disclosed by Contracting Party to any person or entity without prior written authorization by City or unless required by law. City shall grant authorization for disclosure if required by any lawful administrative or legal proceeding, court order, or similar directive with the force of law. All City data, data lists, trade secrets, documents with personal identifying information, documents that are not public records, draft documents, discussions, or other information shall be returned to City upon the termination or expiration of this Agreement. Contracting Party’s covenant under this section shall survive the termination or expiration of this Agreement. 8. ENFORCEMENT OF AGREEMENT. 8.1 California Law. This Agreement shall be interpreted, construed, and governed both as to validity and to performance of the parties in accordance with the laws of the State of California. Legal actions concerning any dispute, claim, or matter arising out of or in relation to this Agreement shall be instituted in the Superior Court of the County of Riverside, State of California, or any other appropriate court in such county, and Contracting 27 -12- Party covenants and agrees to submit to the personal jurisdiction of such court in the event of such action. 8.2 Disputes. In the event of any dispute arising under this Agreement, the injured party shall notify the injuring party in writing of its contentions by submitting a claim therefore. The injured party shall continue performing its obligations hereunder so long as the injuring party commences to cure such default within ten (10) days of service of such notice and completes the cure of such default within forty-five (45) days after service of the notice, or such longer period as may be permitted by the Contract Officer, or assigned designee; provided that if the default is an immediate danger to the health, safety, or general welfare, City may take such immediate action as City deems warranted. Compliance with the provisions of this Section shall be a condition precedent to termination of this Agreement for cause and to any legal action, and such compliance shall not be a waiver of any party’s right to take legal action in the event that the dispute is not cured, provided that nothing herein shall limit City’s right to terminate this Agreement without cause pursuant to this Article 8.0. During the period of time that Contracting Party is in default, City shall hold all invoices and shall, when the default is cured, proceed with payment on the invoices. In the alternative, City may, in its sole discretion, elect to pay some or all of the outstanding invoices during any period of default. 8.3 Retention of Funds. City may withhold from any monies payable to Contracting Party sufficient funds to compensate City for any losses, costs, liabilities, or damages it reasonably believes were suffered by City due to the default of Contracting Party in the performance of the Services required by this Agreement. 8.4 Waiver. No delay or omission in the exercise of any right or remedy of a non-defaulting party on any default shall impair such right or remedy or be construed as a waiver. City’s consent or approval of any act by Contracting Party requiring City’s consent or approval shall not be deemed to waive or render unnecessary City’s consent to or approval of any subsequent act of Contracting Party. Any waiver by either party of any default must be in writing and shall not be a waiver of any other default concerning the same or any other provision of this Agreement. 8.5 Rights and Remedies are Cumulative. Except with respect to rights and remedies expressly declared to be exclusive in this Agreement, the rights and remedies of the parties are cumulative and the exercise by either party of one or more of such rights or remedies shall not preclude the exercise by it, at the same or different times, of any other rights or remedies for the same default or any other default by the other party. 28 -13- 8.6 Legal Action. In addition to any other rights or remedies, either party may take legal action, at law or at equity, to cure, correct, or remedy any default, to recover damages for any default, to compel specific performance of this Agreement, to obtain declaratory or injunctive relief, or to obtain any other remedy consistent with the purposes of this Agreement. 8.7 Termination Prior To Expiration of Term. This Section shall govern any termination of this Agreement, except as specifically provided in the following Section for termination for cause. City reserves the right to terminate this Agreement at any time, with or without cause, upon thirty (30) days’ written notice to Contracting Party. Upon receipt of any notice of termination, Contracting Party shall immediately cease all Services hereunder except such as may be specifically approved by the Contract Officer, or assigned designee. Contracting Party shall be entitled to compensation for all Services rendered prior to receipt of the notice of termination and for any Services authorized by the Contract Officer, or assigned designee, thereafter in accordance with the Schedule of Compensation or such as may be approved by the Contract Officer, or assigned designee, except amounts held as a retention pursuant to this Agreement. 8.8 Termination for Default of Contracting Party. If termination is due to the failure of Contracting Party to fulfill its obligations under this Agreement, Contracting Party shall vacate any City-owned property which Contracting Party is permitted to occupy hereunder and City may, after compliance with the provisions of Section 8.2, take over the Services and prosecute the same to completion by contract or otherwise, and Contracting Party shall be liable to the extent that the total cost for completion of the Services required hereunder exceeds the compensation herein stipulated (provided that City shall use reasonable efforts to mitigate such damages), and City may withhold any payments to Contracting Party for the purpose of setoff or partial payment of the amounts owed City. 8.9 Attorneys’ Fees. If either party to this Agreement is required to initiate or defend or made a party to any action or proceeding in any way connected with this Agreement, the prevailing party in such action or proceeding, in addition to any other relief which may be granted, whether legal or equitable, shall be entitled to reasonable attorneys’ fees; provided, however, that the attorneys’ fees awarded pursuant to this Section shall not exceed the hourly rate paid by City for legal services multiplied by the reasonable number of hours spent by the prevailing party in the conduct of the litigation. Attorneys’ fees shall include attorneys’ fees on any appeal, and in addition a party entitled to attorneys’ fees shall be entitled to all other reasonable costs for investigating such action, taking depositions and discovery, and all other necessary costs the court allows which are incurred in 29 -14- such litigation. All such fees shall be deemed to have accrued on commencement of such action and shall be enforceable whether or not such action is prosecuted to judgment. The court may set such fees in the same action or in a separate action brought for that purpose. 9. CITY OFFICERS AND EMPLOYEES; NONDISCRIMINATION. 9.1 Non-liability of City Officers and Employees. No officer, official, employee, agent, representative, or volunteer of City shall be personally liable to Contracting Party, or any successor in interest, in the event or any default or breach by City or for any amount which may become due to Contracting Party or to its successor, or for breach of any obligation of the terms of this Agreement. 9.2 Conflict of Interest. Contracting Party covenants that neither it, nor any officer or principal of it, has or shall acquire any interest, directly or indirectly, which would conflict in any manner with the interests of City or which would in any way hinder Contracting Party’s performance of the Services under this Agreement. Contracting Party further covenants that in the performance of this Agreement, no person having any such interest shall be employed by it as an officer, employee, agent, or subcontractor without the express written consent of the Contract Officer, or assigned designee. Contracting Party agrees to at all times avoid conflicts of interest or the appearance of any conflicts of interest with the interests of City in the performance of this Agreement. No officer or employee of City shall have any financial interest, direct or indirect, in this Agreement nor shall any such officer or employee participate in any decision relating to this Agreement which effects his financial interest or the financial interest of any corporation, partnership or association in which he is, directly or indirectly, interested, in violation of any State statute or regulation. Contracting Party warrants that it has not paid or given and will not pay or give any third party any money or other consideration for obtaining this Agreement. 9.3 Covenant against Discrimination. Contracting Party covenants that, by and for itself, its heirs, executors, assigns, and all persons claiming under or through them, that there shall be no discrimination against or segregation of, any person or group of persons on account of any impermissible classification including, but not limited to, race, color, creed, religion, sex, marital status, sexual orientation, national origin, or ancestry in the performance of this Agreement. Contracting Party shall take affirmative action to ensure that applicants are employed and that employees are treated during employment without regard to their race, color, creed, religion, sex, marital status, sexual orientation, national origin, or ancestry. 30 -15- 10. MISCELLANEOUS PROVISIONS. 10.1 Notice. Any notice, demand, request, consent, approval, or communication either party desires or is required to give the other party or any other person shall be in writing and either served personally or sent by prepaid, first-class mail to the address set forth below. Either party may change its address by notifying the other party of the change of address in writing. Notice shall be deemed communicated forty-eight (48) hours from the time of mailing if mailed as provided in this Section. To City: CITY OF LA QUINTA Attention: Karla Romero 78495 Calle Tampico La Quinta, California 92253 To Contracting Party: Vanir Construction Management Inc. Attention: Steven Whitehead 4540 Duckhorn Drive, Suite 300 Sacramento California 95834 10.2 Interpretation. The terms of this Agreement shall be construed in accordance with the meaning of the language used and shall not be construed for or against either party by reason of the authorship of this Agreement or any other rule of construction which might otherwise apply. 10.3 Section Headings and Subheadings. The section headings and subheadings contained in this Agreement are included for convenience only and shall not limit or otherwise affect the terms of this Agreement. 10.4 Counterparts. This Agreement may be executed in counterparts, each of which shall be deemed to be an original, and such counterparts shall constitute one and the same instrument 10.5 Integrated Agreement. This Agreement including the exhibits hereto is the entire, complete, and exclusive expression of the understanding of the parties. It is understood that there are no oral agreements between the parties hereto affecting this Agreement and this Agreement supersedes and cancels any and all previous negotiations, arrangements, agreements, and understandings, if any, between the parties, and none shall be used to interpret this Agreement. 10.6 Amendment. No amendment to or modification of this Agreement shall be valid unless made in writing and approved by Contracting Party and by the City Council of City. The parties agree that this requirement for written modifications cannot be waived and that any attempted waiver shall be void. 31 -16- 10.7 Severability. In the event that any one or more of the articles, phrases, sentences, clauses, paragraphs, or sections contained in this Agreement shall be declared invalid or unenforceable, such invalidity or unenforceability shall not affect any of the remaining articles, phrases, sentences, clauses, paragraphs, or sections of this Agreement which are hereby declared as severable and shall be interpreted to carry out the intent of the parties hereunder unless the invalid provision is so material that its invalidity deprives either party of the basic benefit of their bargain or renders this Agreement meaningless. 10.8 Unfair Business Practices Claims. In entering into this Agreement, Contracting Party offers and agrees to assign to City all rights, title, and interest in and to all causes of action it may have under Section 4 of the Clayton Act (15 U.S.C. § 15) or under the Cartwright Act (Chapter 2, (commencing with Section 16700) of Part 2 of Division 7 of the Business and Professions Code), arising from purchases of goods, services, or materials related to this Agreement. This assignment shall be made and become effective at the time City renders final payment to Contracting Party without further acknowledgment of the parties. 10.9 No Third-Party Beneficiaries. With the exception of the specific provisions set forth in this Agreement, there are no intended third-party beneficiaries under this Agreement and no such other third parties shall have any rights or obligations hereunder. 10.10 Equal Employment Opportunity. During the performance of this contract, the Contracting Party agrees as follows: (a) The Contracting Party will not discriminate against any employee or applicant for employment because of race, color, religion, sex, sexual orientation, gender identity, or national origin. The Contracting Party will take affirmative action to ensure that applicants are employed, and that employees are treated during employment without regard to their race, color, religion, sex, sexual orientation, gender identity, or national origin. Such action shall include, but not be limited to the following: Employment, upgrading, demotion, or transfer; recruitment or recruitment advertising; layoff or termination; rates of pay or other forms of compensation; and selection for training, including apprenticeship. The Contracting Party agrees to post in conspicuous places, available to employees and applicants for employment, notices to be provided setting forth the provisions of this nondiscrimination clause. 32 -17- (b) The Contracting Party will, in all solicitations or advertisements for employees placed by or on behalf of the Contracting Party, state that all qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, or national origin. (c) The Contracting Party will not discharge or in any other manner discriminate against any employee or applicant for employment because such employee or applicant has inquired about, discussed, or disclosed the compensation of the employee or applicant or another employee or applicant. This provision shall not apply to instances in which an employee who has access to the compensation information of other employees or applicants as a part of such employee's essential job functions discloses the compensation of such other employees or applicants to individuals who do not otherwise have access to such information, unless such disclosure is in response to a formal complaint or charge, in furtherance of an investigation, proceeding, hearing, or action, including an investigation conducted by the employer, or is consistent with the Contracting Party’s legal duty to furnish information. (d) The Contracting Party will send to each labor union or representative of workers with which he has a collective bargaining agreement or other contract or understanding, a notice to be provided advising the said labor union or workers' representatives of the Contracting Party’s commitments under this section, and shall post copies of the notice in conspicuous places available to employees and applicants for employment. (e) The Contracting Party will comply with all provisions of Executive Order 11246 of September 24, 1965, and of the rules, regulations, and relevant orders of the Secretary of Labor. (f) The Contracting Party will furnish all information and reports required by Executive Order 11246 of September 24, 1965, and by rules, regulations, and orders of the Secretary of Labor, or pursuant thereto, and will permit access to his books, records, and accounts by the administering agency and the Secretary of Labor for purposes of investigation to ascertain compliance with such rules, regulations, and orders. (g) In the event of the Contracting Party’s noncompliance with the nondiscrimination clauses of this contract or with any of the said rules, regulations, or orders, this contract may be canceled, terminated, or suspended in whole or in part and the Contracting Party may be declared ineligible for further Government contracts or federally assisted 33 -18- construction contracts in accordance with procedures authorized in Executive Order 11246 of September 24, 1965, and such other sanctions may be imposed and remedies invoked as provided in Executive Order 11246 of September 24, 1965, or by rule, regulation, or order of the Secretary of Labor, or as otherwise provided by law. (h) The Contracting Party will include the portion of the sentence immediately preceding paragraph (a) and the provisions of paragraphs (a) through (h) in every subcontract or purchase order unless exempted by rules, regulations, or orders of the Secretary of Labor issued pursuant to section 204 of Executive Order 11246 of September 24, 1965, so that such provisions will be binding upon each subcontractor or vendor. The Contracting Party will take such action with respect to any subcontract or purchase order as the administering agency may direct as a means of enforcing such provisions, including sanctions for noncompliance: Provided, however, that in the event a Contracting Party becomes involved in, or is threatened with, litigation with a subcontractor or vendor as a result of such direction by the administering agency, the Contracting Party may request the United States to enter into such litigation to protect the interests of the United States. The applicant further agrees that it will be bound by the above equal opportunity clause with respect to its own employment practices when it participates in federally assisted construction work: Provided, That if the applicant so participating is a State or local government, the above equal opportunity clause is not applicable to any agency, instrumentality or subdivision of such government which does not participate in work on or under the contract. The applicant agrees that it will assist and cooperate actively with the administering agency and the Secretary of Labor in obtaining the compliance of contractors and subcontractors with the equal opportunity clause and the rules, regulations, and relevant orders of the Secretary of Labor, that it will furnish the administering agency and the Secretary of Labor such information as they may require for the supervision of such compliance, and that it will otherwise assist the administering agency in the discharge of the agency's primary responsibility for securing compliance. The applicant further agrees that it will refrain from entering into any contract or contract modification subject to Executive Order 34 -19- 11246 of September 24, 1965, with a contractor debarred from, or who has not demonstrated eligibility for, Government contracts and federally assisted construction contracts pursuant to the Executive Order and will carry out such sanctions and penalties for violation of the equal opportunity clause as may be imposed upon contractors and subcontractors by the administering agency or the Secretary of Labor pursuant to Part II, Subpart D of the Executive Order. In addition, the applicant agrees that if it fails or refuses to comply with these undertakings, the administering agency may take any or all of the following actions: Cancel, terminate, or suspend in whole or in part this grant (contract, loan, insurance, guarantee); refrain from extending any further assistance to the applicant under the program with respect to which the failure or refund occurred until satisfactory assurance of future compliance has been received from such applicant; and refer the case to the Department of Justice for appropriate legal proceedings. 10.11 Compliance with the Contract Work Hours and Safety Standards Act. Overtime requirements. No Contracting Party or subcontractor contracting for any part of the contract work which may require or involve the employment of laborers or mechanics shall require or permit any such laborer or mechanic in any workweek in which he or she is employed on such work to work in excess of forty hours in such workweek unless such laborer or mechanic receives compensation at a rate not less than one and one-half times the basic rate of pay for all hours worked in excess of forty hours in such workweek. Violation; liability for unpaid wages; liquidated damages . In the event of any violation of the clause set forth in paragraph (1) of this section the Contracting Party and any subcontractor responsible therefor shall be liable for the unpaid wages. In addition, such Contracting Party and subcontractor shall be liable to the United States (in the case of work done under contract for the District of Columbia or a territory, to such District or to such territory), for liquidated damages. Such liquidated damages shall be computed with respect to each individual laborer or mechanic, including watchmen and guards, employed in violation of the clause set forth in paragraph (1) of this section, in the sum of $27 for each calendar day on which such individual was required or permitted to work in excess of the standard workweek of forty hours without payment of the overtime wages required by the clause set forth in paragraph (1) of this section. 35 -20- Withholding for unpaid wages and liquidated damages. The City shall upon its own action or upon written request of an authorized representative of the Department of Labor withhold or cause to be withheld, from any moneys payable on account of work performed by the Contracting Party or subcontractor under any such contract or any other Federal contract with the same Contracting Party, or any other federally-assisted contract subject to the Contract Work Hours and Safety Standards Act, which is held by the same prime contractor, such sums as may be determined to be necessary to satisfy any liabilities of such Contracting Party or subcontractor for unpaid wages and liquidated damages as provided in the clause set forth in paragraph (2) of this section. Subcontracts. The Contracting Party or subcontractor shall insert in any subcontracts the clauses set forth in paragraph (1) through (4) of this section and also a clause requiring the subcontractors to include these clauses in any lower tier subcontracts. The Contracting Party shall be responsible for compliance by any subcontractor or lower tier subcontractor with the clauses set forth in paragraphs (1) through (4) of this section. 10.12 Clean Air Act. The Contracting Party agrees to comply with all applicable standards, orders or regulations issued pursuant to the Clean Air Act, as amended, 42 U.S.C. § 7401 et seq. The Contracting Party agrees to report each violation to the City and understands and agrees that the City will, in turn, report each violation as required to assure notification to the Federal Emergency Management Agency, and the appropriate Environmental Protection Agency Regional Office. The Contracting Party agrees to include these requirements in each subcontract exceeding $150,000 financed in whole or in part with Federal assistance provided by FEMA. 10.13 Federal Water Pollution Control Act. The Contracting Party agrees to comply with all applicable standards, orders, or regulations issued pursuant to the Federal Water Pollution Control Act, as amended, 33 U.S.C. 1251 et seq. The Contracting Party agrees to report each violation to the City and understands and agrees that the City will, in turn, report each violation as required to assure notification to the Federal Emergency Management Agency, and the appropriate Environmental Protection Agency Regional Office. The Contracting Party agrees to include these requirements in each subcontract exceeding $150,000 financed in whole or in part with Federal assistance provided by FEMA. 36 -21- 10.14 Suspension and Debarment. This contract is a covered transaction for purposes of 2 C.F.R. pt. 180 and 2 C.F.R. pt. 3000. As such, the Contracting Party is required to verify that none of the Contracting Party’s principals (defined at 2 C.F.R. § 180.995) or its affiliates (defined at 2 C.F.R. § 180.905) are excluded (defined at 2 C.F.R. § 180.940) or disqualified (defined at 2 C.F.R. § 180.935). The Contracting Party must comply with 2 C.F.R. pt. 180, subpart C and 2 C.F.R. pt. 3000, subpart C, and must include a requirement to comply with these regulations in any lower tier covered transaction it enters into. This certification is a material representation of fact relied upon by the City. If it is later determined that the contractor did not comply with 2 C.F.R. pt. 180, subpart C and 2 C.F.R. pt. 3000, subpart C, in addition to remedies available to City, the Federal Government may pursue available remedies, including but not limited to suspension and/or debarment. The Contracting Party agrees to comply with the requirements of 2 C.F.R. pt. 180, subpart C and 2 C.F.R. pt. 3000, subpart C while this offer is valid and throughout the period of any contract that may arise from this offer. The Contracting Party further agrees to include a provision requiring such compliance in its lower tier covered transactions. 10.15 Procurement of Recovered Materials. In the performance of this contract, the Contracting Party shall make maximum use of products containing recovered materials that are EPA-designated items unless the product cannot be acquired: (a) Competitively within a timeframe providing for compliance with the contract performance schedule; (b) Meeting contract performance requirements; or (c) At a reasonable price. Information about this requirement, along with the list of EPA- designated items, is available at EPA’s Comprehensive Procurement Guidelines website, https://www.epa.gov/smm/comprehensive- procurement-guideline-cpg-program. The Contracting Party also agrees to comply with all other applicable requirements of Section 6002 of the Solid Waste Disposal Act. 10.16 DHS Seal, Logo, and Flags. The Contracting Party shall not use the DHS seal(s), logos, crests, or reproductions of flags or likenesses of DHS agency officials without specific FEMA pre-approval. 37 -22- 10.17 Compliance with Federal Law, Regulations, and Executive Orders. This is an acknowledgement that FEMA financial assistance will be used to fund all or a portion of the contract. The Contracting Party will comply with all applicable Federal law, regulations, executive orders, FEMA policies, procedures, and directives. 10.18 No Obligation by Federal Government. The Federal Government is not a party to this Contract and is not subject to any obligations or liabilities to the non-Federal entity, contractor, or any other party pertaining to any matter resulting from the Contract. 10.19 Program Fraud and False or Fraudulent Statements or Related Acts. The Contracting Party acknowledges that 31 U.S.C. Chap. 38 “Administrative Remedies for False Claims and Statements” applies to the Contracting Party’s actions pertaining to this Contract. 10.20 Authority. The persons executing this Agreement on behalf of each of the parties hereto represent and warrant that (i) such party is duly organized and existing, (ii) they are duly authorized to execute and deliver this Agreement on behalf of said party, (iii) by so executing this Agreement, such party is formally bound to the provisions of this Agreement, and (iv) that entering into this Agreement does not violate any provision of any other Agreement to which said party is bound. This Agreement shall be binding upon the heirs, executors, administrators, successors, and assigns of the parties. [SIGNATURES ON FOLLOWING PAGE] 38 39 Exhibit A Page 1 of 3 Last revised summer 2017 Exhibit A Scope of Services 1. Services to be Provided: City of La Quinta Finance department shall obtain and review all activity logs from City employees to determine if COVID-19 work was completed. Activity logs determined to have work associated with COVID-19 shall be sent to the Consultant along with the employee’s payroll log for the pay period. The Consultant shall contact the employee or a designated department personnel representative directly to obtain additional information necessary to justify and document the work related to COVID-19. Consultant services may include the following: x Work with City staff to compile a comprehensive list of disaster related repairs, damage mitigation efforts, possible improvements and collect and compile cost documentation. x Ensure all eligible costs/damages have been identified and reported to insurance, FEMA and Cal OES in an appropriate and timely manner. x Provide quality assurance and quality control support and general eligibility guidance for all State and federal grant programs. x Coordinate and manage deliverables with insurance, FEMA, and CAL OES. x Assist the City in insurance claim preparation, coordination and advice through insurance adjustment process. x Assist the City during Applicant’s Briefings with FEMA and the State, assisting with relationship development, requesting additional programmatic details and clarifications that will assist the City during the grant process. x Collaborate with the City on project formulation, including damage assessments (field team assessment of damages including a comprehensive list of damaged structures, contents, etc.); Information gathering (photo-document damages, gather records, drawings, insurance policies, historical photos/videos, etc.); project development (define both small and large projects’ scope, size, and damages, including cost estimating, that will be the basis of each Project Worksheet); project submittals (draft and submit small and large project public works to CAL OES/FEMA). Additional documentation and tracking may include but is not limited to: x FEMA ICS-214 Activity Log Form (Attachment 3) x Gathering and labeling of pictures provided by Staff x Interviewing employees 40 Exhibit A Page 2 of 3 x Estimating the value of donations x Documenting and tracking donations o The City currently has donated the following items related to COVID-19 (additional donations may occur) Face shields produced by the City Food donations Childcare facility Face masks x Tracking overtime and regular payroll hours worked in response to COVID-19 o City Staff shall provide timesheets (payroll staff will be available as needed by the Consultant) o City’s financial software is tracking remote work hours and Federal IRS guidelines for COVID-19 x Tracking of volunteer hours. The City has or intends to use the following volunteers to respond to COVID-19. o Finance Advisory Commission o Citizens on Patrol o Community Emergency Response Team o Short-term Vacation Rental Ad Hoc Committee o Planning Commission o Wellness Center Volunteers o Housing Commission o Community Services Commission x Meetings with City Staff, FEMA and/or CalOES representatives as needed x Submitting documentation to FEMA and Cal/OES along with updating the FEMA Grants Portal as needed. o The City will add consultant as an alternative contact on the FEMA Grant Portal and provide login access. 2. Performance Standards: a. The consultant shall primarily work remotely (City offices are currently closed to the public, including consultants). Under COVID-19 regulations issued by the State and City shelter in place orders shall be abided by until otherwise notified. b. The consultant shall furnish their own computer, phone, have remote access to a secure electronic deposit repository for documentation tracking. 41 Exhibit A Page 3 of 3 c. In addition, the Consultant shall be well versed and have the ability to use Zoom and Microsoft Teams for meetings. d. The consultant will be expected to communicate with City staff via email, by phone, with Zoom and Teams, or by mail when necessary. e. The Consultant shall provide a written report each Monday by close of business summarizing the work completed in the prior week (Monday – Sunday). f. In addition, ongoing scheduled meetings using Zoom will be conducted as needed to update the Consultant on operational changes. 42 Exhibit B Page 1 of 2 Exhibit B Schedule of Compensation With the exception of compensation for Additional Services, provided for in Section 2.3 of this Agreement, the maximum total compensation to be paid to Contracting Party under this Agreement is not to exceed One Hundred Ninety Nine Thousand Dollars and Fifty Eight Cents ($ 199,943.58) for the life of the Agreement, (the “Contract Sum”), except as provided in Section 1.7. The Contract Sum shall be paid to Contracting Party in installment payments made on a monthly basis and in an amount identified in Contracting Party’s schedule of compensation attached hereto for the work tasks performed and properly invoiced by Contracting Party in conformance with Section 2.2 of this Agreement. 43 City of La Quinta | FEMA Project Administration Services Cost Estimate sĂŶŝƌ͛ƐĐŽƐƚĨŽƌƚŚŝƐĞŶŐĂŐĞŵĞŶƚŝƐďĂƐĞĚŽŶƚŚĞĨŽůůŽǁŝŶŐ ƐƵŵŵĂƌLJŽĨƚŚĞ^ĐŚĞĚƵůĞŽĨWĞƌĨŽƌŵĂŶĐĞZĞƋƵŝƌĞŵĞŶƚƐ ŽƵƚůŝŶĞĚŝŶ^ĐŚĞĚƵůĞŽĨƚŚĞZ&W͗ •ŽŵƉůĞƟŽŶŽĨĂůůƐĞƌǀŝĐĞƐŝĚĞŶƟĮĞĚŝŶƚŚĞ^ĐŽƉĞŽĨ ^ĞƌǀŝĐĞƐ͕džŚŝďŝƚŽĨZ&WŐƌĞĞŵĞŶƚ͘ •^ƵďŵŝƐƐŝŽŶŽĨĂǁƌŝƩĞŶƉƌŽŐƌĞƐƐͬĂĐƟǀŝƚLJƌĞƉŽƌƚƚŽ ďĞƐƵďŵŝƩĞĚĞĂĐŚDŽŶĚĂLJďLJĐůŽƐĞŽĨďƵƐŝŶĞƐƐĂŶĚ ǁŚŝĐŚƐƵŵŵĂƌŝnjĞƐƚŚĞǁŽƌŬĐŽŵƉůĞƚĞĚŝŶƚŚĞƉƌŝŽƌ ǁĞĞŬ;DŽŶĚĂLJʹ^ƵŶĚĂLJͿ͖ĂŶĚ •^ĐŚĞĚƵůŝŶŐŽĨĂŶĚƉĂƌƟĐŝƉĂƟŽŶŝŶŽŶŐŽŝŶŐŽŽŵ ŵĞĞƟŶŐƐĂƐƌĞƋƵŝƌĞĚŽƌƌĞƋƵĞƐƚĞĚďLJƚŚĞŝƚLJ͘ ƐƐƚĂƚĞĚŝŶƚŚĞZ&W͕ƚŚĞŵĂdžŝŵƵŵƚŽƚĂůĐŽŵƉĞŶƐĂƟŽŶ ĨŽƌƚŚŝƐǁŽƌŬŝƐŶŽƚƚŽĞdžĐĞĞĚΨϮϬϬ͕ϬϬϬ͘ϬϬ͕ƚŚĞƌĞĨŽƌĞǁĞ ƉƌŽƉŽƐĞƚŚĞĨŽůůŽǁŝŶŐůĂďŽƌƐƚƌƵĐƚƵƌĞ͗ Section 5 ServicesYear 1Year 2Year 3Year 1Year 2Year 3Year 1Year 2Year 31. Compile comprehensive list of eligible repairs/improvements and cost information50 40 250 502. Eligible costs are collected and timely reported to insurance, Cal OES and FEMA70 10 50 10 50 103. QA/QC and Eligibility Guidance40 10 204. Coordinate and manage deliverables with insurance, Cal OES and FEMA40 20 20 20 105. Assist on insurance claim preparation50 20 30 5 10 106. Assist with Applicant briefings30 75 20 20 25 0 50 507. Collaborate with the city on:a. Damage Assessments40 10 25 75 30b. Information Gathering20 20 75 30c. Project Development75 40 40 20 40 10d. Project Submittals 40 50 25 50 50 40 20Totals455 235 45 315 60 0 570 240 70Total Rate$142.26 $146.53 $150.93 $128.16 $132.01 $135.97 $51.26 $52.80 $54.38Estimate Service Cost (with 3% Escalation Annually)FEMA PROJECT ADMINISTRATIVE SERVICES - DETAILED COST ESTIMATEKey Personnel Hours (3 Years)$45,695.94$199,943.58$105,956.18 $48,291.46Lois Copeland Carolina Madera Julissa Ibarra EXHIBIT B Page 2 of 2 44 Exhibit C Page 1 of 1 Exhibit C Schedule of Performance Contracting Party shall complete all services identified in the Scope of Services, Exhibit A of this Agreement. The Consultant shall provide a written report each Monday by close of business summarizing the work completed in the prior week (Monday – Sunday). In addition, ongoing scheduled meetings using Zoom will be conducted as needed to update the Consultant on operational changes. 45 Exhibit D Page 1 of 1 Exhibit D Special Requirements 1. The consultant shall primarily work remotely (City offices are currently closed to the public, including consultants). Under COVID-19 regulations issued by the State and City shelter in place orders shall be abided by until otherwise notified. 2. The consultant shall furnish their own computer, phone, have remote access to a secure electronic deposit repository for documentation tracking. 46 Exhibit E Page 1 of 7 Exhibit E Insurance Requirements E.1 Insurance. Prior to the beginning of and throughout the duration of this Agreement, the following policies shall be maintained and kept in full force and effect providing insurance with minimum limits as indicated below and issued by insurers with A.M. Best ratings of no less than A-VI: Commercial General Liability (at least as broad as ISO CG 0001) $1,000,000 (per occurrence) $2,000,000 (general aggregate) Must include the following endorsements: General Liability Additional Insured General Liability Primary and Non-contributory Commercial Auto Liability (at least as broad as ISO CA 0001) $1,000,000 (per accident) Personal Auto Declaration Page if applicable Errors and Omissions Liability $1,000,000 (per claim and aggregate) Workers’ Compensation (per statutory requirements) Must include the following endorsements: Workers Compensation with Waiver of Subrogation Workers Compensation Declaration of Sole Proprietor if applicable Cyber Liability $1,000,000 (each claim) $2,000,000 (aggregate) Contracting Party shall procure and maintain, at its cost, and submit concurrently with its execution of this Agreement, Commercial General Liability insurance against all claims for injuries against persons or damages to property resulting from Contracting Party’s acts or omissions rising out of or related to Contracting Party’s performance under this Agreement. The insurance policy shall contain a severability of interest clause providing that the coverage shall be primary for losses arising out of Contracting Party’s performance hereunder and neither City nor its insurers shall be required to contribute to any such loss. An endorsement evidencing the foregoing and naming the City and its officers and employees as additional insured (on the Commercial General Liability policy only) must be submitted concurrently with 47 Exhibit E Page 2 of 7 the execution of this Agreement and approved by City prior to commencement of the services hereunder. Contracting Party shall carry automobile liability insurance of $1,000,000 per accident against all claims for injuries against persons or damages to property arising out of the use of any automobile by Contracting Party, its officers, any person directly or indirectly employed by Contracting Party, any subcontractor or agent, or anyone for whose acts any of them may be liable, arising directly or indirectly out of or related to Contracting Party’s performance under this Agreement. If Contracting Party or Contracting Party’s employees will use personal autos in any way on this project, Contracting Party shall provide evidence of personal auto liability coverage for each such person. The term “automobile” includes, but is not limited to, a land motor vehicle, trailer or semi-trailer designed for travel on public roads. The automobile insurance policy shall contain a severability of interest clause providing that coverage shall be primary for losses arising out of Contracting Party’s performance hereunder and neither City nor its insurers shall be required to contribute to such loss. Professional Liability or Errors and Omissions Insurance as appropriate shall be written on a policy form coverage specifically designed to protect against acts, errors or omissions of the Contracting Party and “Covered Professional Services” as designated in the policy must specifically include work performed under this agreement. The policy limit shall be no less than $1,000,000 per claim and in the aggregate. The policy must “pay on behalf of” the insured and must include a provision establishing the insurer’s duty to defend. The policy retroactive date shall be on or before the effective date of this agreement. Contracting Party shall carry Workers’ Compensation Insurance in accordance with State Worker’s Compensation laws with employer’s liability limits no less than $1,000,000 per accident or disease. Contracting Party shall procure and maintain Cyber Liability insurance with limits of $1,000,000 per occurrence/loss which shall include the following coverage: a. Liability arising from the theft, dissemination and/or use of confidential or personally identifiable information; including credit monitoring and regulatory fines arising from such theft, dissemination or use of the confidential information. b. Network security liability arising from the unauthorized use of, access to, or tampering with computer systems. 48 Exhibit E Page 3 of 7 c. Liability arising from the failure of technology products (software) required under the contract for Consultant to properly perform the services intended. d. Electronic Media Liability arising from personal injury, plagiarism or misappropriation of ideas, domain name infringement or improper deep-linking or framing, and infringement or violation of intellectual property rights. e. Liability arising from the failure to render professional services. If coverage is maintained on a claims-made basis, Contracting Party shall maintain such coverage for an additional period of three (3) years following termination of the contract. Contracting Party shall provide written notice to City within ten (10) working days if: (1) any of the required insurance policies is terminated; (2) the limits of any of the required polices are reduced; or (3) the deductible or self-insured retention is increased. In the event any of said policies of insurance are cancelled, Contracting Party shall, prior to the cancellation date, submit new evidence of insurance in conformance with this Exhibit to the Contract Officer. The procuring of such insurance or the delivery of policies or certificates evidencing the same shall not be construed as a limitation of Contracting Party’s obligation to indemnify City, its officers, employees, contractors, subcontractors, or agents. E.2 Remedies. In addition to any other remedies City may have if Contracting Party fails to provide or maintain any insurance policies or policy endorsements to the extent and within the time herein required, City may, at its sole option: a. Obtain such insurance and deduct and retain the amount of the premiums for such insurance from any sums due under this Agreement. b. Order Contracting Party to stop work under this Agreement and/or withhold any payment(s) which become due to Contracting Party hereunder until Contracting Party demonstrates compliance with the requirements hereof. c. Terminate this Agreement. Exercise of any of the above remedies, however, is an alternative to any other remedies City may have. The above remedies are not the exclusive remedies for Contracting Party’s failure to maintain or secure appropriate 49 Exhibit E Page 4 of 7 policies or endorsements. Nothing herein contained shall be construed as limiting in any way the extent to which Contracting Party may be held responsible for payments of damages to persons or property resulting from Contracting Party’s or its subcontractors’ performance of work under this Agreement. E.3 General Conditions Pertaining to Provisions of Insurance Coverage by Contracting Party. Contracting Party and City agree to the following with respect to insurance provided by Contracting Party: 1. Contracting Party agrees to have its insurer endorse the third party general liability coverage required herein to include as additional insureds City, its officials, employees, and agents, using standard ISO endorsement No. CG 2010 with an edition prior to 1992. Contracting Party also agrees to require all contractors, and subcontractors to do likewise. 2. No liability insurance coverage provided to comply with this Agreement shall prohibit Contracting Party, or Contracting Party’s employees, or agents, from waiving the right of subrogation prior to a loss. Contracting Party agrees to waive subrogation rights against City regardless of the applicability of any insurance proceeds, and to require all contractors and subcontractors to do likewise. 3. All insurance coverage and limits provided by Contracting Party and available or applicable to this Agreement are intended to apply to the full extent of the policies. Nothing contained in this Agreement or any other agreement relating to City or its operations limits the application of such insurance coverage. 4. None of the coverages required herein will be in compliance with these requirements if they include any limiting endorsement of any kind that has not been first submitted to City and approved of in writing. 5. No liability policy shall contain any provision or definition that would serve to eliminate so-called “third party action over” claims, including any exclusion for bodily injury to an employee of the insured or of any contractor or subcontractor. 6. All coverage types and limits required are subject to approval, modification and additional requirements by the City, as the need arises. Contracting Party shall not make any reductions in scope of coverage (e.g. elimination of contractual liability or reduction of discovery period) that may affect City’s protection without City’s prior written consent. 50 Exhibit E Page 5 of 7 7. Proof of compliance with these insurance requirements, consisting of certificates of insurance evidencing all the coverages required and an additional insured endorsement to Contracting Party’s general liability policy, shall be delivered to City at or prior to the execution of this Agreement. In the event such proof of any insurance is not delivered as required, or in the event such insurance is canceled at any time and no replacement coverage is provided, City has the right, but not the duty, to obtain any insurance it deems necessary to protect its interests under this or any other agreement and to pay the premium. Any premium so paid by City shall be charged to and promptly paid by Contracting Party or deducted from sums due Contracting Party, at City option. 8. It is acknowledged by the parties of this agreement that all insurance coverage required to be provided by Contracting Party or any subcontractor, is intended to apply first and on a primary, non-contributing basis in relation to any other insurance or self-insurance available to City. 9. Contracting Party agrees to ensure that subcontractors, and any other party involved with the project that is brought onto or involved in the project by Contracting Party, provide the same minimum insurance coverage required of Contracting Party. Contracting Party agrees to monitor and review all such coverage and assumes all responsibility for ensuring that such coverage is provided in conformity with the requirements of this section. Contracting Party agrees that upon request, all agreements with subcontractors and others engaged in the project will be submitted to City for review. 10. Contracting Party agrees not to self-insure or to use any self- insured retentions or deductibles on any portion of the insurance required herein (with the exception of professional liability coverage, if required) and further agrees that it will not allow any contractor, subcontractor, Architect, Engineer or other entity or person in any way involved in the performance of work on the project contemplated by this agreement to self-insure its obligations to City. If Contracting Party’s existing coverage includes a deductible or self-insured retention, the deductible or self-insured retention must be declared to the City. At that time the City shall review options with the Contracting Party, which may include reduction or elimination of the deductible or self-insured retention, substitution of other coverage, or other solutions. 11. The City reserves the right at any time during the term of this Agreement to change the amounts and types of insurance required by giving the Contracting Party ninety (90) days advance written notice of such change. If such change results in substantial additional cost to the Contracting Party, 51 Exhibit E Page 6 of 7 the City will negotiate additional compensation proportional to the increased benefit to City. 12. For purposes of applying insurance coverage only, this Agreement will be deemed to have been executed immediately upon any party hereto taking any steps that can be deemed to be in furtherance of or towards performance of this Agreement. 13. Contracting Party acknowledges and agrees that any actual or alleged failure on the part of City to inform Contracting Party of non- compliance with any insurance requirement in no way imposes any additional obligations on City nor does it waive any rights hereunder in this or any other regard. 14. Contracting Party will renew the required coverage annually as long as City, or its employees or agents face an exposure from operations of any type pursuant to this agreement. This obligation applies whether the agreement is canceled or terminated for any reason. Termination of this obligation is not effective until City executes a written statement to that effect. 15. Contracting Party shall provide proof that policies of insurance required herein expiring during the term of this Agreement have been renewed or replaced with other policies providing at least the same coverage. Proof that such coverage has been ordered shall be submitted prior to expiration. A coverage binder or letter from Contracting Party’s insurance agent to this effect is acceptable. A certificate of insurance and an additional insured endorsement is required in these specifications applicable to the renewing or new coverage must be provided to City within five (5) days of the expiration of coverages. 16. The provisions of any workers’ compensation or similar act will not limit the obligations of Contracting Party under this agreement. Contracting Party expressly agrees not to use any statutory immunity defenses under such laws with respect to City, its employees, officials, and agents. 17. Requirements of specific coverage features, or limits contained in this section are not intended as limitations on coverage, limits or other requirements nor as a waiver of any coverage normally provided by any given policy. Specific reference to a given coverage feature is for purposes of clarification only as it pertains to a given issue and is not intended by any party or insured to be limiting or all-inclusive. 18. These insurance requirements are intended to be separate and distinct from any other provision in this Agreement and are intended by the parties here to be interpreted as such. 52 Exhibit E Page 7 of 7 19. The requirements in this Exhibit supersede all other sections and provisions of this Agreement to the extent that any other section or provision conflicts with or impairs the provisions of this Exhibit. 20. Contracting Party agrees to be responsible for ensuring that no contract used by any party involved in any way with the project reserves the right to charge City or Contracting Party for the cost of additional insurance coverage required by this agreement. Any such provisions are to be deleted with reference to City. It is not the intent of City to reimburse any third party for the cost of complying with these requirements. There shall be no recourse against City for payment of premiums or other amounts with respect thereto. 21. Contracting Party agrees to provide immediate notice to City of any claim or loss against Contracting Party arising out of the work performed under this agreement. City assumes no obligation or liability by such notice, but has the right (but not the duty) to monitor the handling of any such claim or claims if they are likely to involve City. 53 Exhibit F Page 1 of 3 Exhibit F Indemnification F.1 Indemnity for the Benefit of City. a. Indemnification for Professional Liability. When the law establishes a professional standard of care for Contracting Party’s Services, to the fullest extent permitted by law, Contracting Party shall indemnify, protect, defend (with counsel selected by City), and hold harmless City and any and all of its officials, employees, and agents (“Indemnified Parties”) from and against any and all claims, losses, liabilities of every kind, nature, and description, damages, injury (including, without limitation, injury to or death of an employee of Contracting Party or of any subcontractor), costs and expenses of any kind, whether actual, alleged or threatened, including, without limitation, incidental and consequential damages, court costs, attorneys’ fees, litigation expenses, and fees of expert consultants or expert witnesses incurred in connection therewith and costs of investigation, to the extent same are caused in whole or in part by any negligent or wrongful act, error or omission of Contracting Party, its officers, agents, employees or subcontractors (or any entity or individual that Contracting Party shall bear the legal liability thereof) in the performance of professional services under this agreement. With respect to the design of public improvements, the Contracting Party shall not be liable for any injuries or property damage resulting from the reuse of the design at a location other than that specified in Exhibit A without the written consent of the Contracting Party. b. Indemnification for Other Than Professional Liability. Other than in the performance of professional services and to the full extent permitted by law, Contracting Party shall indemnify, defend (with counsel selected by City), and hold harmless the Indemnified Parties from and against any liability (including liability for claims, suits, actions, arbitration proceedings, administrative proceedings, regulatory proceedings, losses, expenses or costs of any kind, whether actual, alleged or threatened, including, without limitation, incidental and consequential damages, court costs, attorneys’ fees, litigation expenses, and fees of expert consultants or expert witnesses) incurred in connection therewith and costs of investigation, where the same arise out of, are a consequence of, or are in any way attributable to, in whole or in part, by any negligent act, error or omission of Contracting Party in the performance of this Agreement by Contracting Party or by any individual or entity for which Contracting Party is legally liable, including but not limited to officers, agents, employees, or subcontractors of Contracting Party. 54 Exhibit F Page 2 of 3 c. Indemnity Provisions for Contracts Related to Construction (Limitation on Indemnity). Without affecting the rights of City under any provision of this agreement, Contracting Party shall not be required to indemnify and hold harmless City for liability attributable to the active negligence of City, provided such active negligence is determined by agreement between the parties or by the findings of a court of competent jurisdiction. In instances where City is shown to have been actively negligent and where City’s active negligence accounts for only a percentage of the liability involved, the obligation of Contracting Party will be for that entire portion or percentage of liability not attributable to the active negligence of City. d. Indemnification Provision for Design Professionals. 1. Applicability of this Section F.1(d). Notwithstanding Section F.1(a) hereinabove, the following indemnification provision shall apply to a Contracting Party who constitutes a “design professional” as the term is defined in paragraph 3 below. 2. Scope of Indemnification. When the law establishes a professional standard of care for Contracting Party’s Services, to the fullest extent permitted by law, Contracting Party shall indemnify and hold harmless City and any and all of its officials, employees, and agents (“Indemnified Parties”) from and against any and all losses, liabilities of every kind, nature, and description, damages, injury (including, without limitation, injury to or death of an employee of Contracting Party or of any subcontractor), costs and expenses, including, without limitation, incidental and consequential damages, court costs, reimbursement of attorneys’ fees, litigation expenses, and fees of expert consultants or expert witnesses incurred in connection therewith and costs of investigation, to the extent same are caused by any negligent or wrongful act, error or omission of Contracting Party, its officers, agents, employees or subcontractors (or any entity or individual that Contracting Party shall bear the legal liability thereof) in the performance of professional services under this agreement. With respect to the design of public improvements, the Contracting Party shall not be liable for any injuries or property damage resulting from the reuse of the design at a location other than that specified in Exhibit A without the written consent of the Contracting Party. 3. Design Professional Defined. As used in this Section F.1(d), the term “design professional” shall be limited to licensed architects, registered professional engineers, licensed professional land surveyors and landscape architects, all as defined under current law, and as may be amended from time to time by Civil Code § 2782.8. 55 Exhibit F Page 3 of 3 F.2 Obligation to Secure Indemnification Provisions. Contracting Party agrees to obtain executed indemnity agreements with provisions identical to those set forth herein this Exhibit F, as applicable to the Contracting Party, from each and every subcontractor or any other person or entity involved by, for, with or on behalf of Contracting Party in the performance of this Agreement. In the event Contracting Party fails to obtain such indemnity obligations from others as required herein, Contracting Party agrees to be fully responsible according to the terms of this Exhibit. Failure of City to monitor compliance with these requirements imposes no additional obligations on City and will in no way act as a waiver of any rights hereunder. This obligation to indemnify and defend City as set forth in this Agreement are binding on the successors, assigns or heirs of Contracting Party and shall survive the termination of this Agreement. 56 Exhibit G Page 1 of 18 Exhibit G Terms and Conditions Applicable to Agreement Based On Federal Assistance (Federal Emergency Management Agency – FEMA) G.1 Incorporation into Agreement. Notwithstanding any terms or conditions in the Agreement (which includes Exhibits A-F attached hereto) to the contrary, and subject to contractual construction consistent with Sections G.2 and G.3 herein, the following terms and conditions in this Exhibit G shall apply and be of full force and effect to Contracting Party (periodically also referred to in this Exhibit G as the “Vendor,” “vendor,” “Contractor” or “contractor”). G.2 General FEMA Requirements. FEMA financial assistance will be used to fund all or a portion of the Agreement (periodically also referred to in this Exhibit G as the “Contract” or “contract”). The Contracting Party shall comply with all federal requirements including, but not limited to, the following: 1. 2 C.F.R. Part 200 – Uniform Administrative Requirements, Cost Principles, and Audit Requirements for Federal Awards, which is expressly incorporated herein by reference. 2. Federal Contract Provisions attached herein as this Exhibit G and incorporated herein by reference. Subcontracts, if any, shall contain a provision making them subject to all of the provisions stipulated in the Agreement, including but not limited to, 2 C.F.R. Part 200 and the Federal Contract Provisions. With respect to any conflict between such federal requirements and the terms of this contract and/or the provisions of state law and except as otherwise required under federal law or regulation, the more stringent requirement shall control. During the performance of the Agreement, Contracting Party shall comply with all applicable federal laws and regulations including but not limited to the federal contract provisions in this Exhibit. In this Exhibit, the terms “Agency” or “administering agency” shall mean the City as the local agency entering into the Agreement with the Contracting Party. 57 Exhibit G Page 2 of 18 A. LEGAL, CONTRACTUAL, AND ADMINISTRATIVE REMEDIES FOR BREACH OF CONTRACT Enforcement of the Agreement shall be in accordance with SECTION 8 of the Agreement, and City and Contracting Party shall be governed by those terms and conditions for notices of default, breach, and rights and remedies therein provided. In addition to the terms and conditions in SECTION 8 of the Agreement, the legal, contractual, and administrative remedies for breach of contract in this Section G.2(A) of this Exhibit G may be applicable, as set forth below. (i) Contract Interpretation by the Contract Officer. Questions regarding the meaning and intent of the Agreement shall be referred in writing by the Contracting Party to the Contract Officer for the City. The Contract Officer shall respond to the Contracting Party in writing with a decision. If the Agreement does not specify a Contract Officer, or if the specified Contract Officer should not be involved in resolving contractual disputes based on the reasonable discretion of the City Manager, then the City Manager or City Manager’s authorized designee shall be the “Contract Officer” for purposes of this Exhibit G. (ii) Claims. Submission of a claim, properly certified, with all required supporting documentation, and written rejection or denial of all or part of the claim by the City, is a condition precedent to any action, proceeding, litigation, suit or demand for arbitration by the Contracting Party. (iii) Notice. If the Contractor disagrees with the Contract Officer’s decision in Section G.2(A)(i) above, or in any case where the Contracting Party deems additional compensation or a time extension to the Agreement period is due for work or materials not covered in the Agreement or which the Contract Officer has not recognized as extra work, the Contracting Party shall notify the Contract Officer, in writing, of his intention to make a claim. Claims pertaining to decisions provided in Section G.2(A)(i) above shall be filed in writing to the Contract Officer within five (5) days of receipt of such decision. All other claims notices for extra work shall be filed in writing to the Contract Officer prior to the commencement of such work. Written notice shall use the words "Notice of Potential Claim." Such Notice of Potential Claim shall state the circumstances and the reasons for the claim, but need not state the amount. No claim filed after the date of final payment will be considered. 58 Exhibit G Page 3 of 18 It is agreed that unless notice is properly given, the Contracting Party shall not recover costs incurred as a result of the alleged extra work, changed work or other situation which had proper notice been given would have given rise to a right for additional compensation. The Contracting Party should understand that timely notice of potential claim is of great importance to the City, and is not merely a formality. Such notice allows the City to consider preventative action, to monitor the Contracting Party’s increased costs resulting from the situation, to marshal facts, and to plan its affairs. Such notice by the Contracting Party, and the fact that the Contract Office has kept account of the cost as aforesaid, shall not in any way be construed as proving the validity of the claim. (iv) Submission of claim costs. Within 30 days after the last cost of work for which the Contracting Party contends additional compensation is due, but if costs are incurred over a span of more than 30 days, then within 15 days after the thirtieth day and every month thereafter, the Contracting Party shall submit to the Contract Officer the costs incurred for the claimed matter. Claims shall be made in itemized detail satisfactory to the Contract Officer in content, detail and format of presentation. If the additional costs are in any respect not knowable with certainty, they shall be estimated. If the claim is found to be just, it shall be allowed and paid for as provided for in the Agreement. (v) Affidavit required. All claims submitted to the City shall be accompanied with a type written affidavit containing the following language; it must be signed, dated, and notarized on the Contracting Party’s letterhead: “I, (must be an officer) , being the (title) of (contractor's name) , declare under penalty of perjury under the laws of the state of California, and do personally certify and attest that: I have thoroughly reviewed the attached claim for additional compensation and/or extension of time, and know its contents, and said claim is made in good faith; the supporting data is truthful and accurate; the amount requested accurately reflects the contract adjustment for which the contractor believes the City of La Quinta is liable; and further, that I am familiar with California Penal Code Section 72 and California Government Code Section 12560, Et Seq, pertaining to false claims, and further know and understand that submission or certification of a false claim may lead to fines, imprisonment and/or other severe legal consequences.” (vi) Claim meetings. From time to time the Contract Officer may call special meetings to discuss outstanding claims. The Contracting Party shall cooperate and attend, prepared to discuss outstanding claims, making 59 Exhibit G Page 4 of 18 available the personnel necessary for claim resolution, and providing documents reasonably requested by the Contract Officer. (vii) Resolution of Claims. For all contracts awarded during the effective dates of Public Contract Code Section 20104, where claims cannot be resolved between the parties, claims for three hundred and seventy five thousand dollars ($375,000) or less shall be resolved pursuant to the provisions of that code section, which is summarized in Sections G.2(A)(viii)-(xii) below. For claims greater than three hundred and seventy five thousand dollars ($375,000) Sections G.2(A)(viii)-(xi) are applicable; however, Section G.2(A)(xii) [Civil Actions for claims less than $375,000] is not applicable. (viii) Claims Less Than $50,000. (a) For claims of less than fifty thousand dollars ($50,000), the Contract Officer shall respond in writing to written claims within 45 days of receipt of the claim in Section G.2(A)(ii), or may request, in writing, within 30 days of receipt of the claim, any additional documentation supporting the claim or relating to defenses or claims the City may have against the Contracting Party. (b) If additional information is thereafter required, it shall be requested and provided pursuant to this section, upon mutual agreement of the City and the Contracting Party. (c) The Contract Officer’s written response to the claim, as further documented, shall be submitted to the Contractor within 15 days after receipt of the further documentation or within a period of time no greater than that taken by the Contractor in producing the additional information, whichever is greater. (ix) Claims Greater Than $50,000. (a) For claims of over fifty thousand dollars ($50,000), the Contract Officer shall respond in writing to all written claims within 60 days of receipt of the claim in Section G.2(A)(ii), or may request, in writing, within 30 days of receipt of the claim, any additional documentation supporting the claim or relating to defenses or claims the City may have against the Contracting Party. 60 Exhibit G Page 5 of 18 (b) If additional information is thereafter required, it shall be requested and provided pursuant to this paragraph, upon mutual agreement of the City and the Contracting Party. (c) The Contract Officer’s written response to the claim, as further documented, shall be submitted to the Contracting Party within 30 days after receipt of the further documentation, or within a period of time no greater than that taken by the Contracting Party in producing the additional information or requested documentation, whichever is greater. (x) Claim Conference. If the Contracting Party disputes the Contract Officer’s written response, or if the Contract Officer fails to respond within the time prescribed, the Contracting Party may so notify the City, in writing, either within 15 days of receipt of the Contract Officer’s response or within 15 days of the Contract Officer’s failure to respond within the time prescribed, respectively, and demand an informal conference to meet and confer for settlement of the issues in dispute. Upon a demand, the City shall schedule a meet and conference within 30 days for settlement of the dispute. (xi) Claim Filing. If the claim or any portion remains in dispute after the claim conference noted in Section G.2(A)(x) [Claim Conference], the Contracting Party may file a claim pursuant to Chapter 1 (commencing with Section 900) and Chapter 2 (commencing with Section 910) of Part 3 of Division 3.6 of Title 1 of the Government Code. For purposes of those provisions, the running of the period of time within which a claim must be filed shall be tolled from the time the Contracting Party submits his or her written claim pursuant to Section G.2(A)(ii) [Claims] until the time the claim is denied, including any period of time utilized in the meet and confer process. (xii) Civil Actions for Claims Less Than $375,000. The following procedures are established for all civil actions filed to resolve claims for less than three hundred seventy five thousand dollars ($375,000): (a) Within 60 days, but no earlier than 30 days, following the filing or responsive pleading, the court shall submit the matter to non-binding mediation unless waived by mutual stipulation of both parties. The mediation process shall provide for the selection within 15 days by both parties of a disinterested third person as mediator, shall be commenced within 30 days of the submittal, and shall be concluded within 15 days from the commencement of the mediation unless a time requirement is extended upon a good cause showing to the court. 61 Exhibit G Page 6 of 18 (b) If the matter remains in dispute, the case shall be submitted to judicial arbitration pursuant to Chapter 2.5 (commencing with Section 1141.10) of Title 3 of Part 3 of the Code of Civil Procedure, notwithstanding Section 1141.11 of that Code. The Civil Discovery Act of 1986 (Article 3 (commencing with Section 2016) of Chapter 3 of Title 3 of Part 4 of the Code of Civil Procedure) shall apply to any proceeding brought under this subdivision consistent with the rules pertaining to judicial arbitration. (c) In addition to Chapter 2.5 (commencing with Section 1141.10) of Title 3 of Part 3 of the Code of Civil Procedure, (A) arbitrators shall, when possible, be experienced in federal and state law relevant to the scope of services and obligations under this Agreement, and (B) any party appealing an arbitration award who does not obtain a more favorable judgment shall, in addition to payment of costs and fees under the chapter, also pay the attorney's fees on appeal of the other party. (xiii) Unresolved Issues. Unless this Agreement provides otherwise, all claims, counterclaims, disputes, and other matters in question between the City and the Contracting Party that are not resolved between the City and the Contracting Party shall be decided by a court of competent jurisdiction. Should either party to this Agreement bring legal action against the other, the case shall be handled in Riverside County, California, in a court of competent jurisdiction in that county. (xiv) Records of Disputed Work. In proceeding with a disputed portion of the Scope of Work, the Contracting Party shall keep accurate records of its costs and shall make available, to the Contract Officer, a daily summary of the hours and classification of equipment and labor utilized on the disputed work, as well as a summary of any materials or any specialized services which are used. Such information shall be submitted to the Contract Officer on a monthly basis, receipt of which shall not be construed as an authorization for or acceptance of the disputed work. B. TERMINATION FOR CAUSE AND CONVENIENCE Enforcement of the contract shall be in accordance with SECTION 8 of the Agreement, and City and Contracting Party shall be governed by those terms and conditions for termination for cause (Section 8.8) and termination for convenience (Section 8.7). In addition to the terms and conditions in SECTION 8 of the Agreement, the termination for cause and convenience in this Section G.2(B) of this Exhibit G may be applicable, as set forth below. 62 Exhibit G Page 7 of 18 (i) General Guidance for FEMA Contracts. If the Agreement is in excess of $10,000 and the Agreement does not include provisions for both termination for cause and termination for convenience by the City, including the manner by which it will be effected and the basis for settlement, then the following termination clauses shall apply. If the Agreement is for more than the simplified acquisition threshold (see 2 C.F.R. § 200.88) at the time the Agreement is executed and does not provide for administrative, contractual, or legal remedies in instances where Contracting Party violates or breaches the terms of the Agreement, then the following termination clauses shall apply and have precedence over the Agreement. Otherwise, the following termination clauses in this Section G.2(B)(ii)-(v) shall not be applicable to the Agreement. (ii) Termination for Convenience. The City may, by written notice to Contracting Party, terminate this Agreement for convenience, in whole or in part, at any time by giving written notice to Contracting Party of such termination, and specifying the effective date thereof (“Notice of Termination for Convenience”). If the termination is for the convenience of the City, the City shall compensate Contracting Party for work or materials fully and adequately provided through the effective date of termination. No amount shall be paid for unperformed work or materials not provided, including anticipated profit. Contracting Party shall provide documentation deemed adequate by the City to show the work actually completed or materials provided by Contracting Party prior to the effective date of termination. This Agreement shall terminate on the effective date of the Notice of Termination. (iii) Termination for Cause. If Contracting Party fails to perform pursuant to the terms of this Agreement, the City shall provide written notice to Contracting Party specifying the default (“Notice of Default”). If Contracting Party does not cure such default within ten (10) calendar days of receipt of Notice of Default, the City may terminate this Agreement for cause. If Contracting Party fails to cure a default as set forth above, the City may, by written notice to Contracting Party, terminate this Agreement for cause, in whole or in part, and specifying the effective date thereof (“Notice of Termination for Cause”). If the termination is for cause, Contracting Party shall be compensated for that portion of the work or materials provided which has been fully and adequately completed and accepted by the City as of the date the City provides the Notice of Termination. In such case, the City shall have the right to take whatever steps it deems necessary to complete the project and correct Contracting Party's deficiencies and charge the cost thereof to Contracting Party, who shall be liable for the full cost of the City's corrective action, including reasonable overhead, profit and attorneys' fees. 63 Exhibit G Page 8 of 18 (iv) Reimbursement; Damages. The City shall be entitled to reimbursement for any compensation paid in excess of work rendered or materials provided and shall be entitled to withhold compensation for defective work or other damages caused by Contracting Party’s performance of the work. (v) Additional Termination Provisions. Upon receipt of a Notice of Termination, either for cause or for convenience, Contracting Party shall promptly discontinue the work unless the Notice directs to the contrary. Contracting Party shall deliver to the City and transfer title (if necessary) to all provided materials and completed work, and work in progress including drafts, documents, plans, forms, maps, products, graphics, computer programs and reports. The rights and remedies of the parties provided in this Section G.2(B) are in addition to any other rights and remedies provided by law or under this Agreement. Contracting Party acknowledges the City’s right to terminate this Agreement with or without cause as provided in this Section G.2(B), and hereby waives any and all claims for damages that might arise from the City’s termination of this Agreement. The City shall not be liable for any costs other than the charges or portions thereof which are specified herein. Contracting Party shall not be entitled to payment for unperformed work or materials not provided, and shall not be entitled to damages or compensation for termination of work or supply of materials. If City terminates the Agreement for cause, and it is later determined that the termination for cause was wrongful, the termination shall automatically be converted to and treated as a termination for convenience. In such event, Contracting Party shall be entitled to receive only the amounts payable under this Section G.2(B), and Contracting Party specifically waives any claim for any other amounts or damages, including, but not limited to, any claim for consequential damages or lost profits. The rights and remedies of the City provided in this Section G.2(B) shall not be exclusive and are in addition to any other rights and remedies provided by law, equity or under the Agreement including, but not limited to, the right to specific performance. C. EQUAL EMPLOYMENT OPPORTUNITY During the performance of the Agreement (“contract”), the Contracting Party (“contractor”) agrees as follows: (i) The contractor will not discriminate against any employee or applicant for employment because of race, color, religion, sex, or national origin. The contractor will take affirmative action to ensure that applicants are employed, and that employees are treated during employment without regard to their race, color, religion, sex, or national origin. Such action shall include, but not be limited to the following: 64 Exhibit G Page 9 of 18 Employment, upgrading, demotion, or transfer; recruitment or recruitment advertising; layoff or termination; rates of pay or other forms of compensation; and selection for training, including apprenticeship. The contractor agrees to post in conspicuous places, available to employees and applicants for employment, notices to be provided setting forth the provisions of this nondiscrimination clause. (ii) The contractor will, in all solicitations or advertisements for employees placed by or on behalf of the contractor, state that all qualified applicants will receive considerations for employment without regard to race, color, religion, sex, or national origin. (iii) The contractor will not discharge or in any other manner discriminate against any employee or applicant for employment because such employee or applicant has inquired about, discussed, or disclosed the compensation of the employee or applicant or another employee or applicant. This provision shall not apply to instances in which an employee who has access to the compensation information of other employees or applicants as a part of such employee's essential job functions discloses the compensation of such other employees or applicants to individuals who do not otherwise have access to such information, unless such disclosure is in response to a formal complaint or charge, in furtherance of an investigation, proceeding, hearing, or action, including an investigation conducted by the employer, or is consistent with the contractor's legal duty to furnish information. (iv) The contractor will send to each labor union or representative of workers with which he has a collective bargaining agreement or other contract or understanding, a notice to be provided advising the said labor union or workers’ representatives of the contractor’s commitments under this Section G.2(C), and shall post copies of the notice in conspicuous places available to employees and applicants for employment. (v) The contractor will comply with all provisions of Executive Order 11246 of September 24, 1965, and of the rules, regulations, and relevant orders of the Secretary of Labor. (vi) The contractor will furnish all information and reports required by Executive Order 11246 of September 24, 1965, and by rules, regulations, and orders of the Secretary of Labor, or pursuant thereto, and will permit access to books, records, and accounts by the City (“administering agency”) and the Secretary of Labor for purposes of investigation to ascertain compliance with such rules, regulations, and orders. 65 Exhibit G Page 10 of 18 (vii) In the event of the contractor's noncompliance with the nondiscrimination clauses of this contract or with any of the said rules, regulations, or orders, this contract may be canceled, terminated, or suspended in whole or in part and the contractor may be declared ineligible for further Government contracts or federally assisted construction contracts in accordance with procedures authorized in Executive Order 11246 of September 24, 1965, and such other sanctions as may be imposed and remedies invoked as provided in Executive Order 11246 of September 24, 1965, or by rule, regulation, or order of the Secretary of Labor, or as otherwise provided by law. (viii) The contractor will include the portion of the sentence immediately preceding paragraph (i) and the provisions of paragraphs (i) through (viii) in every subcontract or purchase order unless exempted by rules, regulations, or orders of the Secretary of Labor issued pursuant to section 204 of Executive Order 11246 of September 24, 1965, so that such provisions will be binding upon each subcontractor or vendor. The contractor will take such action with respect to any subcontract or purchase order as the administering agency may direct as a means of enforcing such provisions, including sanctions for noncompliance; Provided, That in the event a contractor becomes involved in, or is threatened with, litigation with a subcontractor or vendor as a result of such direction by the administering agency, the contractor may request the United States to enter into such litigation to protect the interests of the United States. The contractor further agrees that it will be bound by the above equal opportunity clause with respect to its own employment practices when it participates in federally assisted construction work; Provided, That if the contractor so participating is a State or local government, the above equal opportunity clause is not applicable to any agency, instrumentality or subdivision of such government which does not participate in work on or under the contract. The contractor agrees that it will assist and cooperate actively with the administering agency and the Secretary of Labor in obtaining the compliance of contractors and subcontractors with the equal opportunity clause and the rules, regulations, and relevant orders of the Secretary of Labor, that it will furnish the administering agency and the Secretary of Labor such information as they may require for the supervision of such compliance, and that it will otherwise assist the administering agency in the discharge of the agency's primary responsibility for securing compliance. The contractor further agrees that it will refrain from entering into any contract or contract modification subject to Executive Order 11246 of September 24, 1965, with a contractor debarred from, or who has not demonstrated eligibility for, Government contracts and federally assisted construction contracts pursuant to the Executive Order and will carry out such sanctions and penalties for violation of the equal opportunity clause as may be imposed upon contractors and subcontractors by the administering agency or the Secretary of Labor 66 Exhibit G Page 11 of 18 pursuant to Part II, Subpart D of the Executive Order. In addition, the contractor agrees that if it fails or refuses to comply with these undertakings, the administering agency may take any or all of the following actions: Cancel, terminate, or suspend in whole or in part a grant (contract, loan, insurance, guarantee); refrain from extending any further assistance to the contractor under the program with respect to which the failure or refund occurred until satisfactory assurance of future compliance has been received from such contractor; and refer the case to the Department of Justice for appropriate legal proceedings. D. DAVIS-BACON ACT During the performance of the Agreement (“contract”), the Contracting Party (“contractor”) agrees as follows: (i) All transactions regarding this contract shall be done in compliance with the Davis-Bacon Act (40 U.S.C. 3141- 3144, and 3146-3148) and the requirements of 29 C.F.R. pt. 5 as may be applicable. The contractor shall comply with 40 U.S.C. 3141-3144, and 3146-3148 and the requirements of 29 C.F.R. pt. 5 as applicable. (ii) Contractors are (and the contractor is) required to pay wages to laborers and mechanics at a rate not less than the prevailing wages specified in a wage determination made by the Secretary of Labor. (iii) Additionally, contractors are (and the contractor is) required to pay wages not less than once a week. E. COPELAND ANTI-KICKBACK ACT During the performance of the Agreement (“contract”), the Contracting Party (“contractor”) agrees to comply with the Copeland Anti-Kickback Act, as follows: (i) Contractor. The contractor shall comply with 18 U.S.C. § 874, 40 U.S.C. § 3145, and the requirements of 29 C.F.R. pt. 3, as may be applicable, which are incorporated by reference into this contract. (ii) Subcontracts. The contractor or subcontractor shall insert in any subcontracts the clause above and such other clauses as FEMA may by appropriate instructions require, and also a clause requiring the subcontractors to include these clauses in any lower tier subcontracts. The prime contractor shall be responsible for the compliance by any subcontractor or lower tier subcontractor with all of these contract clauses. 67 Exhibit G Page 12 of 18 (iii) Breach. A breach of the contract clauses above may be grounds for termination of the contract, and for debarment as a contractor and subcontractor as provided in 29 C.F.R. § 5.12. F. CONTRACT WORK HOURS AND SAFETY STANDARDS ACT During the performance of the Agreement (“contract”), the Contracting Party (“contractor”) agrees to comply with the Contract Work Hours and Safety Standards Act, as follows: (i) Overtime requirements. No contractor or subcontractor contracting for any part of the contract work which may require or involve the employment of laborers or mechanics shall require or permit any such laborer or mechanic in any workweek in which he or she is employed on such work to work in excess of forty hours in such workweek unless such laborer or mechanic receives compensation at a rate not less than one and one-half times the basic rate of pay for all hours worked in excess of forty hours in such workweek. (ii) Violation; liability for unpaid wages; liquidated damages. In the event of any violation of the clause set forth in Section G.2(F)(i) above, the contractor and any subcontractor responsible therefor shall be liable for the unpaid wages. In addition, such contractor and subcontractor shall be liable to the United States (in the case of work done under contract for the District of Columbia or a territory, to such District or to such territory), for liquidated damages. Such liquidated damages shall be computed with respect to each individual laborer or mechanic, including watchmen and guards, employed in violation of the clause set forth in Section G.2(F)(i) above, in the sum of $27 for each calendar day on which such individual was required or permitted to work in excess of the standard workweek of forty hours without payment of the overtime wages required by the clause set forth in Section G.2(F)(i) above. (iii) Withholding for unpaid wages and liquidated damages. The City, shall upon its own action or upon written request of an authorized representative of the Department of Labor, withhold or cause to be withheld, from any moneys payable on account of work performed by the contractor or subcontractor under any such contract or any other Federal contract with the same prime contractor, or any other federally-assisted contract subject to the Contract Work Hours and Safety Standards Act, which is held by the same prime contractor, such sums as may be determined to be necessary to satisfy any liabilities of such contractor or subcontractor for unpaid wages and liquidated damages as provided in the clause set forth in Section G.2(F)(i) above. 68 Exhibit G Page 13 of 18 (iv) Subcontracts. The contractor or subcontractor shall insert in any subcontracts the clauses set forth in Sections G.2(F)(i)-(iv) and also a clause requiring the subcontractors to include these clauses in any lower tier subcontracts. The prime contractor shall be responsible for compliance by any subcontractor or lower tier subcontractor with the clauses set forth in Sections G.2(F)(i)-(iv). G. CLEAN AIR ACT AND THE FEDERAL WATER POLLUTION CONTROL ACT During the performance of the Agreement (“contract”), the Contracting Party (“contractor”) agrees as follows: (i) Clean Air Act (a) The contractor agrees to comply with all applicable standards, orders or regulations issued pursuant to the Clean Air Act, as amended, 42 U.S.C. § 7401 et seq. (b) The contractor agrees to report each violation to the City and understands and agrees that the City will, in turn, report each violation as required to assure notification to the Federal Emergency Management Agency, and the appropriate Environmental Protection Agency Regional Office. (c) The contractor agrees to include these requirements in each subcontract exceeding $150,000 financed in whole or in part with Federal assistance provided by FEMA. (ii) Federal Water Pollution Control Act (a) The contractor agrees to comply with all applicable standards, orders or regulations issued pursuant to the Federal Water Pollution Control Act, as amended, 33 U.S.C. 1251 et seq. (b) The contractor agrees to report each violation to the City and understands and agrees that the City will, in turn, report each violation as required to assure notification to the Federal Emergency. (c) The contractor agrees to include these requirements in each subcontract exceeding $150,000 financed in whole or in part with Federal assistance provided by FEMA. 69 Exhibit G Page 14 of 18 H. DEBARMENT AND SUSPENSION During the performance of the Agreement (“contract”), the Contracting Party (“contractor”) agrees as follows: (i) This contract is a covered transaction for purposes of 2 C.F.R. pt. 180 and 2 C.F.R. pt. 3000. As such the contractor is required to verify that none of the contractor, its principals (defined at 2 C.F.R. § 180.995), or its affiliates (defined at 2 C.F.R. § 180.905) are excluded (defined at 2 C.F.R. § 180.940) or disqualified (defined at 2 C.F.R. § 180.935). (ii) The contractor must comply with 2 C.F.R. pt. 180, subpart C and 2 C.F.R. pt. 3000, subpart C and must include a requirement to comply with these regulations in any lower tier covered transaction it enters into. (iii) This certification is a material representation of fact relied upon by City. If it is later determined that the contractor did not comply with 2 C.F.R. pt. 180, subpart C and 2 C.F.R. pt. 3000, subpart C, in addition to remedies available to City, the Federal Government may pursue available remedies, including but not limited to suspension and/or debarment. (iv) Any bidder or proposer agrees to comply with the requirements of 2 C.F.R. pt. 180, subpart C and 2 C.F.R. pt. 3000, subpart C while any offer is valid and throughout the period of any contract that may arise from an offer subject to the requirements of this Exhibit G. The bidder or proposer further agrees to include a provision requiring such compliance in its lower tier covered transactions. I. BYRD ANTI-LOBBYING AMENDMENT During the performance of the Agreement (“contract”), the Contracting Party (“contractor”) agrees as follows: (i) Contractors who apply or bid for an award of $100,000 or more shall file the required certification. Each tier certifies to the tier above that it will not and has not used Federal appropriated funds to pay any person or organization for influencing or attempting to influence an officer or employee of any agency, a member of Congress, officer or employee of Congress, or an employee of a member of Congress in connection with obtaining any Federal contract, grant or any other award covered by 31 U.S.C. § 1352. (ii) Each tier must also disclose any lobbying with non-Federal funds that takes place in connection with obtaining any Federal award. Such disclosures are forwarded from tier to tier up to the recipient who in turn will forward the certification(s) to the awarding agency. 70 Exhibit G Page 15 of 18 (iii) If applicable, contractors must sign and submit to the City (the non- federal entity) the following certification: APPENDIX A, 44 C.F.R. PART 18–CERTIFICATION REGARDING LOBBYING Certification for Contracts, Grants, Loans, and Cooperative Agreements. The undersigned certifies, to the best of his or her knowledge and belief, that: 1. No Federal appropriated funds have been paid or will be paid, by or on behalf of the undersigned, to any person for influencing or attempting to influence an officer or employee of an agency, a Member of Congress, an officer or employee of Congress, or an employee of a Member of Congress in connection with the awarding of any Federal contract, the making of any Federal grant, the making of any Federal loan, the entering into of any cooperative agreement, and the extension, continuation, renewal, amendment, or modification of any Federal contract, grant, loan, or cooperative agreement. 2. If any funds other than Federal appropriated funds have been paid or will be paid to any person for influencing or attempting to influence an officer or employee of any agency, a Member of Congress, an officer or employee of Congress, or an employee of a Member of Congress in connection with this Federal contract, grant, loan, or cooperative agreement, the undersigned shall complete and submit Standard Form- LLL, “Disclosure Form to Report Lobbying,” in accordance with its instructions. 3. The undersigned shall require that the language of this certification be included in the award documents for all subawards at all tiers (including subcontracts, subgrants, and contracts under grants, loans, and cooperative agreements) and that all subrecipients shall certify and disclose accordingly. This certification is a material representation of fact upon which reliance was placed when this transaction was made or entered into. Submission of this certification is a prerequisite for making or entering into this transaction imposed by 31, U.S.C. § 1352 (as amended by the Lobbying Disclosure Act of 1995). Any person who fails to file the required certification shall be subject to a civil penalty of not less than $10,000 and not more than $100,000 for each such failure. 71 Exhibit G Page 16 of 18 J. PROCUREMENT OF RECOVERED MATERIALS During the performance of the Agreement (“contract”), the Contracting Party (“contractor”) agrees as follows: (i) In the performance of this contract, the contractor shall make maximum use of products containing recovered materials that are EPA- designated items unless the product cannot be acquired— (a) Competitively within a timeframe providing for compliance with the contract performance schedule; (b) Meeting contract performance requirements; or (c) At a reasonable price. (ii) Information about this requirement, along with the list of EPA- designate items, is available at EPA’s Comprehensive Procurement Guidelines web site, https://www.epa.gov/smm/comprehensive-procurement-guideline- cpg-program. (iii) The Contractor also agrees to comply with all other applicable requirements of Section 6002 of the “Solid Waste Disposal Act.” K. ACCESS TO RECORDS The following access to records requirements apply to the Agreement (“contract”): (i) The Contractor agrees to provide City, the FEMA Administrator, the Comptroller General of the United States, or any of their authorized 72 Exhibit G Page 17 of 18 representatives access to any books, documents, papers, and records of the Contractor which are directly pertinent to this contract for the purposes of making audits, examinations, excerpts, and transcriptions. (ii) The Contractor agrees to permit any of the foregoing parties to reproduce by any means whatsoever or to copy excerpts and transcriptions as reasonably needed. (iii) The Contractor agrees to provide the FEMA Administrator or authorized representatives access to construction or other work sites pertaining to the work being completed under the contract. (iv) In compliance with the Disaster Recovery Act of 2018, the City and Contractor acknowledge and agree that no language in this contract is intended to prohibit audits or internal reviews by the FEMA Administrator or the Comptroller General of the United States. L. DHS SEAL, LOGO, AND FLAGS The contractor shall not use the U.S. Department of Homeland Security (DHS) seal(s), logos, crests, or reproductions of flags or likenesses of DHS agency officials without specific FEMA pre-approval. M. COMPLIANCE WITH FEDERAL LAW, REGULATIONS, AND EXECUTIVE ORDERS This is an acknowledgement that FEMA financial assistance will be used to fund all or a portion of the contract. The contractor will comply with all applicable Federal law, regulations, executive orders, FEMA policies, procedures, and directives. N. NO OBLIGATION BY FEDERAL GOVERNMENT The Federal Government is not a party to this contract and is not subject to any obligations or liabilities to the non-Federal entity, contractor, or any other party pertaining to any matter resulting from the contract. O. PROGRAM FRAUD AND FALSE OR FRAUDULENT STATEMENTS OR RELATED ACTS The contractor acknowledges that 31 U.S.C. Chap. 38 (Administrative Remedies for False Claims and Statements) applies to the contractor’s actions pertaining to this contract. G.3 Irreconcilable Terms and Conditions – Exhibit G Governs; All Other Terms and Conditions Applicable and Enforceable to the Maximum Extent. If 73 Exhibit G Page 18 of 18 any term or condition in the Agreement (which includes Exhibits A-F attached) is directly and irreconcilably inconsistent with a term or condition set forth in this Exhibit G, where a term or condition cannot be concurrently applied to the Scope of Services in furtherance of the Contracting Party’s performance of this Agreement, then the term or condition in this Exhibit G shall apply. Except as provided in the preceding sentence, all terms and conditions in the Agreement shall continue to be in full force and effect, and applied along with the terms and conditions in this Exhibit G, to the maximum extent possible so as to give force and effect to each and every term and condition in the Agreement including this Exhibit G. * * * 74 City of La Quinta CITY COUNCIL MEETING: July 7, 2020 STAFF REPORT AGENDA TITLE: APPROVE CHANGE ORDER6 NO. 9 AND NO. 10 TO CONTRACT WITH URBAN HABITAT FOR THE SILVERROCK PARK VENUE PROJECT NO. 2016-08 FOR ALONGI BUILDING PAD AND MISCELLANEOUS ADDITIONAL WORK REQUESTS RECOMMENDATION Approve Change Order No. 9 in the amount of $98,161 and Change Order No. 10 in the amount of $30,345 to Fontract with Urban Habitat for the SilverRock Park Venue 3roject Alongi building pad and miscellaneous additional work requests; and authorize the City Manager to execute the change order. EXECUTIVE SUMMARY • On August 6, 2019, a contract was awarded to Urban Habitat (Contractor) for the construction of the La Quinta SilverRock Park Venue Project (Project) (Attachment 1) and construction began in September 2019. • On January 21, 2020, Council approved funding in the amount of $330,000 for engineering and construction of the Alongi building. • Change Order No. 9 (Attachment 2) includes improvements for the Alongi building in the amount of $98,161 for the foundation pad and utility adjustments. • Change Order No. 10 (Attachment 3) relates to miscellaneous additional work in the amount of $30,345 which includes an overflow to the lake system and over-excavation and compaction for the restroom foundation. FISCAL IMPACT There are sufficient funds in the project budget (Account No. 401-0000-60188, Project No. 151608) for the lake system overflow and over-excavation of the restroom in the amount of $30,345. The following table shows the projects budgeted revenue sources: Budget Arts in Public Spaces $ 300,000 CONSENT CALENDAR ITEM NO. 75 Measure G Funding $ 1,621,900 Park & Rec DIF Fund $ 2,400,000 Quimby Funding $ 2,000,000 Total Budget: $ 6,321,900 The Alongi building improvements in the amount of $98,161 are budgeted separately in Account No. 101-1007-71050 and there are sufficient funds available for this work. The following is a list of all change orders to date: Total Contract Original Contract Amount: $ 4,218,880 Contract Change Order No. 1: $ 5,630 Contract Change Order No. 2: $ 8,759 Contract Change Order No. 3: $ 42,996 Contract Change Order No. 4: $ 35,195 Contract Change Order No. 5: $ 209,856 Contract Change Order No. 6: $ 321,900 Contract Change Order No. 7: $ 3,563 Contract Change Order No. 8: $ (14,695) This Contract Change Order No. 9: $ 98,161 This Contract Change Order No. 10: $ 30,345 Final Contract Amount: $ 4,960,590 BACKGROUND/ANALYSIS Proposed Change Order No. 9 is recommended for approval in the amount of $98,161 for the grading and construction of the Alongi building pad and necessary utility adjustments. Proposed Change Order No. 10 is recommended for approval in the amount of $30,345 for installation of an additional overflow to the lake system line from the top lake to the existing basin and for over-excavation and compaction for the restroom foundation. In an abundance of caution, the additional overflow from the top of the lake system to the existing basin will prevent an accident or large storm from flooding or affecting the park. Additionally, the soils engineer recommended an added step of over-excavation and compaction prior to the installation of the restroom foundation. ALTERNATIVES Council may elect to not approve these change orders. Prepared by: Julie Mignogna, Management Analyst Approved by: Bryan McKinney, P.E., Public Works Director/City Engineer 76 Attachments: 1. Project Vicinity Map 2. Change Order No. 9 3. Change Order No. 10 77 78 79 80 CONTRACT: SilverRock Park Venue PROJECT NO. 2016-08 CONTRACTOR: Urban Habitat PO Box 1177 La Quinta, CA 92247 CONTRACT CHANGE ORDER NO. 9 Pursuant to the terms of the original Contract Agreement, you are hereby directed to make the herein described changes or do the following described work not included in the plans and specifications for this Contract. Unless otherwise stated all work shall conform to the terms, general conditions, and special provisions of the original Contract. DESCRIPTION OF CHANGE This Contract Change Order allows for Alongi Building Pad and Utility Adjustment Total $ 98,160.57 By reason of this contract change order the time of completion is adjusted as follows: - 6 - days added to contract time. The contract completion date shall be: 8/14/2020 Submitted By:Date: Approved By:Date: We, the undersigned Contractor, have given careful consideration to the change proposed and hereby agree, if this proposal is approved, that we will provide all equipment, furnish all materials, perform all labor, except as may be noted above, and perform all services necessary to complete the above specified work, and hereby accept as full payment the amount shown above, which includes all direct and indirect overhead expenses for any delays. Accepted By:Title: Contractor:Date: Previous Contract Amount Through CCO #8 $4,832,398.97 Add This Change Order No. 9 $98,160.57 Revised Contract Total $4,930,559.54 $77$&+0(17 81 82 CONTRACT: SilverRock Park Venue PROJECT NO. 2016-08 CONTRACTOR: Urban Habitat PO Box 1177 La Quinta, CA 92247 CONTRACT CHANGE ORDER NO. 10 Pursuant to the terms of the original Contract Agreement, you are hereby directed to make the herein described changes or do the following described work not included in the plans and specifications for this Contract. Unless otherwise stated all work shall conform to the terms, general conditions, and special provisions of the original Contract. DESCRIPTION OF CHANGE This Contract Change Order allows for Installation of an overflow for lake system Total $ 24,512.23 This Contract Change Order allows for Over Excavation for restroom Total $ 5,832.69 By reason of this contract change order the time of completion is adjusted as follows: - 10 - days added to contract time. The contract completion date shall be: 8/20/2020 Submitted By:Date: Approved By:Date: We, the undersigned Contractor, have given careful consideration to the change proposed and hereby agree, if this proposal is approved, that we will provide all equipment, furnish all materials, perform all labor, except as may be noted above, and perform all services necessary to complete the above specified work, and hereby accept as full payment the amount shown above, which includes all direct and indirect overhead expenses for any delays. Accepted By:Title: Contractor:Date: Previous Contract Amount Through CCO #9 $4,930,559.54 Add This Change Order No. 10 $30,344.92 Revised Contract Total $4,960,904.46 $77$&+0(17 83 84 City of La Quinta CITY COUNCIL MEETING: July 7, 2020 STAFF REPORT AGENDA TITLE:APPROVE GRANT OF EASEMENTS TO COACHELLA VALLEY WATER DISTRICT FOR ACCESS AND MAINTENANCE OF WATER PIPELINES AND FIRE HYDRANT FACILITIES LOCATED WITHIN THE SILVERROCK DEVELOPMENT RECOMMENDATION Approve a Grant of EasementV to Coachella Valley Water District for access to and maintenance of water pipelines within City of La Quinta owned land LQ the SilverRock Resort; and authorize the City Manager to execute the grant of easements. EXECUTIVE SUMMARY x Coachella Valley Water District (CVWD) requires an easement from the City for access to and maintenance of water pipeline and fire hydrant facilities located within City owned land in the SilverRock development. x The subject parcel is identified as Assessors’ Parcel Number 777-490- 047. FISCAL IMPACT There are sufficient funds in the project budget (Account No. 401-0000-60108, Project No. 141513T) for the title insurance policy that is required by CVWD in the amount of $1,000. BACKGROUND/ANALYSIS CVWD requires an access and pipeline easement from the City for their water pipeline that lies within City owned land located in the SilverRock development; the affected parcel is APN 777-490-047. CVWD has requested the City grant them the easement for access to and maintenance of their facilities and accompanied fire hydrant. CVWD has prepared the Grant of Easements and the City has prepared the legal description for access (Attachment 1). ALTERNATIVES Staff does not recommend an alternative; this easement is necessary for CVWD to access and maintain their facilities. Prepared by: Angela Ferreira, Management Analyst Approved by: Jon McMillen, City Manager Attachment: 1. Grant of Easement &216(17&$/(1'$5,7(012 85 No Recording Fees or Documentary Transfer Tax Government Code § 27383 Rev & Tax Code § 11922 RECORDING REQUESTED BY AND WHEN RECORDED MAIL TO: COACHELLA VALLEY WATER DISTRICT Post Office Box 1058 Coachella, California 92236 ____________________________________________________________________________________ APN: 777-490-047 (Space above this line is for Recorders use) FILE: 0421.1 TRA: 020-021 PM 37207 DTT: -0-0655. G R A N T O F E A S E M E N T FOR VALUABLE CONSIDERATION, the receipt of which is hereby acknowledged CITY OF LA QUINTA, a California municipal corporation and charter city (“Grantor” or “collectively Grantor”) hereby grants to COACHELLA VALLEY WATER DISTRICT, a public agency of the State of California (“Grantee”),and its successors and assigns, a perpetual, nonexclusive easement and right-of-way to install, construct, enlarge, survey, reconstruct, remove and replace, operate, maintain, repair, improve and relocate underground pipeline(s) and necessary devices and appurtenances thereto (“Pipeline(s)”) in, on, over, under, along and across that certain real property in the County of Riverside, State of California, described in Exhibit “A”and depicted on Exhibit “B”attached hereto (such rights being described hereafter as the “Easement”and the area affected thereby, the “Easement Area”). The Pipeline(s) may be installed pursuant to this Easement at different times and over a period of time. The Pipeline(s) and every part thereof shall, where it crosses Grantor’s property of which the Easement Area is a part (“Grantor’s Property”) be confined to the Easement Area and shall be constructed by Grantee with sufficient ground cover (i.e., distance between ground surface and top of Pipeline(s)) as shown on the construction plans for the Pipeline(s). The ground cover shall not be changed by any party other than Grantee. Fixtures and appurtenances used or useful in the operation of the Pipeline(s) may be constructed any distance either below or above the ground surface. The Easement includes (a) the right to enter Grantor’s Property to survey, construct, reconstruct, lay, relay, maintain, operate, control, use and remove the Pipeline(s), fixtures, appurtenances, and to remove objects interfering with the construction, operation and maintenance thereof; and (b) a reasonable right of access across Grantor’s Property to and from the Easement Area for the purpose of exercising the rights granted herein. Grantor reserves the right to occupy and use Grantor’s Property for any purpose not inconsistent with the rights and privileges above granted and which will not interfere with or endanger the Pipeline(s) or the use thereof. Grantee shall use due care in the construction, operation and maintenance of the Pipeline(s). Grantee, in its exercise of the rights provided by the Easement, shall not be liable to Grantor or parties claiming under Grantor for any damage to or destruction of improvements within the Easement Area installed by Grantor or parties claiming under Grantor. [SIGNATURES APPEAR ON THE FOLLOWING PAGE] Doc. No. 060708-1-013 86 $77$&+0(17 GRANTOR CITY OF LA QUINTA, a California municipal corporation and charter city Date _______________________________ By __________________________________ Jon McMillen, City Manager APPROVED AS TO FORM: By __________________________________ William H. Ihrke, City Attorney Doc. No. 060708-1-013 ENG RW-004 (Rev. 10/19/16) 87 ACKNOWLEDGMENT A notary public or other officer completing this certificate verifies only the identity of the individual who signed the document to which this certificate is attached, and not the truthfulness, accuracy, or validity of that document. STATE OF CALIFORNIA ) ) ss COUNTY OF _________________ ) On , before me, , Notary Public, personally appeared ______________________________________________________, who proved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/her/their authorized capacity(ies), and that by his/her/their signature(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted, executed the instrument. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. WITNESS my hand and official seal. Signature: (Seal) 88 89 90 City of La Quinta CITY COUNCIL MEETING: July 7, 2020 STAFF REPORT AGENDA TITLE: ACCEPT HIGHWAY SAFETY IMPROVEMENT PROGRAM CITYWIDE FIBER OPTIC SIGNAL INTERCONNECT PROJECT 12. 2016-02, FEDERAL PROJECT NO. HSIPL-5433(017) RECOMMENDATION Accept the Highway Safety Improvement Program (HSIP) citywide Fiber Optic Signal Interconnect Project as complete; authorize the City Clerk to file a Notice of Completion with the Office of the County Recorder; and authorize staff to release retention in the amount of $87,070, thirty-five days after the Notice of Completion is recorded. EXECUTIVE SUMMARY x The project replaced the existing copper wire interconnect with fiber optic cable and installed new fiber optic cable lines and conduit to replace the existing wireless interconnect. The project also installed new fiber optic interconnect along several segments to close signal communication gaps. x The work is complete and Council acceptance will close the contract and allow final payment. FISCAL IMPACT The following is the financial accounting for Project No. 2016-02: Original Contract Amount $ 1,612,316 Contract Change Orders No. 1-4 $ 129,079 Final Contract Amount $ 1,741,395 Project Budget $ 2,261,000 Final Contract Amount ($ 1,741,395) Design, Professional, & Personnel Costs ($ 65,000) Inspection, Survey, Plans, & Other Construction Costs ($ 3,394) Anticipated Funds Remaining* $ 451,211 * All costs to date have been accounted for and no further costs are anticipated. CONSENT CALENDAR ITEM NO. 91 There are adequate funds to close this project; the final retention amount of $87,070 will be paid from account number 401-0000-20600. BACKGROUND/ANALYSIS On August 6, 2019, Council awarded a $1,612,316 contract to DBX, Inc. On November 12, 2019, a Notice to Proceed was issued with a 90-working day completion time starting on November 18, 2019 and ending on April 1, 2020. Contract Change Orders No. 1 and 3 extended the contract to April 7, 2020. The project was deemed substantially complete on March 27, 2020. No liquidated damages or early completion incentives are recommended. Contract Change Order No. 1 was issued to remobilize at Calle Tampico to pull out the signal interconnect cable (SIC) and investigate for conduit damage. Contract Change Order No. 2 was issued for the installation of additional #10 trace wire throughout the project in existing conduit, not shown on the original plans and specifications. Contract Change Order No. 3 was issued for the installation of HDPE conduit and 3 pull boxes due to existing conduit being unusable. Contract Change Order No. 4 was issued and approved by Council on May 5, 2020 for final quantity adjustments. The project construction effort is complete and in compliance with the plans and specifications. Staff recommends acceptance and release of the retention thirty-five days after the Notice of Completion is recorded. ALTERNATIVES Staff does not recommend an alternative. Prepared by: Carley Escarrega, Management Assistant Approved by: Bryan McKinney, P.E., Public Works Director/City Engineer Attachment: 1. Vicinity Map 92 ATTACHMENT 1 93 94 City of La Quinta CITY COUNCIL MEETING: July 7, 2020 STAFF REPORT AGENDA TITLE:ADOPT RESOLUTION DESIGNATING SPEED LIMITS FOR AVENUE 52 FROM DESERT CLUB DRIVE TO AVENIDA BERMUDAS AND AVENUE 52 FROM AVENIDA BERMUDAS TO EISENHOWER DRIVE RECOMMENDATION Adopt a resolution approving legal speed limits on Avenue 52 from Desert Club Drive to Avenida Bermudas and on Avenue 52 from Avenida Bermudas to Eisenhower Drive, as recommended in the 2020 Engineering and Traffic Survey. EXECUTIVE SUMMARY x The City Traffic Engineer recommended that a speed survey be conducted on two street segments due to recent changes which would affect the operating conditions along each. x The engineering and speed survey accounts for: 1) prevailing speed, 2) accident history, and 3) roadway characteristics not apparent to the motorist. x The survey designated two segments for speed limit adjustments. FISCAL IMPACT Replacing these signs will cost $300; Gas Tax funds are available in the Traffic Control Signs budget (201-7003-60429). BACKGROUND/ANALYSIS In order to enforce speed limits using radar, speed limits must be set in accordance with the California Vehicle Code (CVC). Per the CVC, vehicle speeds are determined by the behavior of a majority of drivers during normal driving conditions. Jurisdictions may not establish arbitrary speed limits. The City of La Quinta recently made changes to several streets which would affect the operating conditions along each. As such, it is desirable to resurvey the prevailing speeds and determine if speed limit adjustments are in order. Two street segments were recently re-surveyed. The 2020 Engineering and Traffic Survey presents the following recommended speed limit for these roadway segments: CONSENT CALENDAR ITEM NO. 95 Street Segment Posted Proposed Avenue 52 Desert Club Drive to Avenida Bermudas 40 35 Avenue 52 Avenida Bermudas to Eisenhower Drive 40 35 Staff requests approval for the recommended changes and to post these street segments immediately with the new speed limits for safety reasons. The new speed limits will help drivers select a speed that is safe and consistent with the majority of other users. ALTERNATIVES No alternative is recommended. Prepared by: Julie Mignogna, Management Analyst Approved by: Bryan McKinney, Public Works Director/City Engineer 96 RESOLUTION NO. 2020 - A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF LA QUINTA, CALIFORNIA, DESIGNATING SPEED LIMITS WHEREAS, the California Vehicle Code authorizes cities to designate and regulate speed zones within their jurisdictions; and WHEREAS, the City Council finds it appropriate to designate speed limits on the following local streets to facilitate safe and orderly traffic flow; and WHEREAS, said designation shall be made by resolution; and WHEREAS, the City Council finds it appropriate to designate speed limits for 2 street segments; and WHEREAS, in accordance with the provisions of Title 12.20.020 of the La Quinta Municipal Code, an engineering and traffic survey has been performed on the specified streets; and WHEREAS, the following designated prima facie speed limits are based on the results of the engineering and traffic survey; and Street Segment Speed Limit (mph) Avenue 52 Desert Club Drive to Avenida Bermudas 35 Avenue 52 Avenida Bermudas to Eisenhower Drive 35 NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of La Quinta, California, as follows: the aforementioned prima facie speed limits are most appropriate to facilitate the orderly movement of traffic and to be reasonably safe. PASSED, APPROVED, and ADOPTED at a regular meeting of the La Quinta City Council held on this 7th day of July 2020, by the following vote: 97 Resolution No. 2020- Designate Speed Limits on Ave 52 Adopted: July 7, 2020 Page 2 of 2 AYES: NOES: ABSENT: ABSTAIN: __________________________ LINDA EVANS, Mayor City of La Quinta, California ATTEST: _________________________ MONIKA RADEVA, City Clerk City of La Quinta, California (CITY SEAL) APPROVED AS TO FORM: ___________________________ WILLIAM H. IHRKE, City Attorney City of La Quinta, California 98 City of La Quinta CITY COUNCIL MEETING: July 7, 2020 STAFF REPORT AGENDA TITLE: APPROVE DEMAND REGISTERS DATED JUNE 12, 19, AND 26, 2020 RECOMMENDATION Approve demand registers dated June 12, 19, and 26, 2020. EXECUTIVE SUMMARY – None FISCAL IMPACT Demand of Cash: City 6,526,536.05$ Successor Agency of RDA -$ Housing Authority 23,803.14$ 6,550,339.19$ BACKGROUND/ANALYSIS Routine bills and payroll must be paid between Council meetings. Attachment 1 details the weekly demand registers for June 12, 19, and 26, 2020. Warrants Issued: 202079-202123 2,026,099.85$ 202124-202183 2,375,415.27$ 202184-202238 1,127,663.23$ Wire Transfers 361,593.83$ AP Voids (9,900.00)$ Payroll Tax Transfers 133,635.98$ Payroll Dir Dep & Checks 37587-37597 535,831.03$ 6,550,339.19$ In the amounts listed above, two checks were voided. One check was reissued due to non-receipt by vendor and the other check was not reissued as the event was cancelled. &216(17&$/(1'$5,7(012 99 The most significant expenditures on the demand register are: Account Name Amount Burrtec Waste & Various 1,628,187.88$ Waste Mgmt Pass Recycling Svcs Through Pymt Riverside County Various 1,133,674.72$ Mar-Apr 2020 Sheriff Dept Police Services Riverside County Various 764,607.63$ FY 19/20 Facility Fee & Sheriff Dept Police Services Adj City of Indio Contribution 613,784.60$ Madison Street Impr Progress Payment 2 Urban Habitat Various 340,051.31$ May 2020 SilverRock Park Venue PurposeVendor Wire Transfers: Fourteen transfers totaled $361,591. Of this amount, $213,599 was for PERS and $132,269 for Landmark. (See Attachment 2 for a full listing). Investment Transactions: Full details of investment transactions as well as total holdings are reported quarterly in the Treasurer’s Report. Transaction Issuer Type Par Value Settle Date Coupon Rate Maturity EverBank CD 248,000$ 6/5/20 1.700% Purchase Fed Farm Credit Bank Agency 500,000$ 6/9/20 0.500% Purchase Fed Farm Credit Bank Agency 500,000$ 6/10/20 0.680% Maturity Bank Midwest CD 248,000$ 6/12/20 1.650% Maturity Wex Bank CD 245,000$ 6/15/20 2.750% Purchase Chippewa Valley Bank CD 248,000$ 6/24/20 0.600% Purchase Southern Bancorp CD 248,000$ 6/26/20 0.500% Purchase Amer First Cr Union CD 248,000$ 6/26/20 0.350% ALTERNATIVES Council may approve, partially approve, or reject the demand registers. Prepared by: Bernice Choo, Account Technician Approved by: Rosemary Hallick, Financial Services Analyst Attachments:1. Demand Registers 2. Wire Transfers 100 6/15/2020 7:41:09 PM Page 1 of 7 Demand Register City of La Quinta Packet: APPKT02417 - BC 06/12/2020 AmountVendor Name Payment Number Description (Item) Account Name Account Number Fund: 101 - GENERAL FUND 660.00Security & Alarm04/01-06/30/20 FACILITIES ALARM MONI…202080ALARM MONITORING SERVICE…101-3008-60123 510.00Fire Station04/01-06/30/20 FIRE ALARM MONITORIN…202080ALARM MONITORING SERVICE…101-2002-60670 510.00Security & Alarm04/01-06/30/20 FACILITIES ALARM MONI…202080ALARM MONITORING SERVICE…101-3008-60123 699.65Coronavirus Expenses04/16-05/15/20 - ZOOM202081BANK OF THE WEST 101-1007-60195 38.05Coronavirus Expenses04/15/20 - SIGNS REOPEN FACILITIES202081BANK OF THE WEST 101-1007-60195 423.42Coronavirus Expenses04/19/20 - CHARGER CABLES FOR CODE202081BANK OF THE WEST 101-1007-60195 969.75Coronavirus Expenses04/23/20 - HAND SANITIZER202081BANK OF THE WEST 101-1007-60195 195.60Coronavirus Expenses04/24/20 - CLEANING WIPES202081BANK OF THE WEST 101-1007-60195 115.66Coronavirus Expenses04/24/20 - THERMOMETERS (2)202081BANK OF THE WEST 101-1007-60195 43.71Coronavirus Expenses04/15/20 - SIGNS REOPEN FACILITIES202081BANK OF THE WEST 101-1007-60195 65.24Coronavirus Expenses04/25/20 - EMPTY SPRAY BOTTLES202081BANK OF THE WEST 101-1007-60195 78.27Coronavirus Expenses04/24/20 - SAFETY GLASSES202081BANK OF THE WEST 101-1007-60195 228.30Coronavirus Expenses04/29/20 - FACE COVERS202081BANK OF THE WEST 101-1007-60195 2,009.72Coronavirus Expenses04/07/20 - BANDANAS202081BANK OF THE WEST 101-1007-60195 69.60Coronavirus Expenses04/15/20 - SIGNS FOR REOPENING FAC202081BANK OF THE WEST 101-1007-60195 10.77Coronavirus Expenses04/26/20 - BAGS202081BANK OF THE WEST 101-1007-60195 17.39Fire Station04/28/20 - FS #93 SUPPLIES202081BANK OF THE WEST 101-2002-60670 305.68Professional Services05/10-06/06/20 - CH POL SVC SINKS202083BURRTEC ENVIRONMENTAL 101-1002-60103 1,819,339.60Due to Waste Management06/10/20 - FY 19/20 PROPERTY TAX PYMN…202084BURRTEC WASTE & RECYCLING…101-0000-20307 -181,594.13Franchise Taxes - Burrtec06/10/20 - FY 19/20 PROPERTY TAX PYMN…202084BURRTEC WASTE & RECYCLING…101-0000-41505 25.00Travel & Training06/11/20 - APPLICATION FEE R HALLICK202085CALIFORNIA MUNICIPAL TREA…101-1006-60320 35.00Travel & Training05/18/20 - DYN & SUSTAIN WKSHOP M R…202086CITY CLERK ASSOCIATION OF C…101-1005-60320 75.00Prepaid Expense08/28/20 - 101-1005-60320 ATHENIAN W…202086CITY CLERK ASSOCIATION OF C…101-0000-13600 1,331.00MSHCP Mitigation Fee05/2020 - MSHCP FEES202088COACHELLA VALLEY CONSERV…101-0000-20310 -13.31CVMSHCP Admin Fee05/2020 - MSHCP FEES202088COACHELLA VALLEY CONSERV…101-0000-43631 340.01Water -Desert Pride - Utilities04/14/20 - WATER SERVICE202089COACHELLA VALLEY WATER DI…101-3005-61206 22,010.19Machinery & Equipment06/01/20 TRASH PUMP202090CRAFCO, INC 101-7003-80100 105.00Blood/Alcohol Testing02/2020 - BLOOD/ALCOHOL ANALYSIS202091DEPARTMENT OF JUSTICE 101-2001-60174 4,995.00Maintenance/Services06/03/20 - CIVIC PARK BRIDGES PAINTING202092DESERT CONCEPTS CONSTRUC…101-3005-60691 420.00Advertising05/23/20 - CC PHN LAD 2020-0003 #4678…202093DESERT SUN PUBLISHING, LLC 101-7002-60450 1,800.00Coronavirus Expenses05/2020 COVID-19 EMERGENCY MEETINGS202095FISHER INTEGRATED INC 101-1007-60195 1,728.13Special Enforcement Funds05/29/20 REPLACEMENT POLICE TRAFFIC …202096GOLDEN STAR TECHNOLOGY, …101-2001-60175 32.36Coronavirus Expenses05/19/20 - CH BUCKETS202098HOME DEPOT CREDIT SERVICES 101-1007-60195 8.94Fire Station05/07/20 - FS #93 CABLE TIES202098HOME DEPOT CREDIT SERVICES 101-2002-60670 520.11Fire Station05/07/20 - FS #70 SUPPLIES202098HOME DEPOT CREDIT SERVICES 101-2002-60670 25.55Maintenance/Services05/18/20 - FS #70 MAT'LS202098HOME DEPOT CREDIT SERVICES 101-2002-60691 23.34Maintenance/Services05/18/20 - FS #70 MAT'LS202098HOME DEPOT CREDIT SERVICES 101-2002-60691 144.73Materials/Supplies05/20/20 - MATERIALS202098HOME DEPOT CREDIT SERVICES 101-3005-60431 208.35Materials/Supplies05/27/20 - MATERIALS202098HOME DEPOT CREDIT SERVICES 101-3005-60431 325.16Tools/Equipment05/11/20 - HAMMER DRILL/IMPACT COM…202098HOME DEPOT CREDIT SERVICES 101-3005-60432 130.27Tools/Equipment05/20/20 - DRILL SET202098HOME DEPOT CREDIT SERVICES 101-3005-60432 25.99Materials/Supplies04/30/20 - CITY HALL MAT'LS202098HOME DEPOT CREDIT SERVICES 101-3008-60431 33.42Materials/Supplies04/30/20 - LQ PARK PAINT202098HOME DEPOT CREDIT SERVICES 101-3008-60431 61.05Materials/Supplies05/12/20 - CH OUTLET COVERS202098HOME DEPOT CREDIT SERVICES 101-3008-60431 66.84Materials/Supplies04/29/20 - CITY HALL PAINT202098HOME DEPOT CREDIT SERVICES 101-3008-60431 10.57Materials/Supplies05/12/20 - CH OUTLET COVERS202098HOME DEPOT CREDIT SERVICES 101-3008-60431 171.01Materials/Supplies05/06/20 - SPORTS COMPLEX PAINT MAT'…202098HOME DEPOT CREDIT SERVICES 101-3008-60431 9.77Materials/Supplies05/11/20 - WC MAT'LS202098HOME DEPOT CREDIT SERVICES 101-3008-60431 83.62Materials/Supplies05/18/20 - CH PAINT MAT'LS202098HOME DEPOT CREDIT SERVICES 101-3008-60431 44.55Tools/Equipment05/14/20 - WC DRILLSET202098HOME DEPOT CREDIT SERVICES 101-3008-60432 23.89Tools/Equipment05/11/20 - WC DREMEL CUTTING KIT202098HOME DEPOT CREDIT SERVICES 101-3008-60432 14.12Operating Supplies05/20/20 - PADLOCK202098HOME DEPOT CREDIT SERVICES 101-7003-60420 10.84Tools/Equipment05/26/20 - WRENCH202098HOME DEPOT CREDIT SERVICES 101-7003-60432 $77$&+0(17 101 Demand Register Packet: APPKT02417 - BC 06/12/2020 6/15/2020 7:41:09 PM Page 2 of 7 AmountVendor Name Payment Number Description (Item) Account Name Account Number 36.78Tools/Equipment05/20/20 - DRILL SET202098HOME DEPOT CREDIT SERVICES 101-7003-60432 140.29Tools/Equipment05/27/20 - CIRC SAW202098HOME DEPOT CREDIT SERVICES 101-7003-60432 179.00HVAC06/04/20 - CITY HALL HVAC SVC202100HYDE'S AC 101-3008-60667 24.68Electric - Colonel Paige - Utiliti…06/08/20 - ELECTRICITY SERVICE202101IMPERIAL IRRIGATION DIST 101-3005-61108 73.07Electric - Adams Park - Utilities06/08/20 - ELECTRICITY SERVICE202101IMPERIAL IRRIGATION DIST 101-3005-61110 1,275.00Marketing & Tourism Promoti…06/2020 DIGITAL/RETAINER202102JNS MEDIA SPECIALISTS 101-3007-60461 75.00Wellness Center Memberships06/08/20 - REFUND ANNUAL FITNESS202106MORENO, XIMENA 101-0000-42218 990.00Consultants05/2020 CAPITAL IMPROVEMENT PLAN202107NAI CONSULTING INC 101-7006-60104 772.50Consultants05/2020 CALTRANS INCURRED COST AUDIT202107NAI CONSULTING INC 101-7006-60104 1,603.33Marketing & Tourism Promoti…05/22-06/18/20 IN-THEATER ADVERTISING202108NATIONAL CINEMEDIA LLC 101-3007-60461 43.41Office Supplies06/01/20 - CM HAND SANITIZER202109OFFICE DEPOT 101-1002-60400 550.58Coronavirus Expenses04/21/20 - HAND SANITIZER202110OMEGA INDUSTRIAL SUPPLY, I…101-1007-60195 2,021.06Coronavirus Expenses05/18/20 - SANITIZING ALCOHOL WIPES202110OMEGA INDUSTRIAL SUPPLY, I…101-1007-60195 1,362.88HVAC05/29/20 - CITY HALL HVAC SVC202111PACIFIC WEST AIR CONDITION…101-3008-60667 2,041.05HVAC05/25/20 - WC HVAC SVC202111PACIFIC WEST AIR CONDITION…101-3008-60667 250.00HVAC06/01/20 - CITY HALL HVAC202111PACIFIC WEST AIR CONDITION…101-3008-60667 4,067.50Coronavirus Expenses05/20/20 CITY HALL PARTITIONS FINAL PA…202112PALMS TO PINES MIRROR & G…101-1007-60195 19.25LQ Police Volunteers05/15/20 - POLICE SHRED202115SHRED-IT USA - SAN BERNADI…101-2001-60109 231.00Sexual Assault Exam Fees01/31/2020 - EXAM FEES LA200240073202116SINATRA, BARBARA CHILDREN'…101-2001-60193 231.00Sexual Assault Exam Fees05/21/20 - EXAM FEES LA201360074202116SINATRA, BARBARA CHILDREN'…101-2001-60193 143.22Annual Permits/Inspections07/2019-06/2020 - WC EMISSIONS FEE202117SOUTH COAST AIR QUALITY M…101-3008-60196 1,269.17Telephone - Utilities05/23-06/22/20 - PHONE LINE SVC (EOC)202119TPX COMMUNICATIONS 101-2002-61300 -250.00Maintenance/Services04/02/20 - RECLASS TO 101-3008-60116202120TRULY NOLEN INC 101-3005-60691 250.00Pest Control04/02/20 - RECLASS FROM 101-3005-606…202120TRULY NOLEN INC 101-3008-60116 61.00Pest Control05/04/20 - LQ PARK PEST CONTROL202120TRULY NOLEN INC 101-3008-60116 70.00Pest Control05/01/20 - WC PEST CONTROL202120TRULY NOLEN INC 101-3008-60116 47.00Pest Control05/01/20 - PW YARD PEST CONTROL202120TRULY NOLEN INC 101-3008-60116 48.00Pest Control05/01/20 - WC RODENT MONTHLY202120TRULY NOLEN INC 101-3008-60116 185.00Pest Control05/08/20 - BEE HIVE REMOVAL202120TRULY NOLEN INC 101-3008-60116 23,852.50Contract Traffic Engineer04/08-04/30/20 ON-CALL TRAFFIC ENGIN…202121WILLDAN 101-7006-60144 408.00Sheriff - Other05/13/20 - POLICE TOW LA201340115202122WOOD, RUSSELL DAVID 101-2001-60176 Fund 101 - GENERAL FUND Total: 1,721,593.05 Fund: 201 - GAS TAX FUND -440.00Materials/Supplies04/28/20 - ROTARY MIXER CREDIT202081BANK OF THE WEST 201-7003-60431 632.31Materials/Supplies04/27/20 - ROTARY MIXER SIDEWALK REP…202081BANK OF THE WEST 201-7003-60431 35.44Traffic Control Signs05/12/20 - TRAFFIC SIGNS202098HOME DEPOT CREDIT SERVICES 201-7003-60429 10.26Traffic Control Signs05/12/20 - TRAFFIC SIGN202098HOME DEPOT CREDIT SERVICES 201-7003-60429 29.95Materials/Supplies05/26/20 - METAL SHEET202098HOME DEPOT CREDIT SERVICES 201-7003-60431 17.64Materials/Supplies05/27/20 - MATERIALS202098HOME DEPOT CREDIT SERVICES 201-7003-60431 19.00Materials/Supplies05/20/20 - MATERIALS202098HOME DEPOT CREDIT SERVICES 201-7003-60431 -19.00Materials/Supplies05/20/20 - MATERIALS202098HOME DEPOT CREDIT SERVICES 201-7003-60431 19.32Materials/Supplies04/30/20 - WALL REPAIR202098HOME DEPOT CREDIT SERVICES 201-7003-60431 536.03Traffic Control Signs06/03/20 - TRAFFIC CONTROL SIGNS202118TOPS' N BARRICADES INC 201-7003-60429 102.77Traffic Control Signs06/03/20 - TRAFFIC CONTROL SIGNS202118TOPS' N BARRICADES INC 201-7003-60429 104.51Traffic Control Signs06/03/20 - TRAFFIC CONTROL SIGNS202118TOPS' N BARRICADES INC 201-7003-60429 256.60Traffic Control Signs06/08/20 - TRAFFIC CONTROL SIGNS202118TOPS' N BARRICADES INC 201-7003-60429 Fund 201 - GAS TAX FUND Total: 1,304.83 Fund: 202 - LIBRARY & MUSEUM FUND 165.00Security & Alarm04/01-06/30/20 LIBRARY ALARM MONITO…202080ALARM MONITORING SERVICE…202-3004-60123 165.00Security & Alarm04/01-06/30/20 MUSEUM ALARM MONI…202080ALARM MONITORING SERVICE…202-3006-60123 255.00Security & Alarm04/01-06/30/20 LIBRARY ALARM MONITO…202080ALARM MONITORING SERVICE…202-3004-60123 255.00Security & Alarm04/01-06/30/20 MUSEUM ALARM MONI…202080ALARM MONITORING SERVICE…202-3006-60123 71.10Maintenance/Services05/20/20 - MUSEUM MAT'LS202098HOME DEPOT CREDIT SERVICES 202-3006-60691 1,699.79HVAC05/29/20 - LIBRARY HVAC SVC202111PACIFIC WEST AIR CONDITION…202-3004-60667 74.00Pest Control05/01/20 - LIBRARY PEST CONTROL202120TRULY NOLEN INC 202-3004-60116 49.00Pest Control05/01/20 - MUSEUM PEST CONTROL202120TRULY NOLEN INC 202-3006-60116 Fund 202 - LIBRARY & MUSEUM FUND Total: 2,733.89 Fund: 215 - LIGHTING & LANDSCAPING FUND 1,283.77Water - Medians - Utilities04/14/20 - WATER SERVICE202089COACHELLA VALLEY WATER DI…215-7004-61211 102 Demand Register Packet: APPKT02417 - BC 06/12/2020 6/15/2020 7:41:09 PM Page 3 of 7 AmountVendor Name Payment Number Description (Item) Account Name Account Number 32.59Operating Supplies04/30/20 - OPER SUPPLIES202098HOME DEPOT CREDIT SERVICES 215-7004-60420 17.95Supplies-Graffiti and Vandalism05/18/20 - GRAFFITI202098HOME DEPOT CREDIT SERVICES 215-7004-60423 1,418.70Electric - Utilities06/08/20 - ELECTRICITY SERVICE202101IMPERIAL IRRIGATION DIST 215-7004-61116 780.85Electric - Medians - Utilities06/08/20 - ELECTRICITY SERVICE202101IMPERIAL IRRIGATION DIST 215-7004-61117 5,278.00SilverRock Way Landscape04/2020 FY 19/20 SRR PERIMETER202104LANDMARK GOLF MANAGEM…215-7004-60143 6,028.00SilverRock Way Landscape05/2020 FY 19/20 SRR PERIMETER202104LANDMARK GOLF MANAGEM…215-7004-60143 Fund 215 - LIGHTING & LANDSCAPING FUND Total: 14,839.86 Fund: 221 - AB 939 - CALRECYCLE FUND -9,557.59Burrtec AB 939 Fee06/10/20 - FY 19/20 PROPERTY TAX PYMN…202084BURRTEC WASTE & RECYCLING…221-0000-41506 Fund 221 - AB 939 - CALRECYCLE FUND Total: -9,557.59 Fund: 224 - TUMF FUND 2,310.00TUMF Payable to CVAG05/2020 - TUMF FEE202087COACHELLA VALLEY ASSOC OF…224-0000-20320 Fund 224 - TUMF FUND Total: 2,310.00 Fund: 241 - HOUSING AUTHORITY 288.20Professional Services05/08/20 - LINC HOUSING CORP PH #4182…202093DESERT SUN PUBLISHING, LLC 241-9101-60103 Fund 241 - HOUSING AUTHORITY Total: 288.20 Fund: 247 - ECONOMIC DEVELOPMENT FUND 150.00Marketing & Tourism Promoti…04/17/20 - FB BOOST202081BANK OF THE WEST 247-0000-60461 150.00Marketing & Tourism Promoti…04/21/20 - FB BOOST202081BANK OF THE WEST 247-0000-60461 150.00Marketing & Tourism Promoti…04/22/20 - FB BOOST202081BANK OF THE WEST 247-0000-60461 53.01Marketing & Tourism Promoti…04/08/20 - FB BOOST202081BANK OF THE WEST 247-0000-60461 149.61Marketing & Tourism Promoti…04/14/20 - FB BOOST202081BANK OF THE WEST 247-0000-60461 150.00Marketing & Tourism Promoti…04/11/20 - FB BOOST202081BANK OF THE WEST 247-0000-60461 -928.78Marketing & Tourism Promoti…04/10/20 - RECLASS TO PROJECT CORONA…202102JNS MEDIA SPECIALISTS 247-0000-60461 928.78Marketing & Tourism Promoti…04/10/20 - RECLASS FROM PROJECT COR…202102JNS MEDIA SPECIALISTS 247-0000-60461 2,307.82Marketing & Tourism Promoti…06/09/20 - CORONAVIRUS CAMPAIGN202103JNS MEDIA SPECIALISTS 247-0000-60461 Fund 247 - ECONOMIC DEVELOPMENT FUND Total: 3,110.44 Fund: 401 - CAPITAL IMPROVEMENT PROGRAMS 2,415.00Professional Services05/31/20 REGIONAL SCOUR ANALYSIS202082BENGAL ENGINEERING INC 401-0000-60103 31,639.70DesignMAY 2020 DUNE PALMS BRIDGE LOW WA…202082BENGAL ENGINEERING INC 401-0000-60185 10,359.02Design04/30/20 WASHINGTON/WARING TRIPLE …202094ENGINEERING RESOURCES 401-0000-60185 -1,547.38Retention PayablePO 1819-0137-R1 RETENTION #7202097GRANITE CONSTRUCTION CO…401-0000-20600 30,947.64Construction05/31/20 EISENHOWER DRIVE DRAINAGE …202097GRANITE CONSTRUCTION CO…401-0000-60188 13,336.25Design05/03/20 SRR PHASE II INFRASTRUCTURE …202105MICHAEL BAKER INTERNATIO…401-0000-60185 620.00Professional Services05/2020 PMP SLURRY SEAL202107NAI CONSULTING INC 401-0000-60103 5,090.00Professional Services05/2020 EISENHOWER DRAINAGE IMPRO…202107NAI CONSULTING INC 401-0000-60103 330.00Professional Services05/2020 HIGHWAY 111 CORRIDOR202107NAI CONSULTING INC 401-0000-60103 1,712.50Professional Services05/2020 SB821 WASHINGTON SIDEWALK …202107NAI CONSULTING INC 401-0000-60103 475.00Professional Services05/2020 HSIP TRAFFIC SIGNAL INTERCON…202107NAI CONSULTING INC 401-0000-60103 6,877.50Professional Services05/2020 ASHINGTON ST AT FRED WARING…202107NAI CONSULTING INC 401-0000-60103 822.50Professional Services05/2020 JEFFERSON STREET AT AVENUE 5…202107NAI CONSULTING INC 401-0000-60103 502.50Professional Services05/2020 COVE PUBLIC RESTROOM202107NAI CONSULTING INC 401-0000-60103 1,742.50Professional Services05/2020 SILVERROCK RESORT INFRASTRU…202107NAI CONSULTING INC 401-0000-60103 2,978.75Professional Services05/2020 SILVERROCK PARK VENUE SITE202107NAI CONSULTING INC 401-0000-60103 330.00Professional Services05/2020 CORPORATE YARD202107NAI CONSULTING INC 401-0000-60103 52.50Professional Services05/2020 DUNE PALMS ROAD STREET IMP…202107NAI CONSULTING INC 401-0000-60103 37.50Professional Services05/2020 EISENHOWER RETENTION BASIN …202107NAI CONSULTING INC 401-0000-60103 570.00Professional Services05/2020 REGIONAL SKATE AND BMX PARK202107NAI CONSULTING INC 401-0000-60103 4,827.50Professional Services05/2020 FY 1920 PAVEMENT MANAGEM…202107NAI CONSULTING INC 401-0000-60103 775.00Professional Services05/2020 NORTH LA QUINTA PARKWAY TU…202107NAI CONSULTING INC 401-0000-60103 495.00Professional Services05/2020 FIRE STATION 70 REVITALIZATION202107NAI CONSULTING INC 401-0000-60103 8,588.75Professional Services05/2020 VILLAGE COMPLETE STREETS202107NAI CONSULTING INC 401-0000-60103 2,105.00Professional Services05/2020 PAVEMENT MANAGEMENT PLAN202107NAI CONSULTING INC 401-0000-60103 15,043.75Professional Services05/2020 DUNE PALMS BRIDGE IMPROVE…202107NAI CONSULTING INC 401-0000-60103 485.00Professional Services05/2020 AVE 50 BRIDGE SPANNING EVAC …202107NAI CONSULTING INC 401-0000-60103 -719.85Retention PayablePO 1920-0166 RETENTION 4202113PAVEMENT COATINGS, CO.401-0000-20600 14,397.00Construction04/30/20 2019-10 PMP SLURRY SEAL & M…202113PAVEMENT COATINGS, CO.401-0000-60188 57,645.47Construction04/30/20 2016-08 RESTROOM PURCHASE202114ROMTEC INC.401-0000-60188 103 Demand Register Packet: APPKT02417 - BC 06/12/2020 6/15/2020 7:41:09 PM Page 4 of 7 AmountVendor Name Payment Number Description (Item) Account Name Account Number 247.38Construction06/08/20 - SIGNS 2015-03202123XPRESS GRAPHICS 401-0000-60188 Fund 401 - CAPITAL IMPROVEMENT PROGRAMS Total: 213,181.48 Fund: 501 - FACILITY & FLEET REPLACEMENT 10,625.00Furniture04/09/20 - CHAIRS QUOTE #20844202081BANK OF THE WEST 501-0000-71020 25.25Vehicle Repair & Maintenance05/15/20 - VEHICLE MAINT202098HOME DEPOT CREDIT SERVICES 501-0000-60676 Fund 501 - FACILITY & FLEET REPLACEMENT Total: 10,650.25 Fund: 502 - INFORMATION TECHNOLOGY -18,440.89Consultants03/25/20 - RECLASS TO 502-0000-80103202079ACORN TECHNOLOGY SERVICES 502-0000-60104 18,440.89Computers03/25/20 - RECLASS FROM 502-0000-601…202079ACORN TECHNOLOGY SERVICES 502-0000-80103 35,527.98Consultants06/01/20 DELL LATITUDE LAPTOPS (10)202079ACORN TECHNOLOGY SERVICES 502-0000-60104 25,285.00Consultants06/2020 IT SERVICES NETWORK ADMIN C…202079ACORN TECHNOLOGY SERVICES 502-0000-60104 467.64Machinery & Equipment04/17/20 - MONITOR MOUNTS (3)202081BANK OF THE WEST 502-0000-80100 130.48Machinery & Equipment04/14/20 - IPHONE XR CASES (2)202081BANK OF THE WEST 502-0000-80100 260.96Machinery & Equipment04/02/20 - IPHONE XR CASES (4)202081BANK OF THE WEST 502-0000-80100 800.00Consultants05/2020 COUNCIL MTG MEDIA RECORD, …202095FISHER INTEGRATED INC 502-0000-60104 2,936.32Telephone - Utilities05/23-06/22/20 - PHONE LINE SVC202119TPX COMMUNICATIONS 502-0000-61300 Fund 502 - INFORMATION TECHNOLOGY Total: 65,408.38 Fund: 601 - SILVERROCK RESORT 94.48Coronavirus Expenses04/30/20 - MASKS FOR SRR202081BANK OF THE WEST 601-0000-60195 38.67Repair & Maintenance05/21/20 - SRR MAT'LS202098HOME DEPOT CREDIT SERVICES 601-0000-60660 43.30Repair & Maintenance05/19/20 - SRR MAT'LS202098HOME DEPOT CREDIT SERVICES 601-0000-60660 60.61Repair & Maintenance05/05/20 - SRR MAT'LS202098HOME DEPOT CREDIT SERVICES 601-0000-60660 Fund 601 - SILVERROCK RESORT Total: 237.06 Grand Total: 2,026,099.85 104 Demand Register Packet: APPKT02417 - BC 06/12/2020 6/15/2020 7:41:09 PM Page 5 of 7 Fund Summary Fund Expense Amount 101 - GENERAL FUND 1,721,593.05 201 - GAS TAX FUND 1,304.83 202 - LIBRARY & MUSEUM FUND 2,733.89 215 - LIGHTING & LANDSCAPING FUND 14,839.86 221 - AB 939 - CALRECYCLE FUND -9,557.59 224 - TUMF FUND 2,310.00 241 - HOUSING AUTHORITY 288.20 247 - ECONOMIC DEVELOPMENT FUND 3,110.44 401 - CAPITAL IMPROVEMENT PROGRAMS 213,181.48 501 - FACILITY & FLEET REPLACEMENT 10,650.25 502 - INFORMATION TECHNOLOGY 65,408.38 601 - SILVERROCK RESORT 237.06 Grand Total: 2,026,099.85 Account Summary Account Number Account Name Expense Amount 101-0000-13600 Prepaid Expense 75.00 101-0000-20307 Due to Waste Manageme… 1,819,339.60 101-0000-20310 MSHCP Mitigation Fee 1,331.00 101-0000-41505 Franchise Taxes - Burrtec -181,594.13 101-0000-42218 Wellness Center Member… 75.00 101-0000-43631 CVMSHCP Admin Fee -13.31 101-1002-60103 Professional Services 305.68 101-1002-60400 Office Supplies 43.41 101-1005-60320 Travel & Training 35.00 101-1006-60320 Travel & Training 25.00 101-1007-60195 Coronavirus Expenses 13,419.24 101-2001-60109 LQ Police Volunteers 19.25 101-2001-60174 Blood/Alcohol Testing 105.00 101-2001-60175 Special Enforcement Funds 1,728.13 101-2001-60176 Sheriff - Other 408.00 101-2001-60193 Sexual Assault Exam Fees 462.00 101-2002-60670 Fire Station 1,056.44 101-2002-60691 Maintenance/Services 48.89 101-2002-61300 Telephone - Utilities 1,269.17 101-3005-60431 Materials/Supplies 353.08 101-3005-60432 Tools/Equipment 455.43 101-3005-60691 Maintenance/Services 4,745.00 101-3005-61108 Electric - Colonel Paige - U…24.68 101-3005-61110 Electric - Adams Park - Util…73.07 101-3005-61206 Water -Desert Pride - Utili… 340.01 101-3007-60461 Marketing & Tourism Pro… 2,878.33 101-3008-60116 Pest Control 661.00 101-3008-60123 Security & Alarm 1,170.00 101-3008-60196 Annual Permits/Inspectio… 143.22 101-3008-60431 Materials/Supplies 462.27 101-3008-60432 Tools/Equipment 68.44 101-3008-60667 HVAC 3,832.93 101-7002-60450 Advertising 420.00 101-7003-60420 Operating Supplies 14.12 101-7003-60432 Tools/Equipment 187.91 101-7003-80100 Machinery & Equipment 22,010.19 101-7006-60104 Consultants 1,762.50 101-7006-60144 Contract Traffic Engineer 23,852.50 201-7003-60429 Traffic Control Signs 1,045.61 201-7003-60431 Materials/Supplies 259.22 202-3004-60116 Pest Control 74.00 202-3004-60123 Security & Alarm 420.00 202-3004-60667 HVAC 1,699.79 105 Demand Register Packet: APPKT02417 - BC 06/12/2020 6/15/2020 7:41:09 PM Page 6 of 7 Account Summary Account Number Account Name Expense Amount 202-3006-60116 Pest Control 49.00 202-3006-60123 Security & Alarm 420.00 202-3006-60691 Maintenance/Services 71.10 215-7004-60143 SilverRock Way Landscape 11,306.00 215-7004-60420 Operating Supplies 32.59 215-7004-60423 Supplies-Graffiti and Van… 17.95 215-7004-61116 Electric - Utilities 1,418.70 215-7004-61117 Electric - Medians - Utiliti… 780.85 215-7004-61211 Water - Medians - Utilities 1,283.77 221-0000-41506 Burrtec AB 939 Fee -9,557.59 224-0000-20320 TUMF Payable to CVAG 2,310.00 241-9101-60103 Professional Services 288.20 247-0000-60461 Marketing & Tourism Pro… 3,110.44 401-0000-20600 Retention Payable -2,267.23 401-0000-60103 Professional Services 56,876.25 401-0000-60185 Design 55,334.97 401-0000-60188 Construction 103,237.49 501-0000-60676 Vehicle Repair & Mainte… 25.25 501-0000-71020 Furniture 10,625.00 502-0000-60104 Consultants 43,172.09 502-0000-61300 Telephone - Utilities 2,936.32 502-0000-80100 Machinery & Equipment 859.08 502-0000-80103 Computers 18,440.89 601-0000-60195 Coronavirus Expenses 94.48 601-0000-60660 Repair & Maintenance 142.58 Grand Total: 2,026,099.85 Project Account Summary Project Account Key Expense AmountProject Account Name Project Name **None**1,774,090.30**None** **None** 091004P 52.50Professional Expense Dune Palms Road Street Improvem 111205D 31,639.70Design Expense Dune Palms Bridge Imp/BRLKS-543 111205P 15,043.75Professional Expense Dune Palms Bridge Imp/BRLKS-543 141513P 1,742.50Professional Expense SilverRock Way Infra/Street Improv 151603CT 247.38Construction Expense La Quinta Village Complete St-ATPS 151603P 8,588.75Professional Expense La Quinta Village Complete St-ATPS 151609P 570.00Professional Expense La Quinta X Park 151612CT 30,947.64Construction Expense Citywide Drainage Enhancements 151612P 5,090.00Professional Expense Citywide Drainage Enhancements 151612RP -1,547.38Retention Payable Citywide Drainage Enhancements 1920PMPP 4,827.50Professional Expense FY19/20 Pavement Management P 201602P 475.00Professional Expense HSIP Traffic Signal Interconnect/HS 201603P 775.00Professional Expense La Quinta Landscape Renovation Im 201608CT 57,645.47Construction Expense SilverRock Event Space 201608P 2,978.75Professional Expense SilverRock Event Space 201701D 10,359.02Design Expense Washington Street at Fred Waring 201701P 6,877.50Professional Expense Washington Street at Fred Waring 201704P 37.50Professional Expense Eisenhower Retention Basin Landsc 201709D 13,336.25Design Expense Ave 53 Jefferson St.Roundabout 201709P 822.50Professional Expense Ave 53 Jefferson St.Roundabout 201801P 502.50Professional Expense Cove Public Restroom 201805P 330.00Professional Expense Corporate Yard Admin Offices & Cr 201902P 485.00Professional Expense Avenue 50 Bridge Spanning the Eva 201905P 330.00Professional Expense Highway 111 Corridor Area Plan Im 201907P 495.00Professional Expense Fire Station 70 Revitalization 201910CT 14,397.00Construction Expense FY 19/20 PMP Slurry Seal Improvem 201910P 620.00Professional Expense FY 19/20 PMP Slurry Seal Improvem 201910RP -719.85Retention Payable FY 19/20 PMP Slurry Seal Improvem 106 Demand Register Packet: APPKT02417 - BC 06/12/2020 6/15/2020 7:41:09 PM Page 7 of 7 Project Account Summary Project Account Key Expense AmountProject Account Name Project Name 201919E 2,415.00Regional Scour Analysis Expense Regional Scour Analysis 201923P 1,712.50Professional Expense Washington St at Ave 50/Calle Tam 201924P 2,105.00Professional Expense 5 Year Pavement Management Pla CORONAMISC 5,027.07Miscellaneous Corona Virus Emergency Response CORONAMS 5,923.31Corona Materials & Supplies Corona Virus Emergency Response CORONAP 5,867.50Contracts Corona Virus Emergency Response CSA152E 22,010.19CSA 152 Expenses CSA 152 Project Tracking Grand Total: 2,026,099.85 107 6/18/2020 7:47:31 PM Page 1 of 5 Demand Register City of La Quinta Packet: APPKT02426 - BC 06/19/2020 AmountVendor Name Payment Number Description (Item) Account Name Account Number Fund: 101 - GENERAL FUND 125.00Maintenance/Services06/17/20 - CITY HALL CARPET CLEANING202124ACE CARPET CLEANING 101-3008-60691 55.00Blood/Alcohol Testing05/31/20 - BLOOD/ALCOHOL ANALYSIS202126AMERICAN FORENSIC NURSES …101-2001-60174 136.67PM 10 - Dust Control06/08-07/05/20 - PM10 ANSWERING SERV…202127ANSAFONE CONTACT CENTERS 101-7006-60146 1,547.34Professional Services05/2020 STVR HOTLINE & 04/2020 ADD'L…202129CENTRAL COMMUNICATIONS 101-6004-60103 874.86Professional Services06/2020 STVR HOTLINE & 05/2020 ADD'L…202129CENTRAL COMMUNICATIONS 101-6004-60103 40.57Water - Utilities06/12/20 - WATER SERVICE202132COACHELLA VALLEY WATER DI…101-2002-61200 1,289.90Water -Pioneer Park - Utilities06/12/20 - WATER SERVICE202132COACHELLA VALLEY WATER DI…101-3005-61207 17.68Water - Utilities06/12/20 - WATER SERVICE202132COACHELLA VALLEY WATER DI…101-3008-61200 925.08Water -Desert Pride - Utilities06/12/20 - WATER SERVICE202132COACHELLA VALLEY WATER DI…101-3005-61206 105.00Blood/Alcohol Testing05/2020 - BLOOD/ALCOHOL ANALYSIS202134DEPARTMENT OF JUSTICE 101-2001-60174 4,520.82Fritz Burns Pool Maintenance03/2020 FRITZ BURNS POOL OPERATIONS202135DESERT RECREATION DISTRICT 101-3005-60184 1,699.66School Officer03/26-04/22/20 - BP#11 SCHOOL RESOUR…202136DESERT SANDS UNIFIED SCHO…101-2001-60168 46.85Subscriptions & Publications07/2020 - NEWSPAPER WC202137DESERT SUN, THE 101-3002-60352 94.65Cable - Utilities04/22-05/21/20 - EOC CABLE202138DISH NETWORK 101-2002-61400 94.65Cable - Utilities05/22-06/21/20 - EOC CABLE202138DISH NETWORK 101-2002-61400 11,425.00Auditors04/30/20 APRIL 2020 AUDIT SVCS202139EIDE BAILLY LLP 101-1006-60106 840.00Plan Checks04/30/20 ON-CALL PLAN REV LQ-BCPR201…202140ESGIL CORPORATION 101-6003-60118 47.27Telephone - Utilities06/2020 - LQ PARK PHONE202141FRONTIER COMMUNICATIONS…101-3005-61300 46.35Telephone - Utilities05/28-06/27/20 - SPORTS COMPLEX PHO…202141FRONTIER COMMUNICATIONS…101-3005-61300 1,772.63Consultants05/11/20 - CONTRACT SVCS SALES TAX202144HINDERLITER DE LLAMAS & AS…101-1006-60104 621.79Consultants05/11/20 - AUDIT SVCS SALES TAX Q4 2019202144HINDERLITER DE LLAMAS & AS…101-1006-60104 910.00Plan Checks05/31/20 ON-CALL PLAN REVIEW202145HR GREEN PACIFIC INC 101-6003-60118 884.00HVAC06/11/20 - CITY HALL HVAC SVC202146HYDE'S AC 101-3008-60667 -43.05Sales Taxes Payable06/01/20 - SUN PROTECT HATS (24) SALES…202147IMPERIAL HEADWEAR INC 101-0000-20304 8,237.50Plan Checks04/2020 ON-CALL BUILDING PLAN CHECK …202148INTERWEST CONSULTING GR…101-6003-60118 4,900.00Grants & Economic Developm…02/13/20 - COMMUNITY SVCS GRANT FU…202149LA QUINTA ROTARY CLUB 101-3001-60510 92.44Coronavirus Expenses05/18/20 - PARK ENCLOSURES202150LOWE'S HOME IMPROVEMENT…101-1007-60195 57.46Materials/Supplies05/18/20 - MATERIALS202150LOWE'S HOME IMPROVEMENT…101-3005-60431 28.92Materials/Supplies05/11/20 - WC MAT'LS202150LOWE'S HOME IMPROVEMENT…101-3008-60431 18.55Materials/Supplies05/22/20 - CITY HALL MAT'LS202150LOWE'S HOME IMPROVEMENT…101-3008-60431 20.56Materials/Supplies05/04/20 - LQ PARK MAT'LS202150LOWE'S HOME IMPROVEMENT…101-3008-60431 43.26Tools/Equipment05/18/20 - CUTTER202150LOWE'S HOME IMPROVEMENT…101-3008-60432 10.29Operating Supplies05/13/20 - SUPPLIES202150LOWE'S HOME IMPROVEMENT…101-7003-60420 17.55Operating Supplies04/28/20 - MATERIALS202150LOWE'S HOME IMPROVEMENT…101-7003-60420 5.74Operating Supplies04/27/20 - MATERIALS202150LOWE'S HOME IMPROVEMENT…101-7003-60420 10.71Operating Supplies05/12/20 - MATERIALS202150LOWE'S HOME IMPROVEMENT…101-7003-60420 10.32Operating Supplies05/04/20 - SIMPLE GREEN202150LOWE'S HOME IMPROVEMENT…101-7003-60420 10.32Operating Supplies05/07/20 - SHOP TOWELS202150LOWE'S HOME IMPROVEMENT…101-7003-60420 25.82Tools/Equipment05/14/20 - CUTTING SAW202150LOWE'S HOME IMPROVEMENT…101-7003-60432 153.94Tools/Equipment04/28/20 - SAW BLADE202150LOWE'S HOME IMPROVEMENT…101-7003-60432 35.03Tools/Equipment04/28/20 - REPL SCREW DRIVERS202150LOWE'S HOME IMPROVEMENT…101-7003-60432 7,470.00Professional Services06/09/20 INDIAN WELLS JOINT POLICE CO…202151MATRIX CONSULTING GROUP 101-2001-60103 190.00Fritz Burns Pool Maintenance06/12/20 - FB POOL LIGHT202155OCEAN SPRINGS TECH INC 101-3005-60184 453.40Supplies-Graffiti and Vandalism06/08/20 - GRAFFITI MAT'LS202156OMEGA INDUSTRIAL SUPPLY, I…101-3005-60423 276.00Cash Over/Short06/01/20 - BCOM2020-0015 REF OVERPM…202158PALM DESERT LODGING LLC 101-0000-42300 22.66Office Supplies03/10/20 - NAME PLATE202159POWERS AWARDS INC 101-6004-60400 1,012.50Cash Over/Short06/08/20 - BRES2019-0463 REF OVERPYM…202161R.W. WEBSTER 101-0000-42300 75,024.93Machinery & Equipment06/05/20 VAC-TRON SER #5HZG16213KK0…202163RDO EQUIPMENT CO 101-7003-80100 -623.93Operating Supplies11/24-12/24/20 - RECLASS TO 101-2001-6…202164RIVERSIDE COUNTY SHERIFF D…101-2001-60420 623.93Sheriff - Other11/24-12/24/20 - RECLASS FROM 101-200…202164RIVERSIDE COUNTY SHERIFF D…101-2001-60176 -423.37Operating Supplies12/24/19-01/23/20 - RECLASS TO 101-200…202164RIVERSIDE COUNTY SHERIFF D…101-2001-60420 423.37Sheriff - Other12/24/19-01/23/20 - RECLASS FROM 101-…202164RIVERSIDE COUNTY SHERIFF D…101-2001-60176 -588.72Operating Supplies01/25-02/24/20 - RECLASS TO 101-2001-6…202164RIVERSIDE COUNTY SHERIFF D…101-2001-60420 108 Demand Register Packet: APPKT02426 - BC 06/19/2020 6/18/2020 7:47:31 PM Page 2 of 5 AmountVendor Name Payment Number Description (Item) Account Name Account Number 588.72Sheriff - Other01/25-02/24/20 - RECLASS FROM 101-200…202164RIVERSIDE COUNTY SHERIFF D…101-2001-60176 690,302.95Sheriff Patrol03/26-04/22/20 - BP11 POLICE SERVICE202164RIVERSIDE COUNTY SHERIFF D…101-2001-60161 13,281.71Police Overtime03/26-04/22/20 - BP11 POLICE SERVICE202164RIVERSIDE COUNTY SHERIFF D…101-2001-60162 191,764.96Target Team03/26-04/22/20 - BP11 POLICE SERVICE202164RIVERSIDE COUNTY SHERIFF D…101-2001-60163 59,493.17Community Services Officer03/26-04/22/20 - BP11 POLICE SERVICE202164RIVERSIDE COUNTY SHERIFF D…101-2001-60164 13,622.40Gang Task Force03/26-04/22/20 - BP11 POLICE SERVICE202164RIVERSIDE COUNTY SHERIFF D…101-2001-60166 13,622.40Narcotics Task Force03/26-04/22/20 - BP11 POLICE SERVICE202164RIVERSIDE COUNTY SHERIFF D…101-2001-60167 45,957.60Motor Officer03/26-04/22/20 - BP11 POLICE SERVICE202164RIVERSIDE COUNTY SHERIFF D…101-2001-60169 36,617.20Dedicated Sargeants03/26-04/22/20 - BP11 POLICE SERVICE202164RIVERSIDE COUNTY SHERIFF D…101-2001-60170 21,363.20Dedicated Lieutenant03/26-04/22/20 - BP11 POLICE SERVICE202164RIVERSIDE COUNTY SHERIFF D…101-2001-60171 36,489.36Sheriff - Mileage03/26-04/22/20 - BP11 POLICE SERVICE202164RIVERSIDE COUNTY SHERIFF D…101-2001-60172 5,256.34Special Enforcement Funds03/26-04/22/20 - BP11 POLICE SERVICE202164RIVERSIDE COUNTY SHERIFF D…101-2001-60175 298.55Sheriff - Other04/24-05/24/20 - COPS FUEL202164RIVERSIDE COUNTY SHERIFF D…101-2001-60176 23,000.00Developer Deposits06/17/20 - RELEASE CASH DEPOSIT SDP20…202165SAFEWAY, INC 101-0000-22810 152.43Materials/Supplies06/01/20 - MATERIALS202166SMITH PIPE & SUPPLY CO 101-3005-60431 439.64Operating Supplies05/15/20 - DRINKING WATER202167SPARKLETTS 101-7003-60420 195.51Operating Supplies06/12/20 - DRINKING WATER202167SPARKLETTS 101-7003-60420 174.49Citywide Conf Room Supplies05/15/20 - CITYWIDE DRINKING WATER202167SPARKLETTS 101-1007-60403 207.41Citywide Conf Room Supplies06/12/20 - CITYWIDE DRINKING WATER202167SPARKLETTS 101-1007-60403 1,698.56Vision Insurance Pay02/2020 - VSP VIA THE STANDARD202168STANDARD INSURANCE COMP…101-0000-20945 1,809.75Vision Insurance Pay03/2020 - VSP VIA THE STANDARD202168STANDARD INSURANCE COMP…101-0000-20945 1,777.37Vision Insurance Pay04/2020 - VSP VIA THE STANDARD202168STANDARD INSURANCE COMP…101-0000-20945 1,784.78Vision Insurance Pay05/2020 - VSP VIA THE STANDARD202168STANDARD INSURANCE COMP…101-0000-20945 488.11Add'l Life Insurance Pay05/2020 - ADD'L LIFE INSURANCE202169STANDARD INSURANCE COMP…101-0000-20948 89.82Office Supplies06/11/20 - OFFICE SUPPLIES202170STAPLES ADVANTAGE 101-7003-60400 346.90Office Supplies06/12/20 - OFFICE SUPPLIES202170STAPLES ADVANTAGE 101-3005-60400 -3,511.20Sales Taxes PayablePO 1920-0187 SALES TAX202171TERRABOUND SOLUTIONS, INC 101-0000-20304 70.50Gas - Utilities04/27-05/27/20 - FS #93 GAS SVC202172THE GAS COMPANY 101-2002-61100 82.00United Way DeductionsCONTRIBUTION202176UNITED WAY OF THE DESERT 101-0000-20981 3,000.00Professional Services05/2020 STVRP COMPLIANCE SERVICES202178VACATION RENTAL COMPLIAN…101-6006-60103 98.05Materials/Supplies06/09/20 - MATERIALS202180VINTAGE ASSOCIATES 101-3008-60431 76.51Materials/Supplies06/16/20 - MATERIALS202180VINTAGE ASSOCIATES 101-3005-60431 497.70Maintenance/Services06/12/20 - CH CONDUIT COUPLINGS202181VINTAGE E & S INC 101-3008-60691 360.00Maintenance/Services06/02/20 - YMCA ROOF REPAIR202182WESTERN PACIFIC ROOFING C…101-3008-60691 Fund 101 - GENERAL FUND Total: 1,287,113.79 Fund: 201 - GAS TAX FUND 555.94Safety Gear06/01/20 - SUN PROTECTION HATS (24)202147IMPERIAL HEADWEAR INC 201-7003-60427 62.74Materials/Supplies04/30/20 - WALL REPAIR202150LOWE'S HOME IMPROVEMENT…201-7003-60431 58.37Paint/Legends06/10/20 - PAINT LEGENDS202173THE SHERWIN-WILLIAMS CO.201-7003-60433 85.80Traffic Control Signs04/24/20 - TRAFFIC CONTROL SIGNS202174TOPS' N BARRICADES INC 201-7003-60429 265.35Traffic Control Signs06/09/20 - TRAFFIC CONTROL SIGNS202174TOPS' N BARRICADES INC 201-7003-60429 Fund 201 - GAS TAX FUND Total: 1,028.20 Fund: 202 - LIBRARY & MUSEUM FUND 77.76Water - Utilities06/12/20 - WATER SERVICE202132COACHELLA VALLEY WATER DI…202-3006-61200 Fund 202 - LIBRARY & MUSEUM FUND Total: 77.76 Fund: 212 - SLESA (COPS) FUND 3,561.05COPS Robbery Prevention03/26-04/22/20 - BP11 POLICE SERVICE202164RIVERSIDE COUNTY SHERIFF D…212-0000-60178 2,043.83COPS Burglary/Theft Preventi…03/26-04/22/20 - BP11 POLICE SERVICE202164RIVERSIDE COUNTY SHERIFF D…212-0000-60179 Fund 212 - SLESA (COPS) FUND Total: 5,604.88 Fund: 215 - LIGHTING & LANDSCAPING FUND 1,593.91Water - Medians - Utilities06/12/20 - WATER SERVICE202132COACHELLA VALLEY WATER DI…215-7004-61211 15.85Supplies-Graffiti and Vandalism05/04/20 - GRAFFITI SUPPLIES202150LOWE'S HOME IMPROVEMENT…215-7004-60423 2,100.00Palm Trees06/13/20 - PALM TREE REMOVAL202160PWLC II, INC 215-7004-60673 Fund 215 - LIGHTING & LANDSCAPING FUND Total: 3,709.76 Fund: 221 - AB 939 - CALRECYCLE FUND 3,511.20AB 939 Recycling Solutions02/12/20 WASTE & RECYCLE CONTAINERS …202171TERRABOUND SOLUTIONS, INC 221-0000-60127 45,788.00AB 939 Recycling Solutions02/12/20 WASTE & RECYCLE CONTAINERS …202171TERRABOUND SOLUTIONS, INC 221-0000-60127 Fund 221 - AB 939 - CALRECYCLE FUND Total: 49,299.20 109 Demand Register Packet: APPKT02426 - BC 06/19/2020 6/18/2020 7:47:31 PM Page 3 of 5 AmountVendor Name Payment Number Description (Item) Account Name Account Number Fund: 241 - HOUSING AUTHORITY 2,067.50Professional Services11/30/19 - APPRAISAL SERVICES202157OVERLAND PACIFIC & CUTLER …241-9101-60103 Fund 241 - HOUSING AUTHORITY Total: 2,067.50 Fund: 243 - RDA LOW-MOD HOUSING FUND 400.00Homelessness Assistance06/10/19 - HOMELESSNESS ASSISTANCE202133CORAL MOUNTAIN APARTME…243-0000-60532 380.00Homelessness Assistance12/20/19 - HOMELESSNESS ASSISTANCE202133CORAL MOUNTAIN APARTME…243-0000-60532 Fund 243 - RDA LOW-MOD HOUSING FUND Total: 780.00 Fund: 401 - CAPITAL IMPROVEMENT PROGRAMS 2,002.00Design10/01-10/31/19 HSIP INTERCONNECT IMP…202125ADVANTEC CONSULTING ENG…401-0000-60185 868.00Design11/01/19-04/30/20 HSIP INTERCONNECT …202125ADVANTEC CONSULTING ENG…401-0000-60185 613,784.60Contributions to Other Agenci…03/17/20 - PROGRESS PMT 2 2009-02202130CITY OF INDIO 401-0000-60480 11,773.67Contributions to Other Agenci…06/01/20 - JEFFERSON INTERCHANGE202131COACHELLA VALLEY ASSOC OF…401-0000-60480 2,413.50Design04/25/20 GHD VILLAGE COMPLETE STREE…202142GHD INC.401-0000-60185 5,782.25Design05/30/20 GHD VILLAGE COMPLETE STREE…202142GHD INC.401-0000-60185 100.00Design05/31/20 COVE PUBLIC RESTROOM & TRA…202143HERMANN DESIGN GROUP INC 401-0000-60185 580.00Technical04/29/20 REVIEW LAD 2020-004 2017-01 …202162RASA/ERIC NELSON 401-0000-60108 -17,897.44Retention PayablePO 1920-0128 RETENTION #9202177URBAN HABITAT 401-0000-20600 357,948.75Construction05/01-05/31/20 2016-08 SILVERROCK PA…202177URBAN HABITAT 401-0000-60188 6,317.08Construction05/22/20 2015-03 POSTCARDS AND MAIL…202183XPRESS GRAPHICS 401-0000-60188 Fund 401 - CAPITAL IMPROVEMENT PROGRAMS Total: 983,672.41 Fund: 501 - FACILITY & FLEET REPLACEMENT 12.90Fuel & Oil05/08/20 - DEF FLUID202150LOWE'S HOME IMPROVEMENT…501-0000-60674 5.57Parts & Maintenance Supplies04/25/20 - TOW HITCH PIN202150LOWE'S HOME IMPROVEMENT…501-0000-60675 26,111.01Machinery & Equipment06/19/20 TRAILER HEAVY DUTY FLATBED202154NIXON EGLI EQUIPMENT CO, I…501-0000-80100 26.34Street Sweeper05/2020 - SWEEPER FUEL202172THE GAS COMPANY 501-0000-60678 1,510.10Parts & Maintenance Supplies06/10/20 - CODE TRUCK LIGHT BAR202174TOPS' N BARRICADES INC 501-0000-60675 2,336.80Fuel & Oil05/16-05/31/20 - VEHICLE FUEL202175TOWER ENERGY GROUP 501-0000-60674 Fund 501 - FACILITY & FLEET REPLACEMENT Total: 30,002.72 Fund: 502 - INFORMATION TECHNOLOGY 3,182.02Copiers06/2020 CITY PRINTERS202128CANON FINANCIAL SERVICES, …502-0000-60662 85.98Cable - Utilities05/25-06/24/20 - CITH HALL INTERNET202141FRONTIER COMMUNICATIONS…502-0000-61400 95.89Cable - Utilities05/27-06/26/20 - BLACKHAWK/LQ PARK D…202141FRONTIER COMMUNICATIONS…502-0000-61400 100.89Cable - Utilities05/26-6/25/20 - CITY HALL DSL202141FRONTIER COMMUNICATIONS…502-0000-61400 3,465.28Software Licenses05/10-06/09/10 - MS AZURE ONLINE SVCS202152MICROSOFT CORPORATION 502-0000-60301 651.30Machinery & Equipment06/17/20 HPLASERJET PRO MF479FDN LA…202153NEWEGG BUSINESS INC.502-0000-80100 66.52Cable - Utilities05/02-06/01/20 - BACKUP SERVER (2183)202179VERIZON WIRELESS 502-0000-61400 1,269.97Cell/Mobile Phones05/02-06/01/20 - CITY CELL IPADS (5587)202179VERIZON WIRELESS 502-0000-61301 2,094.10Cell/Mobile Phones05/02-06/01/20 - CITY CELL SVC (5496)202179VERIZON WIRELESS 502-0000-61301 Fund 502 - INFORMATION TECHNOLOGY Total: 11,011.95 Fund: 601 - SILVERROCK RESORT 1,047.10Repair & Maintenance06/12/20 - SRR LED & MOTION SENSOR202181VINTAGE E & S INC 601-0000-60660 Fund 601 - SILVERROCK RESORT Total: 1,047.10 Grand Total: 2,375,415.27 110 Demand Register Packet: APPKT02426 - BC 06/19/2020 6/18/2020 7:47:31 PM Page 4 of 5 Fund Summary Fund Expense Amount 101 - GENERAL FUND 1,287,113.79 201 - GAS TAX FUND 1,028.20 202 - LIBRARY & MUSEUM FUND 77.76 212 - SLESA (COPS) FUND 5,604.88 215 - LIGHTING & LANDSCAPING FUND 3,709.76 221 - AB 939 - CALRECYCLE FUND 49,299.20 241 - HOUSING AUTHORITY 2,067.50 243 - RDA LOW-MOD HOUSING FUND 780.00 401 - CAPITAL IMPROVEMENT PROGRAMS 983,672.41 501 - FACILITY & FLEET REPLACEMENT 30,002.72 502 - INFORMATION TECHNOLOGY 11,011.95 601 - SILVERROCK RESORT 1,047.10 Grand Total: 2,375,415.27 Account Summary Account Number Account Name Expense Amount 101-0000-20304 Sales Taxes Payable -3,554.25 101-0000-20945 Vision Insurance Pay 7,070.46 101-0000-20948 Add'l Life Insurance Pay 488.11 101-0000-20981 United Way Deductions 82.00 101-0000-22810 Developer Deposits 23,000.00 101-0000-42300 Cash Over/Short 1,288.50 101-1006-60104 Consultants 2,394.42 101-1006-60106 Auditors 11,425.00 101-1007-60195 Coronavirus Expenses 92.44 101-1007-60403 Citywide Conf Room Suppl…381.90 101-2001-60103 Professional Services 7,470.00 101-2001-60161 Sheriff Patrol 690,302.95 101-2001-60162 Police Overtime 13,281.71 101-2001-60163 Target Team 191,764.96 101-2001-60164 Community Services Offic… 59,493.17 101-2001-60166 Gang Task Force 13,622.40 101-2001-60167 Narcotics Task Force 13,622.40 101-2001-60168 School Officer 1,699.66 101-2001-60169 Motor Officer 45,957.60 101-2001-60170 Dedicated Sargeants 36,617.20 101-2001-60171 Dedicated Lieutenant 21,363.20 101-2001-60172 Sheriff - Mileage 36,489.36 101-2001-60174 Blood/Alcohol Testing 160.00 101-2001-60175 Special Enforcement Funds 5,256.34 101-2001-60176 Sheriff - Other 1,934.57 101-2001-60420 Operating Supplies -1,636.02 101-2002-61100 Gas - Utilities 70.50 101-2002-61200 Water - Utilities 40.57 101-2002-61400 Cable - Utilities 189.30 101-3001-60510 Grants & Economic Devel… 4,900.00 101-3002-60352 Subscriptions & Publicati… 46.85 101-3005-60184 Fritz Burns Pool Maintena… 4,710.82 101-3005-60400 Office Supplies 346.90 101-3005-60423 Supplies-Graffiti and Van… 453.40 101-3005-60431 Materials/Supplies 286.40 101-3005-61206 Water -Desert Pride - Utili… 925.08 101-3005-61207 Water -Pioneer Park - Utili…1,289.90 101-3005-61300 Telephone - Utilities 93.62 101-3008-60431 Materials/Supplies 166.08 101-3008-60432 Tools/Equipment 43.26 101-3008-60667 HVAC 884.00 101-3008-60691 Maintenance/Services 982.70 101-3008-61200 Water - Utilities 17.68 111 Demand Register Packet: APPKT02426 - BC 06/19/2020 6/18/2020 7:47:31 PM Page 5 of 5 Account Summary Account Number Account Name Expense Amount 101-6003-60118 Plan Checks 9,987.50 101-6004-60103 Professional Services 2,422.20 101-6004-60400 Office Supplies 22.66 101-6006-60103 Professional Services 3,000.00 101-7003-60400 Office Supplies 89.82 101-7003-60420 Operating Supplies 700.08 101-7003-60432 Tools/Equipment 214.79 101-7003-80100 Machinery & Equipment 75,024.93 101-7006-60146 PM 10 - Dust Control 136.67 201-7003-60427 Safety Gear 555.94 201-7003-60429 Traffic Control Signs 351.15 201-7003-60431 Materials/Supplies 62.74 201-7003-60433 Paint/Legends 58.37 202-3006-61200 Water - Utilities 77.76 212-0000-60178 COPS Robbery Prevention 3,561.05 212-0000-60179 COPS Burglary/Theft Prev… 2,043.83 215-7004-60423 Supplies-Graffiti and Van… 15.85 215-7004-60673 Palm Trees 2,100.00 215-7004-61211 Water - Medians - Utilities 1,593.91 221-0000-60127 AB 939 Recycling Solutions 49,299.20 241-9101-60103 Professional Services 2,067.50 243-0000-60532 Homelessness Assistance 780.00 401-0000-20600 Retention Payable -17,897.44 401-0000-60108 Technical 580.00 401-0000-60185 Design 11,165.75 401-0000-60188 Construction 364,265.83 401-0000-60480 Contributions to Other Ag… 625,558.27 501-0000-60674 Fuel & Oil 2,349.70 501-0000-60675 Parts & Maintenance Supp…1,515.67 501-0000-60678 Street Sweeper 26.34 501-0000-80100 Machinery & Equipment 26,111.01 502-0000-60301 Software Licenses 3,465.28 502-0000-60662 Copiers 3,182.02 502-0000-61301 Cell/Mobile Phones 3,364.07 502-0000-61400 Cable - Utilities 349.28 502-0000-80100 Machinery & Equipment 651.30 601-0000-60660 Repair & Maintenance 1,047.10 Grand Total: 2,375,415.27 Project Account Summary Project Account Key Expense AmountProject Account Name Project Name **None**1,281,608.33**None** **None** 091002CB 613,784.60Contribution Costs Madison Street Avenue 50 to Aven 151603CT 6,317.08Construction Expense La Quinta Village Complete St-ATPS 151603D 8,195.75Design Expense La Quinta Village Complete St-ATPS 201602D 2,870.00Design Expense HSIP Traffic Signal Interconnect/HS 201608CT 357,948.75Construction Expense SilverRock Event Space 201608RP -17,897.44Retention Payable SilverRock Event Space 201701T 580.00Technical Expense Washington Street at Fred Waring 201801D 100.00Design Expense Cove Public Restroom 261-123E 23,000.00SAFEWAY EXP SAFEWAY INC 999902CB 11,773.67Contribution Costs Jefferson St/I-10 (contribution cost CORONAMS 92.44Corona Materials & Supplies Corona Virus Emergency Response CSA152E 75,051.27CSA 152 Expenses CSA 152 Project Tracking FBPOPSE 4,520.82Fritz Burns Pool Operations Expense Fritz Burns Pool Operations MATRIXE 7,470.00Police Matrix Study Expense Police Matrix Study Grand Total: 2,375,415.27 112 6/25/2020 7:36:03 PM Page 1 of 5 Demand Register City of La Quinta Packet: APPKT02433 - BC 06/26/2020 AmountVendor Name Payment Number Description (Item) Account Name Account Number Fund: 101 - GENERAL FUND 39.75Coronavirus Expenses06/07-07/04/20 - CH POL SVC SINKS202186BURRTEC ENVIRONMENTAL 101-1007-60195 212.90Coronavirus Expenses06/07-07/04/20 - CH POL SVC SINKS202186BURRTEC ENVIRONMENTAL 101-1007-60195 26.27Professional Services05/31/20 - AMERICAN EXPRESS202187BURRTEC WASTE & RECYCLING…101-1002-60103 354.87Professional Services05/31/20 - AMERICAN EXPRESS202187BURRTEC WASTE & RECYCLING…101-1002-60103 400.78Professional Services05/31/20 - AMERICAN EXPRESS202187BURRTEC WASTE & RECYCLING…101-1002-60103 609.43Water - Utilities06/22/20 - WATER SERVICE202189COACHELLA VALLEY WATER DI…101-2002-61200 3,434.76Water -Monticello Park - Utiliti…06/22/20 - WATER SERVICE202189COACHELLA VALLEY WATER DI…101-3005-61201 91.16Water -Fritz Burns Park - Utiliti…06/22/20 - WATER SERVICE202189COACHELLA VALLEY WATER DI…101-3005-61204 19.05Water -Seasons Park - Utilities06/22/20 - WATER SERVICE202189COACHELLA VALLEY WATER DI…101-3005-61208 164.77Water -Community Park - Utilit…06/22/20 - WATER SERVICE202189COACHELLA VALLEY WATER DI…101-3005-61209 90.44Water - Utilities06/22/20 - WATER SERVICE202189COACHELLA VALLEY WATER DI…101-3008-61200 415.85Water - Utilities06/22/20 - WATER SERVICE202189COACHELLA VALLEY WATER DI…101-2002-61200 219.29Water -Eisenhower Park - Utilit…06/22/20 - WATER SERVICE202189COACHELLA VALLEY WATER DI…101-3005-61203 214.69Water -Velasco Park - Utilities06/22/20 - WATER SERVICE202189COACHELLA VALLEY WATER DI…101-3005-61205 39.55PM 10 - Dust Control06/22/20 - WATER SERVICE202189COACHELLA VALLEY WATER DI…101-7006-60146 8,817.60Sheriff Patrol04/01/20 CITY-WIDE CAMERA SYSTEM202191CONVERGINT TECHNOLOGIES …101-2001-60161 690.00Materials/Supplies06/24/20 - FB PARK REPL TENNIS PARTS202192COURTMASTER SPORTS, INC.101-3005-60431 63.41Materials/Supplies06/23/20 - MATERIALS202195DAVE BANG, INC.101-3005-60431 304.81Postage06/12/20 - OVERNIGHT MAIL202200FEDEX 101-1007-60470 79.00Over Payments, AR Policy06/09/20 - LIC-0100694 REFUND BL FEES202202GARCIA PLUMBING CO.101-0000-20330 4,174.04Special Enforcement Funds06/18/20 REPLACEMENT POLICE TRAFFIC …202203GOLDEN STAR TECHNOLOGY, …101-2001-60175 403.77Materials/Supplies05/29/20 - PARKS SOAP DISPENSER (7)202204GRAINGER 101-3008-60431 243.02Materials/Supplies05/29/20 - PARKS LIQUID SOAP (3)202204GRAINGER 101-3008-60431 173.05Materials/Supplies06/16/20 - PARKS SOAP DISPENSER (3)202204GRAINGER 101-3008-60431 6,571.00Map/Plan Checking05/22/20 ON-CALL ENG PLAN CHECK SVC …202205HR GREEN PACIFIC INC 101-7002-60183 32.63Office Supplies06/02/20 - OFFICE SUPPLIES202210OFFICE DEPOT 101-1005-60400 24.46Office Supplies06/02/20 - OFFICE SUPPLIES202210OFFICE DEPOT 101-1005-60400 95.91Coronavirus Expenses06/18/20 - GLOVES LARGE202210OFFICE DEPOT 101-1007-60195 20.27Office Supplies06/18/20 - OFFICE SUPPLIES202210OFFICE DEPOT 101-1006-60400 11,856.58Sales Tax Reimbursements06/26/20 - SALES TAX REIMB QTR END 03…202211ONE ELEVEN LA QUINTA LLC 101-1007-60535 216.79Postage06/06/20 - OVERNIGHT MAIL202212ONTRAC 101-1007-60470 36.00Business Licenses05/26/20 - LIC-763873 REFUND BL202213PALM CANYON GROUP 101-0000-41600 2,066.29Marketing & Tourism Promoti…06/19/20 - STAFF COVID19- FACE COVERI…202214PALMS TO PINES PRINTING 101-3007-60461 275.00Operating Supplies06/2020 REPAIRS SVCS FOR WC GYM EQU…202215PAX FITNESS REPAIR 101-3002-60420 1,461.00Landscape Contract06/2020 GENERAL MAINT LLMD PROJ 201…202217PWLC II, INC 101-2002-60112 8,560.00Professional Services06/08/20 HWY 111 AREA PLANNING FINAL…202219RANGWALA ASSOCIATES 101-6002-60103 624.00Map/Plan Checking06/18/20 REVIEW TRACT MAP 37790202220RASA/ERIC NELSON 101-7002-60183 396,369.26Sheriff - Other07/01/19-06/30/20 - FACILITY FEE202221RIVERSIDE COUNTY SHERIFF D…101-2001-60176 213,215.79Sheriff Patrol07/01/19-04/22/20 - ADJ BP1-BP10 POLIC…202221RIVERSIDE COUNTY SHERIFF D…101-2001-60161 33,689.38Police Overtime07/01/19-04/22/20 - ADJ BP1-BP10 POLIC…202221RIVERSIDE COUNTY SHERIFF D…101-2001-60162 60,688.34Target Team07/01/19-04/22/20 - ADJ BP1-BP10 POLIC…202221RIVERSIDE COUNTY SHERIFF D…101-2001-60163 5,687.17Community Services Officer07/01/19-04/22/20 - ADJ BP1-BP10 POLIC…202221RIVERSIDE COUNTY SHERIFF D…101-2001-60164 4,935.00Gang Task Force07/01/19-04/22/20 - ADJ BP1-BP10 POLIC…202221RIVERSIDE COUNTY SHERIFF D…101-2001-60166 5,100.00Narcotics Task Force07/01/19-04/22/20 - ADJ BP1-BP10 POLIC…202221RIVERSIDE COUNTY SHERIFF D…101-2001-60167 14,686.31Motor Officer07/01/19-04/22/20 - ADJ BP1-BP10 POLIC…202221RIVERSIDE COUNTY SHERIFF D…101-2001-60169 20,759.20Dedicated Sargeants07/01/19-04/22/20 - ADJ BP1-BP10 POLIC…202221RIVERSIDE COUNTY SHERIFF D…101-2001-60170 8,791.05Dedicated Lieutenant07/01/19-04/22/20 - ADJ BP1-BP10 POLIC…202221RIVERSIDE COUNTY SHERIFF D…101-2001-60171 1,447.27Sheriff - Mileage07/01/19-04/22/20 - ADJ BP1-BP10 POLIC…202221RIVERSIDE COUNTY SHERIFF D…101-2001-60172 -1,176.73Special Enforcement Funds07/01/19-04/22/20 - ADJ BP1-BP10 POLIC…202221RIVERSIDE COUNTY SHERIFF D…101-2001-60175 41.00Sales Taxes Payable05/2020 - SALES/USE TAX202222SILVERROCK RESORT 101-0000-20304 1,350.00Civic Center Lake Maintenance06/2020 CC CAMPUS LAKE MAINT202223SOUTHWEST AQUATICS INC 101-3005-60117 16.28Coronavirus Expenses06/06/20 - CLOROX WIPES 3 CT202225STAPLES ADVANTAGE 101-1007-60195 148.98Coronavirus Expenses06/07/20 - WIPE REFILLS OXIVIR (1)202225STAPLES ADVANTAGE 101-1007-60195 113 Demand Register Packet: APPKT02433 - BC 06/26/2020 6/25/2020 7:36:03 PM Page 2 of 5 AmountVendor Name Payment Number Description (Item) Account Name Account Number 65.22Coronavirus Expenses06/10/20 - REUSABLE FACE MASKS202225STAPLES ADVANTAGE 101-1007-60195 522.21Forms, Copier Paper06/12/20 - COPY PAPER 8 1/2 X 11 11X17202225STAPLES ADVANTAGE 101-1007-60402 12.81Coronavirus Expenses06/13/20 - GLOVES XL202225STAPLES ADVANTAGE 101-1007-60195 20.21Coronavirus Expenses06/13/20 - GLOVES XL202225STAPLES ADVANTAGE 101-1007-60195 21.95Coronavirus Expenses06/17/20 - GLOVES LARGE202225STAPLES ADVANTAGE 101-1007-60195 6.51Office Supplies06/19/20 - OFFICE SUPPLIES202225STAPLES ADVANTAGE 101-3005-60400 516.56Operating Supplies06/18/20 - BUSINESS LICENSE PAPER202227THE PRINTING PLACE 101-6006-60420 10.50Cable - Utilities06/05-07/04/20 - FS #32 CABLE (1841)202229TIME WARNER CABLE 101-2002-61400 89.99Cable - Utilities06/03-07/02/20 - FS #93 INTERNET (3514)202229TIME WARNER CABLE 101-2002-61400 89.99Cable - Utilities05/29-06/28/20 - FS #32 INTERNET (6491)202229TIME WARNER CABLE 101-2002-61400 282.75Printing06/22/20 - CITY SEALS FIRE TRUCKS202230TOP OF THE LINE SIGNS 101-2002-60410 506.78Maintenance/Services06/22/20 - CITY HALL SIGNS202230TOP OF THE LINE SIGNS 101-3008-60691 40.00Pest Control06/05/20 - FRITZ BURNS PEST CONTROL202232TRULY NOLEN INC 101-3008-60116 10.00United Way DeductionsCONTRIBUTION202233UNITED WAY OF THE DESERT 101-0000-20981 72.00United Way DeductionsCONTRIBUTION202233UNITED WAY OF THE DESERT 101-0000-20981 918.22Telephone - Utilities04/26-05/25/20 - LQPD CELL SVC (6852)202234VERIZON WIRELESS 101-2001-61300 41,890.00Landscape Contract06/2020 PARKS MAINT202235VINTAGE ASSOCIATES 101-3005-60112 -336.00Maintenance/Services06/23/20 - MAINT SVC CREDIT202235VINTAGE ASSOCIATES 101-3005-60691 355.58Materials/Supplies06/16/20 - MATERIALS202235VINTAGE ASSOCIATES 101-3005-60431 408.00Consultants03/2020 WELLNESS WORKS - EMP ASSIST …202237WELLNESS WORKS 101-1004-60104 420.00Consultants04/2020 WELLNESS WORKS - EMP ASSIST …202237WELLNESS WORKS 101-1004-60104 412.00Consultants05/2020 WELLNESS WORKS - EMP ASSIST …202237WELLNESS WORKS 101-1004-60104 190.10Printing06/19/20 - STICKERS202238XPRESS GRAPHICS 101-3007-60410 Fund 101 - GENERAL FUND Total: 865,395.87 Fund: 201 - GAS TAX FUND 787.25Materials/Supplies06/17/20 - ASPHALT COLD PATCH BAG202193CRAFCO, INC 201-7003-60431 2,398.88Safety Gear06/19/20 - PPE SAFETY202193CRAFCO, INC 201-7003-60427 81.20Materials/Supplies05/11/20 - ELECTRIC CONCRETE VIBRATOR202218QUINN COMPANY 201-7003-60431 69.60Traffic Control Signs06/17/20 - TRAFFIC CONTROL BEADS202231TOPS' N BARRICADES INC 201-7003-60429 116.42Traffic Control Signs06/22/20 - TRAFFIC CONTROL SIGNS202231TOPS' N BARRICADES INC 201-7003-60429 Fund 201 - GAS TAX FUND Total: 3,453.35 Fund: 202 - LIBRARY & MUSEUM FUND 49.85Water - Utilities06/22/20 - WATER SERVICE202189COACHELLA VALLEY WATER DI…202-3006-61200 910.00Landscape Contract05/2020 LIBRARY MAINT202235VINTAGE ASSOCIATES 202-3004-60112 190.00Landscape Contract06/2020 MUSEUM MAINT202235VINTAGE ASSOCIATES 202-3006-60112 Fund 202 - LIBRARY & MUSEUM FUND Total: 1,149.85 Fund: 212 - SLESA (COPS) FUND 234.56COPS Robbery Prevention07/01/19-04/22/20 - ADJ BP1-BP10 POLIC…202221RIVERSIDE COUNTY SHERIFF D…212-0000-60178 181.03COPS Burglary/Theft Preventi…07/01/19-04/22/20 - ADJ BP1-BP10 POLIC…202221RIVERSIDE COUNTY SHERIFF D…212-0000-60179 Fund 212 - SLESA (COPS) FUND Total: 415.59 Fund: 215 - LIGHTING & LANDSCAPING FUND 900.00Maintenance/Services06/17/20 - MONUMENTS MAINT202185BLOWNAWAY BY WILLIAM 215-7004-60691 5,167.66Water - Medians - Utilities06/22/20 - WATER SERVICE202189COACHELLA VALLEY WATER DI…215-7004-61211 6,349.83Consultants06/2020 LIGHTING MAINTENANCE SERVICE202194CREATIVE LIGHTING & ELECTR…215-7004-60104 103.66Electric - Utilities06/07-07/06/20 - PHONE SERVICE202201FRONTIER COMMUNICATIONS…215-7004-61116 57.77Electric - Utilities06/10-07/09/20 - PHONE SERVICE202201FRONTIER COMMUNICATIONS…215-7004-61116 933.87Electric - Utilities06/22/20 - ELECTRICITY SERVICE202206IMPERIAL IRRIGATION DIST 215-7004-61116 74.87Electric - Medians - Utilities06/22/20 - ELECTRICITY SERVICE202206IMPERIAL IRRIGATION DIST 215-7004-61117 193.94Tools/Equipment06/17/20 - BG 56 BLOWER202209MOWERS PLUS INC 215-7004-60432 55,793.00Landscape Contract06/2020 GENERAL MAINT LLMD PROJ 201…202217PWLC II, INC 215-7004-60112 59.57Operating Supplies06/17/20 - DIGITAL CLOCK202225STAPLES ADVANTAGE 215-7004-60420 205.39Materials/Supplies06/22/20 - PAINT & MATERIALS202228THE SHERWIN-WILLIAMS CO.215-7004-60431 11,865.00Landscape Contract06/2020 LIGHTING & LANDSCAPING MAINT202235VINTAGE ASSOCIATES 215-7004-60112 766.64Materials/Supplies06/05/20 - LED LAMP (10)202236WALTERS WHOLESALE ELECTR…215-7004-60431 848.25Materials/Supplies06/05/20 - FLOOD LIGHTS (12)202236WALTERS WHOLESALE ELECTR…215-7004-60431 134.47Materials/Supplies06/10/20 - MATERIALS202236WALTERS WHOLESALE ELECTR…215-7004-60431 388.66Materials/Supplies06/22/20 - MATERIALS202236WALTERS WHOLESALE ELECTR…215-7004-60431 880.88Materials/Supplies06/22/20 - FLOOD LIGHTS (10)202236WALTERS WHOLESALE ELECTR…215-7004-60431 Fund 215 - LIGHTING & LANDSCAPING FUND Total: 84,723.46 114 Demand Register Packet: APPKT02433 - BC 06/26/2020 6/25/2020 7:36:03 PM Page 3 of 5 AmountVendor Name Payment Number Description (Item) Account Name Account Number Fund: 221 - AB 939 - CALRECYCLE FUND 3,000.00AB 939 Recycling Solutions05/2020 - 107.3 MOD FM RECYCLE202184ALPHA MEDIA LLC 221-0000-60127 Fund 221 - AB 939 - CALRECYCLE FUND Total: 3,000.00 Fund: 230 - CASp FUND, AB 1379 4.00SB 1186 Revenue05/26/20 - LIC-763873 REFUND BL202213PALM CANYON GROUP 230-0000-42130 Fund 230 - CASp FUND, AB 1379 Total: 4.00 Fund: 241 - HOUSING AUTHORITY 5,825.00Professional Services05/2020 HOUSING COMPLIANCE AND M…202188CAHA, BECKY 241-9101-60103 Fund 241 - HOUSING AUTHORITY Total: 5,825.00 Fund: 247 - ECONOMIC DEVELOPMENT FUND 157.50Marketing & Tourism Promoti…04/01-04/30/20 - 93.7 KCLB STIMULUS PKG202184ALPHA MEDIA LLC 247-0000-60461 920.00Marketing & Tourism Promoti…06/01-06-16/20 - FIND FOOD BANK202207KUNA FM 247-0000-60461 -2,750.00Marketing & Tourism Promoti…03/16-04/12/20 - RECLASS TO PROJECT C…202226THE LAMAR COMPANIES 247-0000-60461 2,750.00Marketing & Tourism Promoti…03/16-04/12/20 - RECLASS FROM PROJECT…202226THE LAMAR COMPANIES 247-0000-60461 2,750.00Marketing & Tourism Promoti…06/08-07/05/20 - DIGITAL BILLBOARDS C…202226THE LAMAR COMPANIES 247-0000-60461 Fund 247 - ECONOMIC DEVELOPMENT FUND Total: 3,827.50 Fund: 401 - CAPITAL IMPROVEMENT PROGRAMS 36,666.00Construction06/18/20 - 2014-13 CONST INSP DEP SRR202190COACHELLA VALLEY WATER DI…401-0000-60188 -4,507.38Retention PayablePO 1920-0101 RETENTION 5202196DBX, INC.401-0000-20600 90,147.26Construction05/26/20 2016-02 HSIP INTERCONNECT I…202196DBX, INC.401-0000-60188 1,188.05Technical06/14/20 2016-08 COMPACTION TESTING202197EARTH SYSTEMS PACIFIC 401-0000-60108 422.84Construction02/28/20 - MMU REPAIRS202198ECONOLITE CONTROL PRODU…401-0000-60188 8,172.50Design03/31/20 SRR PHASE II INFRASTRUCTURE …202208MICHAEL BAKER INTERNATIO…401-0000-60185 2,653.25Design05/31/20 SRR PHASE II INFRASTRUCTURE …202208MICHAEL BAKER INTERNATIO…401-0000-60185 400.00Design05/31/20 SRR PHASE II INFRASTRUCTURE …202208MICHAEL BAKER INTERNATIO…401-0000-60185 162.00Construction06/18/20 - 2016-02 SCANS202216PLANIT REPROGRAPHICS SYST…401-0000-60188 282.80Construction06/22/20 - 2019-09 CONST SET202216PLANIT REPROGRAPHICS SYST…401-0000-60188 702.58Construction05/2020 ON CALL TRAFFIC SIGNAL REPAIR…202224ST. FRANCIS ELECTRIC, LLC 401-0000-60188 Fund 401 - CAPITAL IMPROVEMENT PROGRAMS Total: 136,289.90 Fund: 501 - FACILITY & FLEET REPLACEMENT 20,032.42Vehicles, Rentals & Leases06/2020 - FLEET LEASE202199ENTERPRISE FM TRUST 501-0000-71030 Fund 501 - FACILITY & FLEET REPLACEMENT Total: 20,032.42 Fund: 502 - INFORMATION TECHNOLOGY 105.01Cable - Utilities06/10-07/09/20 - CITY HALL INTERNET202201FRONTIER COMMUNICATIONS…502-0000-61400 223.55Cable - Utilities06/04-07-03/20 - DSL SERVICE202201FRONTIER COMMUNICATIONS…502-0000-61400 147.03Cable - Utilities03/15-04/14/20 - WC CABLE (8105)202229TIME WARNER CABLE 502-0000-61400 147.03Cable - Utilities04/15-05/14/20 - WC CABLE (8105)202229TIME WARNER CABLE 502-0000-61400 168.14Cable - Utilities06/2020 - CITY HALL CABLE (4625)202229TIME WARNER CABLE 502-0000-61400 2,079.00Cable - Utilities06/10-07/09/20 - CITY HALL FIBER (2546)202229TIME WARNER CABLE 502-0000-61400 Fund 502 - INFORMATION TECHNOLOGY Total: 2,869.76 Fund: 503 - PARK EQUIP & FACILITY FUND 676.53Parks06/23/20 - TUBE SLIDE REPL PART202195DAVE BANG, INC.503-0000-71060 Fund 503 - PARK EQUIP & FACILITY FUND Total: 676.53 Grand Total: 1,127,663.23 115 Demand Register Packet: APPKT02433 - BC 06/26/2020 6/25/2020 7:36:03 PM Page 4 of 5 Fund Summary Fund Expense Amount 101 - GENERAL FUND 865,395.87 201 - GAS TAX FUND 3,453.35 202 - LIBRARY & MUSEUM FUND 1,149.85 212 - SLESA (COPS) FUND 415.59 215 - LIGHTING & LANDSCAPING FUND 84,723.46 221 - AB 939 - CALRECYCLE FUND 3,000.00 230 - CASp FUND, AB 1379 4.00 241 - HOUSING AUTHORITY 5,825.00 247 - ECONOMIC DEVELOPMENT FUND 3,827.50 401 - CAPITAL IMPROVEMENT PROGRAMS 136,289.90 501 - FACILITY & FLEET REPLACEMENT 20,032.42 502 - INFORMATION TECHNOLOGY 2,869.76 503 - PARK EQUIP & FACILITY FUND 676.53 Grand Total: 1,127,663.23 Account Summary Account Number Account Name Expense Amount 101-0000-20304 Sales Taxes Payable 41.00 101-0000-20330 Over Payments, AR Policy 79.00 101-0000-20981 United Way Deductions 82.00 101-0000-41600 Business Licenses 36.00 101-1002-60103 Professional Services 781.92 101-1004-60104 Consultants 1,240.00 101-1005-60400 Office Supplies 57.09 101-1006-60400 Office Supplies 20.27 101-1007-60195 Coronavirus Expenses 634.01 101-1007-60402 Forms, Copier Paper 522.21 101-1007-60470 Postage 521.60 101-1007-60535 Sales Tax Reimbursements 11,856.58 101-2001-60161 Sheriff Patrol 222,033.39 101-2001-60162 Police Overtime 33,689.38 101-2001-60163 Target Team 60,688.34 101-2001-60164 Community Services Offic… 5,687.17 101-2001-60166 Gang Task Force 4,935.00 101-2001-60167 Narcotics Task Force 5,100.00 101-2001-60169 Motor Officer 14,686.31 101-2001-60170 Dedicated Sargeants 20,759.20 101-2001-60171 Dedicated Lieutenant 8,791.05 101-2001-60172 Sheriff - Mileage 1,447.27 101-2001-60175 Special Enforcement Funds 2,997.31 101-2001-60176 Sheriff - Other 396,369.26 101-2001-61300 Telephone - Utilities 918.22 101-2002-60112 Landscape Contract 1,461.00 101-2002-60410 Printing 282.75 101-2002-61200 Water - Utilities 1,025.28 101-2002-61400 Cable - Utilities 190.48 101-3002-60420 Operating Supplies 275.00 101-3005-60112 Landscape Contract 41,890.00 101-3005-60117 Civic Center Lake Mainten… 1,350.00 101-3005-60400 Office Supplies 6.51 101-3005-60431 Materials/Supplies 1,108.99 101-3005-60691 Maintenance/Services -336.00 101-3005-61201 Water -Monticello Park - … 3,434.76 101-3005-61203 Water -Eisenhower Park -… 219.29 101-3005-61204 Water -Fritz Burns Park - … 91.16 101-3005-61205 Water -Velasco Park - Utili…214.69 101-3005-61208 Water -Seasons Park - Util… 19.05 101-3005-61209 Water -Community Park -… 164.77 101-3007-60410 Printing 190.10 116 Demand Register Packet: APPKT02433 - BC 06/26/2020 6/25/2020 7:36:03 PM Page 5 of 5 Account Summary Account Number Account Name Expense Amount 101-3007-60461 Marketing & Tourism Pro… 2,066.29 101-3008-60116 Pest Control 40.00 101-3008-60431 Materials/Supplies 819.84 101-3008-60691 Maintenance/Services 506.78 101-3008-61200 Water - Utilities 90.44 101-6002-60103 Professional Services 8,560.00 101-6006-60420 Operating Supplies 516.56 101-7002-60183 Map/Plan Checking 7,195.00 101-7006-60146 PM 10 - Dust Control 39.55 201-7003-60427 Safety Gear 2,398.88 201-7003-60429 Traffic Control Signs 186.02 201-7003-60431 Materials/Supplies 868.45 202-3004-60112 Landscape Contract 910.00 202-3006-60112 Landscape Contract 190.00 202-3006-61200 Water - Utilities 49.85 212-0000-60178 COPS Robbery Prevention 234.56 212-0000-60179 COPS Burglary/Theft Prev… 181.03 215-7004-60104 Consultants 6,349.83 215-7004-60112 Landscape Contract 67,658.00 215-7004-60420 Operating Supplies 59.57 215-7004-60431 Materials/Supplies 3,224.29 215-7004-60432 Tools/Equipment 193.94 215-7004-60691 Maintenance/Services 900.00 215-7004-61116 Electric - Utilities 1,095.30 215-7004-61117 Electric - Medians - Utiliti… 74.87 215-7004-61211 Water - Medians - Utilities 5,167.66 221-0000-60127 AB 939 Recycling Solutions 3,000.00 230-0000-42130 SB 1186 Revenue 4.00 241-9101-60103 Professional Services 5,825.00 247-0000-60461 Marketing & Tourism Pro… 3,827.50 401-0000-20600 Retention Payable -4,507.38 401-0000-60108 Technical 1,188.05 401-0000-60185 Design 11,225.75 401-0000-60188 Construction 128,383.48 501-0000-71030 Vehicles, Rentals & Leases 20,032.42 502-0000-61400 Cable - Utilities 2,869.76 503-0000-71060 Parks 676.53 Grand Total: 1,127,663.23 Project Account Summary Project Account Key Expense AmountProject Account Name Project Name **None**974,655.36**None** **None** 141513CT 36,666.00Construction Expense SilverRock Way Infra/Street Improv 1920TMICT 1,125.42Construction Expense FY19/20 Traffic Maintenance Impro 201602CT 90,309.26Construction Expense HSIP Traffic Signal Interconnect/HS 201602RP -4,507.38Retention Payable HSIP Traffic Signal Interconnect/HS 201608D 8,572.50Design Expense SilverRock Event Space 201608T 1,188.05Technical Expense SilverRock Event Space 201709D 2,653.25Design Expense Ave 53 Jefferson St.Roundabout 201804E 848.25Landscape & Lighting Median Island … Landscape & Lighting Median Islan 201823E 8,560.00Highway 111 Corridor Area Expense Highway 111 Corridor Area Plan 201909CT 282.80Construction Expense Citywide Miscellaneous ADA Impro AMEXWASTE 781.92Amex Golf Expense Waste Disposal American Express Golf Tournamen CORONAMISC 6,577.50Miscellaneous Corona Virus Emergency Response CORONAMS -49.70Corona Materials & Supplies Corona Virus Emergency Response Grand Total: 1,127,663.23 117 6/19/2020 11:31:32 AM Page 1 of 2 Payment Reversal Register City of La Quinta APPKT02423 - BC 06/18/2020 Canceled Payables Vendor Set:01 - Vendor Set 01 Bank:APBNKBOW - APBNK- BOW 05073 Vendor Number LA QUINTA ROTARY CLUB Total Vendor Amount -4,900.00 Vendor Name Check 200999 06/18/2020 -4,900.0002/14/2020 06/18/2020 Payment Type Payment Number Original Payment Date Reversal Date Cancel Date Payment Amount Payable Number: Description Payable AmountDue DatePayable Date 021320-R 02/14/202002/13/20 - COMMUNITY SVCS GRANT FUNDING 4,900.0002/13/2020 09682 Vendor Number HINDU TEMPLE OF THE DESERT Total Vendor Amount -5,000.00 Vendor Name Check 201156 06/18/2020 -5,000.0002/28/2020 06/18/2020 Payment Type Payment Number Original Payment Date Reversal Date Cancel Date Payment Amount Payable Number: Description Payable AmountDue DatePayable Date 1-R 02/28/202002/19/20 NAMASTE INDIA FESTIVAL 5,000.0002/19/2020 118 Payment Reversal Register Packet: APPKT02423 - BC 06/18/2020 6/19/2020 11:31:32 AM Page 2 of 2 Bank Code Summary Canceled Payables Payables Left To Pay AgainBank Code Total APBNKBOW -9,900.00 0.00 -9,900.00 -9,900.00 0.00Report Total: -9,900.00 119 120 City of La Quinta Bank Transactions 06/05 – 06/26/2020 Wire Transaction Listed below are the wire transfers from 06/05 – 06/26/2020 Wire Transfers: 06/05/2020 - WIRE TRANSFER - PERS 131,039.94$ 06/05/2020 - WIRE TRANSFER - AM FSA 1,362.84$ 06/05/2020 - WIRE TRANSFER - TEXAS LIFE 857.35$ 06/10/2020 - WIRE TRANSFER - AM FSA 4,974.56$ 06/15/2020 - WIRE TRANSFER - PERS 43,184.33$ 06/15/2020 - WIRE TRANSFER - ICMA 3,815.29$ 06/15/2020 - WIRE TRANSFER - LQCEA 450.00$ 06/15/2020 - WIRE TRANSFER - PERS 426.55$ 06/18/2020 - WIRE TRANSFER - LANDMARK 132,269.14$ 06/23/2020 - WIRE TRANSFER - ICMA 690.00$ 06/23/2020 - WIRE TRANSFER - LQCEA 18.00$ 06/26/2020 - WIRE TRANSFER - PERS 38,948.54$ 06/26/2020 - WIRE TRANSFER - ICMA 3,125.29$ 06/26/2020 - WIRE TRANSFER - LQCEA 432.00$ TOTAL WIRE TRANSFERS OUT 361,593.83$ $77$&+0(17 121 122 City of La Quinta CITY COUNCIL MEETING:July 7, 2020 STAFF REPORT AGENDA TITLE: ADOPT RESOLUTION TO APPROVE A PUBLIC INTEREST FINDING TO RATIFY THE SELECT SOURCE CONTRACT EXTENSION OF BENGAL ENGINEERING, INC. TO COMPLETE THE ENGINEERING PHASE OF THE DUNE PALMS ROAD BRIDGE IMPROVEMENT PROJECT NO. 2011-05, FEDERAL AID PROJECT NO. BRLKS 5433 (014) RECOMMENDATION Adopt Resolution to approve a Public Interest Finding to ratify the select source contract extension of Bengal Engineering, Inc. to complete the engineering phase of the Dune Palms Road Bridge Improvement Project (Project No. 2011-05, Federal Aid Project No. BRLKS 5433 (014). EXECUTIVE SUMMARY x The Dune Palms Road Bridge Improvement Project (Project) will replace the existing low water crossing with an all-weather access bridge on Dune Palms Road at the Coachella Valley Storm Water Channel (CVSWC) (Attachment 1) and is partially funded through the state’s Highway Bridge Program. x In June 2014 the City entered into a Professional Services Agreement (PSA) with Bengal Engineering, Inc. (Bengal) to provide professional engineering and environmental services for the Project after conducting a two-step consultant selection process. x Amendment No. 8 to the PSA with Bengal was approved by the City Council on October 16, 2018 and extended the contract term after it had expired. x Extending the contract term after it had inadvertently expired is considered by Caltrans procedures to be a select source procurement and a Public Interest Finding (Attachment 2) must be adopted. FISCAL IMPACT The Dune Palms Road Bridge Project has an approved budget of $17,510,000. This project is funded through a combination of Federal Surface Transportation Funds through the state’s Highway Bridge Program. Federal funds will provide up to $15,501,603 of the total project cost. The Coachella Valley Association CONSENT CALENDAR ITEM NO. 123 of Governments (CVAG) will fund up to $1,506,750, and the City will fund the remaining $502,250. BACKGROUND/ANALYSIS In June 2014, Council approved a PSA with Bengal to provide professional engineering and environmental services for an all-weather bridge on Dune Palms Road spanning the CVSWC. While addressing other scope related changes which were ultimately included within Amendment No. 8, and approved by Council on October 16, 2018, staff realized that Bengal’s contract term had expired and included an extended term as part of that Amendment. At this point, the project had experienced several environmental and right of way processing delays. The environmental document, special studies, and environmental permitting took nearly 4 years to complete. During the time frame leading up to the expired term, the City had just received notification from Caltrans Environmental that the Project’s environmental document was finally approved. The City and its Consultants were working diligently to make up time and avoid losing the funding authorized for the preliminary engineering phase. The project development team was working through the requirements of the adopted environmental document, environmental permitting requirements, initiating the right of way acquisition phase and coordinating with utilities. The project could not proceed with any of these steps until the NEPA/CEQA environmental documents were adopted. It was not feasible to stop all work with Bengal and initiate a new competitive procurement process for the engineering services needed to complete the Project. Doing so would have been detrimental to the project, the general public, the City of La Quinta, the Coachella Valley Sub-Region, and the State. The contract extension is considered a select source procurement in accordance with Caltrans procedural requirements, which requires approval of a Public Interest Finding. The City Council is being asked to ratify the select source selection and the contract term extension approved with Amendment No. 8 on October 16, 2018 for Bengal Engineering to complete it’s contract work, and adopt a Public Interest Finding to satisfy Caltrans’s procedural requirements. The project development team is currently finalizing right of way acquisition, utility clearance, and final design. 124 Prepared by: Julie Mignogna, Management Analyst Approved by: Bryan McKinney, Public Works Director/City Engineer Attachments: 1. Vicinity Map 2. Public Interest Finding ALTERNATIVES Staff does not recommend an alternative. 125 126 RESOLUTION NO. 2020 - XXX A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF LA QUINTA, CALIFORNIA, TO APPROVE A PUBLIC INTEREST FINDING TO RATIFY THE SELECT SOURCE CONTRACT EXTENSION OF BENGAL ENGINEERING, INC. TO COMPLETE THE ENGINEERING PHASE OF THE DUNE PALMS ROAD BRIDGE IMPROVEMENT PROJECT NO. 2011-05, FEDERAL AID PROJECT NO. BRLKS 5433 (014) WHEREAS, on October 15, 2013, the City Council approved the program supplemental agreement with California Department of Transportation and Federal Highways Administration; authorized the City Manager to execute the agreement; and authorized staff to advertise the request for proposal to obtain the professional engineering and environmental services for the Dune Palms Road Bridge Improvement; and WHEREAS, the City issued a formal Request for Proposal on October 15, 2013 and conducted the pre-proposal conference on November 12, 2013; and WHEREAS, the City received 4 proposals from qualified firms on November 25, 2013, and conducted interviews with each of the 4 qualified firms on January 17, 2014; and WHEREAS, Bengal Engineering, Inc. was awarded a Professional Services Agreement June 17, 2014 to prepare the plans, specifications, and engineer’s estimate for the Dune Palms Road Bridge Improvement, City Project No. 2011-05, Federal Aid Project No. BRLKS 5433 (014); and WHEREAS,the City and Bengal Engineering, Inc. inadvertently allowed the Professional Services Agreement to lapse on July 31, 2018; and WHEREAS, it was not feasible to stop all work with Bengal Engineering, Inc. and initiate a new competitive procurement process for the engineering services needed to complete the Dune Palms Road Bridge Improvement Project; and WHEREAS, the City determined it was in the best interest of the public, the City, the Coachella Valley Sub-Region, the State of California, and FHWA to extend the contract term of Professional Services Agreement with Bengal Engineering, Inc. 12 Resolution No. 2020- Dune Palms Bridge Public Interest Finding Adopted: July 7, 2020 Page 2 of 3 NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of La Quinta, California, as follows: The City Council approves a Public Interest Finding to ratify the select source contract extension of Bengal Engineering, Inc. to complete the engineering phase of the Dune Palms Road Bridge Improvement Project, City Project No. 2011-05 and Federal Aid Project No. BRLKS 5433 (014). PASSED, APPROVED, and ADOPTED at a regular meeting of the La Quinta City Council held on this 7th day of July 2020, by the following vote: AYES: NOES: ABSENT: ABSTAIN: ________________________ LINDA EVANS, Mayor City of La Quinta, California 1 Resolution No. 2020- Dune Palms Bridge Public Interest Finding Adopted: July 7, 2020 Page 3 of 3 ATTEST: __________________________ MONIKA RADEVA, City Clerk City of La Quinta, California (CITY SEAL) APPROVED AS TO FORM: ___________________________ WILLIAM H. IHRKE, City Attorney City of La Quinta, California 12 130 WZK:d>Kd/KE HIGHWAY 111 sŝĐŝŶŝƚLJDĂƉ AVENUE 48 ATTACHMENT 1 1 13 ,'800%02* 8., 4. 08*4'8 88 :737X*IAD>Ag*j*3LDND]`X*`DQN/*ID:QXND*37T*X`L7N`c]37T*X`L7N`Q:`X*N]TQX`*`DQNQ:`X*N]TQX`*`DQN & & & 4 duxxqukqq0;Y"! ! 4 duxo~qutu~u0;Y"!" 4 R|u & $!"&#!"&"#!#&!%& $!"&&!%& F5 V\SG82b^V82F=F2 2J,^^S==858\,J=eO5^' & 69K9?+a96BE?BUYR;EK9 5F^b2S\b8VM MeJbFVJ8V\SG82b^ & & & & 4 duxqu~~uuz~kutqkqkq1<Z$$l 4 duxo~qx~|utku~k0;Y"! % 4 duxqkq~zu|t|u|kqu~~uo~tt~z1<Z#! 4 duxktkot~k~u0;Y"! % 4 *tu~~zu~tu|kuu0;Y"! 4 hk~ux-+u~qkYu~uu0;Y"! 4 R|u & PB_aURaB9[ 8^bFM,b852S^b=858\,J=eO5^ ^b,b8iF58 @8O8\,J58^2\FVbFSOS=iS\H X7*]QN]`A*`X7Wc7]`73*TTXQf*ID]/QN]D37X73`Q.7/Q]`7::7/`Df7QXDN`A7Tc.ID/].7]`DN`7X7]`]`*`7( TX7T*X73*TTXQf73.jIQ/*I*>7N/j]X7TX7]7N`*`Df7N*L7*N3`D`I7(3mv( X7TX7]7N`*`Df7 *TTXQf73.j3D]`XD/`IQ/*I*]]D]`*N/77N>DN77X3I*7 N*L7(3mv( 3I*7 *TTXQf73.j:Ag*.*vrmgmv:Ag*X7TX7]7N`*`Df7N*L7(3mv( 5p' Jsn ,{ws= w S{n ) 5J,8 2) 2n nVwsMnn{w 2y}w^C^ $77$&+0(17 %5./6 ✔ ✔ 5,9/D4XLQWD ,QWKH&LW\RI/D4XLQWDDORQJ'XQH3DOPV5RDGDWWKH &RDFKHOOD9DOOH\6WRUP:DWHU&KDQQHO:KLWHZDWHU5LYHU ✔ )LQDOGHVLJQDQG52:DSSUDLVDOVIRUWKHSURMHFWWRUHSODFHDODQHORZ ZDWHUFURVVLQJZLWKODQHEULGJH 6HH$WWDFKHG 3XEOLF:RUNV'LUHFWRU%U\DQ0F.LQQH\ 13 ,'800%02* 8., 4. 08*4'8 88 -13 #!3&6!+!118!3!/)&+3&-+5(&8+3!/!138&+&+$8 B 0,*3B(88:78:1(<,B)7@B=6+,:B7;<.,*<1>,B,<,:516(<176B$,9=1:,+B7:B#=)41*B6<,:,;<B ,<,:516(<176B$,9=1:,+ B B 0,*3B4(;;B7-B=6+;B(;B-7447?;B 46<,:;<(<,B (16<,6(6*,B!!(<176(4B 1/0?(AB%&#B %<(<,B&:(6;87:<(<176B#:7/:(5B"<0,:B(44B7<0,:B*4(;;,; B B #:7>1+,B<0,B,+,:(4(1+B#:72,*<BB6=5),:B16B-1:;<B*74=56 B B +,6<1-AB(4<:(6;B1;<:1*<7=6<A%<(<,B$7=<,#7;<B 14,B 7:B1<AB(6+B;<:,,<B16B;,*76+B*74=56 B B 1;<B;<15(<,+B7;<B7-B<0,B87:<176B7-B<0,B8:72,*<B;=)2,*<B<7B<01;B# B B 1;<B<0,B (57=6<B7-B <0,B ,+,:(4B=6+;B16B <0,B87:<176B7-B<0,B 8:72,*<B;=)2,*<B<7B <01;B# B B ,;*:1),B,6,:(4B7*(<176B(8841*()4,B<7B<01;B# B B #:7>1+,B,6,:(4B ,;*:18<176B7-B'7:3B (--,*<,+B)AB <01;B # B B @84(16B(6+B/1>,B$,(;76;B<0(<B:,9=,;<,+B(88:7>(4B1;B*76;1+,:,+B<7B),B*7;<,.,*<1>,B7:B16B<0,B 8=)41*;B),;<B16<,:,;< B#:7>1+,B*7;<B(6(4A;1;B7:B*758(:1;76B(;B,>1+,6*,B7-B*7;<,.,*<1>,6,;; B B$,5(:3;B1;B-7:B<0,B7*(4B/,6*AB$,8:,;,6<(<1>,B8:,8(:16/B <0,B16+16/ B B%1/6(<=:,B!(5,B(6+B&1<4,B7-B7*(4B/,6*AB$,8:,;,6<(<1>,B8:,8(:16/B7:B(88:7>16/B#B(;B (88:78:1(<,B(6+B(<, B B%1/6(<=:,B(6+B!(5,B7-B1;<:1*<B7*(4B ;;1;<(6*,B6/16,,:B(88:7>16/B<0,B#B(;B:,9=1:,+B(6+B (<, B B%1/6(<=:,B(6+B!(5,B7-B'B:,8:,;,6<(<1>,B(88:7>16/B<0,B#B-7:B=AB5,:1*(B?(1>,:;B(6+B (<, B $!88-"88 !/5/78813 REASONS THAT REQUESTED APPROVAL IS CONSIDERED TO BE COST EFFECTIVE OR IN THE PUBLIC’S BEST INTEREST (STATE) In 2013, during the selection of Bengal Engineering to perform the professional engineering and environmental services the City of La Quinta complied with the requirements set forth by the Caltrans LAPM and conducted a competitive one-step RFP consultant selection process. The following represents the chronology of events associated with the Consultant Selection Process: The City Appointed a Consultant Selection Committee Consisting of Project Engineers and Managers. The Request for Proposal was issued on October 15, 2013 and the Pre-Proposal Conference was conducted on November 12, 2013 at 10:30 am. The City received four (4) proposals from the following qualified consultants on November 25, 2013: Bengal Engineering, Inc., CNS Engineers, Inc., IDC Consulting, Engineers, Inc., and RBF Consulting. The Consultant Selection Committee met on December 16, 2013 and determined that all four (4) of the engineering firms submitting proposals should be interviewed. Interviews were conducted on January 17, 2014. Following the interviews, the Consultant Selection Committee recommended Bengal Engineering, Inc. be awarded a Professional Services Agreement to prepare the plans, specifications, and estimates for the Dune Palms Road Low Water Crossing Replacement at the Coachella Valley Stormwater Channel. The Professional Services Agreement with Bengal Engineering was prepared in accordance with the requirements outlined within Chapter 10 of the Caltrans LAPM and was submitted for review and acceptance by Caltrans Audit and Investigation. This included Exhibits 10K and 10H which outlined key personnel. Caltrans Audit and Investigation issued the contract Conformance Letter Review on May 22, 2014 . All deficiencies noted by Caltrans Audit and Investigation Conformance Review were incorporated and submitted to City Council for award consideration. The City Council considered and approved a Professional Services Agreement with Bengal Engineering, Inc. on June 17, 2014 While addressing other scope related changes which were ultimately included within Amendment No. 8, and approved by Council on October 16, 2018, staff realized that Bengal’s contract term had expired and included an extended term as part of that Amendment. At this point, the project had experienced several environmental and right of way processing delays. The environmental document, special studies, and environmental permitting took nearly 4 years to complete. During the time frame leading up to the expired term, the City had just received notification from Caltrans Environmental that that the Project’s environmental document was finally approved. The City and its Consultants were working diligently to make up time and avoid losing the funding authorized for the preliminary engineering phase due to the approaching reversion date. The project development team was working through the requirements of the adopted environmental document, environmental permitting requirements, initiating the right of way acquisition phase and coordinating with utilities. The project could not proceed with any of these steps until the NEPA/CEQA environmental documents were adopted. 13 It was not feasible to stop all work with Bengal and initiate a new competitive procurement process for the engineering services needed to complete the Project. Doing so would have been detrimental to the project, the general public, the City of La Quinta, the Coachella Valley Sub- Region, the State, and Federal Highway Administration (FHWA). Bengal Engineering is thoroughly aware of the issues surrounding the design and construction of the Dune Palms Bridge. They had been working in partnership with City for over 4 years on the project. They have coordinated with the Federal Emergency Management Agency, Riverside County Flood Control, Coachella Valley Water District, Caltrans District 8, and are well aware of the requirements for 1602 Streambed Alteration Agreement with the California Department of Fish and Game, the 401 Water Quality Certification from the Regional Water Quality Control Board and the 404 permit from the Army Corps of Engineers. The City finds the continuation of Bengal Engineering and Consulting, Inc. for the proposed project is in the best interest of the City of La Quinta, the State of California, and Federal Highway Administration. 13 City of La Quinta CITY COUNCIL MEETING: July 7, 2020 STAFF REPORT AGENDA TITLE: APPROVE CANCELING THE REGULAR CITY COUNCIL MEETINGS OF AUGUST 18 AND SEPTEMBER 1, 2020 RECOMMEDATION Approve cancelling the regular City Council meetings of August 18 and September 1, 2020. EXECUTIVE SUMMARY xCouncil traditionally modifies its meeting schedule during summer months if there are no known time-sensitive matters requiring Council action. xAdvance notice of cancelled meetings allows Councilmembers, Staff, and the public to properly plan for deadlines and operations. FISCAL IMPACT There would be a cost savings consisting of the time and materials associated with production of agenda packets. BACKGROUND/ANALYSIS The recommended summer meeting schedule is as follows: xJuly 21 regular meeting xAugust 4 regular meeting xAugust 18 CANCELLED xSeptember 1 CANCELLED xSeptember 15 regular meeting Should a pressing situation or matter require Council direction or action before the next regular meeting, a special meeting will be called. ALTERNATIVES Council may select alternate dates for cancelled meetings, cancel only one meeting, cancel more than two meetings, or cancel no meetings. Prepared by: Tania Flores, Management Assistant Approved by: Monika Radeva, City Clerk BUSINESS SESSION ITEM NO. 1 137 138 City of La Quinta CITY COUNCIL: June 7, 2020 STAFF REPORT AGENDA TITLE: APPROVE MODIFIED COVID-19 SMALL BUSINESS EMERGENCY ECONOMIC RELIEF PROGRAM FOR LA QUINTA BUSINESSES IMPACTED BY NOVEL CORONAVIRUS DISEASE RECOMMENDATION Approve modified COVID-19 Small Business Emergency Economic Relief Program for La Quinta businesses impacted by novel coronavirus disease. EXECUTIVE SUMMARY xIn March 2020 Council established a $1.5 million COVID-19 Small Business Emergency Economic Relief Program (Program) and appointed an Ad-Hoc Committee to review the Program, to help mitigate the adverse economic impacts on local businesses due to COVID-19. xRounds I, II and III of the Program combined have provided approximately $555,148 in loans and rebates to 55 businesses. xStaff is recommending a revision to the Program that would address the recent State Mandated closure of indoor activities for restaurants, providing additional economic relief. FISCAL IMPACT The modified Program would continue to utilize the remaining $944,852, previously allocated from the Economic Disaster Emergency Reserve. Expenditures would be charged to account 247-0000-60510. BACKGROUND/ANALYSIS On March 16, Riverside County Public Health Officer, Dr. Cameron Kaiser, ordered all County residents to stay at home to help prevent the spread of COVID-19. In addition, all non-essential businesses were directed to remain closed. BUSINESS SESSION ITEM NO. 2 139 The City recognizes that COVID-19 has put a difficult burden on our small business community. As a response to this unprecedented challenge, on March 25, 2020, the City Council authorized the appropriation of up to $1.5 million from the City’s Economic Disaster Reserves, and directed Staff to bring back to the Council for consideration a program offering micro-loans or similar relief to assist local businesses affected by the COVID-19 local emergency. Round I: Funds were provided to eligible businesses of 25 or fewer full-time equivalent employees in the form of zero interest, loans beginning at $5,000 and up to $20,000. A total of $500,000 is available exclusively to restaurants in the City. Under Round I $330,000 was awarded to 36 businesses. Round II: Allowed all businesses that would have been eligible in Round I to apply, including those that may have applied, were deemed eligible, but were not granted a loan. Additionally, Round II provided broader eligibility, such as businesses with over 25 employees and home businesses that do not have a physical storefront such as Handymen, Caterers, and Pest Control professionals. Under Round II $170,000 was awarded to 18 businesses. Round III: Created a Rebate Program for La Quinta businesses with a physical storefront that were willing to invest in safety measures as part of the statewide industry guidance. To date, under Round III $27,574.22 has been awarded to seven (7) businesses. Proposed Revisions to Program: introduce a modified Round III rebate program and/or a new Round IV relief program that would be available exclusively to La Quinta restaurants with a physical storefront. Due to the State mandated closure of indoor activities for restaurants on July 1, 2020, only outdoor dining will be permitted for a minimum of three (3) weeks. Recognizing the challenges associated with staffing, purchase of inventory, the difficulty associated with outside dining outside during the extreme desert summer season, and other operational expenses incurred after anticipating to reopen dine-in experiences, the proposed modifications to the Program would provide relief of up to $500,000 in emergency relief exclusively to restaurants. ALTERNATIVES Council may elect not to approve the revisions to the program. Prepared by: Doug Kinley, Management Specialist Approved by: Jon McMillen, City Manager 140 City of La Quinta CITY COUNCIL MEETING: July 7, 2020 STAFF REPORT AGENDA TITLE: CONTINUED FROM MAY 5, 2020: ADOPT RESOLUTIONS TO ADOPT MITIGATED NEGATIVE DECLARATION AND MITIGATION MONITORING AND REPORTING PROGRAM FOR ENVIRONMENTAL ASSESSMENT 2017-0006, AND APPROVE SPECIFIC PLAN 2017-0002 AMENDMENT NO. 2, TENTATIVE PARCEL MAP 2017-0003, AND SITE DEVELOPMENT PERMIT 2017-0009 PROPOSING AN APPROXIMATE 125,000 SQUARE-FOOT SHOPPING CENTER WITH DRIVE-THROUGHS AND A 63,000 SQUARE-FOOT SUPERMARKET WITH ASSOCIATED VEHICLE FUEL CENTER; CEQA: THE DESIGN AND DEVELOPMENT DEPARTMENT HAS PREPARED A MITIGATED NEGATIVE DECLARATION UNDER THE CALIFORNIA ENVIRONMENTAL QUALITY ACT; LOCATION: NORTHWEST CORNER OF AVENUE 50 AND JEFFERSON STREET; PROJECT: PAVILION PALMS SHOPPING CENTER RECOMMENDATION A. Adopt a resolution to adopt an Initial Study/Mitigated Negative Declaration for the Fairway Plaza Specific Plan Amendment No. 2 “Pavilion Palms” Shopping Center and a Mitigation Monitoring and Reporting Program for Environmental Assessment 2017-0006. B. Adopt a resolution to approve Specific Plan 2017-0002, Amendment No. 2 of the Fairway Plaza Specific Plan (SP 1998-034), Tentative Parcel Map 2017- 0003 (TPM 37370), and Site Development Permit 2017-0009, subject to the Findings and Conditions of Approval. EXECUTIVE SUMMARY x The applicant is requesting a Specific Plan Amendment (SPA), TPM, Site Development Permit (SDP), and Environmental Assessment (EA) to construct an approximate 125,000 sq. ft. shopping center consisting of commercial/office and retail buildings. x On December 10, 2019, the Planning Commission (Commission) recommended Council approval of this item, following review and consideration of the item and public testimony during four public hearings. x Council considered this item during public hearings held on February 4 and March 3, considered public testimony, directed the applicant to revise the site design, and continued the public hearing to May 5, 2020. At the May 5 public hearing, an applicant-requested continuance was granted to July 7, 2020. PUBLIC HEARING ITEM NO. 1 141 FISCAL IMPACT If approved, once operational, the project would generate sales and property taxes. Estimated taxable sales range from $7-9 million per year for the Pavilions store, $5- 8 million per year in gas sales and approximately $16 million per year for retail and restaurant sales for the remainder of the center. This volume of sales would produce $560,000-660,000 per year in new tax revenues for the City. Additionally, the estimated assessed value of the property is $28 million, yielding an estimated $12,000-17,000 per year in property taxes to the City. BACKGROUND/ANALYSIS Project History The Rancho Cielo Specific Plan (SP 1998-034) was approved in May 1999, for a 111,000 sq. ft. shopping center on 12.5 acres at the northwest corner of Jefferson Street and Avenue 50. A GPA, ZC, and TPM (TPM 29052) were also approved. In 2002, SPA No. 1 was approved for a 100,460 sq. ft. shopping center and renamed as the Fairway Plaza Shopping Center Specific Plan. This project was not constructed. Public Hearing History On May 8, 2018, a public hearing was held before the Planning Commission (Commission) to consider the project consisting of a SPA to allow for a 125,800 sq. ft. shopping center, renamed the Pavilion Palms Shopping Center, and allow deviations from the City’s zoning standards, a TPM to subdivide the site into 12 parcels, and a SDP for the center’s site plan, architecture and landscaping. The Commission at that time recommended approval. Due to the potential for a conflict of interest of one Commissioner, Council did not hear the project but remanded it back to the Commission for a new public hearing without the participation of that Commissioner. Another public hearing was held June 26, 2018 before the Commission which was continued in order to allow the applicant time to revise their traffic study to include an analysis of other intersections in the area in compliance with Engineering Bulletin (EB) 06-13. The applicant complied with this request and the continued public hearing was held October 8, 2019, where the Commission had other comments and requests regarding the site design and the landscape plan to encourage walkability and create public spaces. The applicant revised their site plan and the continued public hearing was held December 10, 2019 where the Commission recommended approval with some added conditions of approval to further encourage walkable design and address lighting issues. Council Direction Council held public hearings on February 4, and March 3, 2020 (staff reports and related materials are hereby incorporated by this reference), reviewed the proposal, considered public testimony, and asked the applicant to further revise the design of the site as follows: x Revise the site plan to provide better pedestrian circulation; 142 x Make the gathering spaces a more cohesive part of the plan; x Incorporate improved shade features; x Consider reducing the amount of parking for the center, in favor of more neighborhood design features; x Move the fuel center further to the north along Jefferson Street to create a more iconic corner at Avenue 50 and Jefferson Street; x Explore not having a left out at the eastern driveway on Avenue 50; x Consider what incorporating mixed uses could do for the center; x Show more detail of the corner plaza; x Revise corner building footprints to have better usable indoor space; and x Show renderings of plaza from outside the center. Site Development Permit – Revised Site Plan Since the March 3, 2020 public hearing meeting, the applicant has revised the site plan in response to comments from Council. The revised site plan shows the shopping center with 13 buildings at 125,800 sq. ft., which is an increase of 6,843 sq. ft. from what was shown at the March 3 hearing. This results in 0.23 Floor Area Ratio (FAR), still below the allowed 0.30 FAR for the underlying Community Commercial (CC) zone. Other changes made include: x The plaza area at the Jefferson Street/Avenue 50 corner has been refined and renderings have been included to show more detail in the plaza area and show the image from outside the center. x Corner building footprints have been revised to provide better usable space and incorporate patios towards the street. x Pedestrian connectivity has been enhanced with pronounced stamped concrete walkways and same treatment at the driveway entrances to the site. x The fuel center has been moved further north along Jefferson Street. x Architectural treatments have been enhanced to more closely reflect the look of the Pavilions building. x Parking spaces have increased from 463 to 486 due to increase in square footage. x Buildings 1, 2, 8, 9, and 10 would be slated for future construction, requiring a subsequent Site Development Permit. The 13 commercial buildings consist of the following (no changes from the project as presented at the March 3 meeting, except relocation of the fuel center) (Attachment 2): x A 63,000 sq. ft. Pavilions grocery store building, with a drive-through pharmacy; x A Pavilions-branded fuel center, with an 825 sq. ft. mini-mart (Building 7); x A retail building approximately 4,400 sq. ft. (Retail 1); x A multi-tenant building (Shops 1) approximately 11,700 sq. ft.; x Five buildings ranging from 2,000 to 5,000 sq. ft. (Buildings 1-5) along the Jefferson Street frontage, with Buildings 3 and 4 as drive-throughs; x Four buildings ranging from 4,000 to 8,000 sq. ft. along the Avenue 50 frontage; and 143 Fuel Center Operations Other than the revised location on the site, the fuel center operations are the same as proposed at the March 3 meeting. The Pavilions-branded fuel center will include dispensing of motor vehicle fuel, an automobile-related air/water unit, and an 825 sq. ft. mini-mart that will offer the sale of convenience dry goods and general merchandise, lottery tickets, refrigerated dairy/deli products and prepared food and drinks. The sale of beer, wine and alcohol would be prohibited. Hours of operation for the fuel center (including the mini mart) will be limited to 7:00 A.M. to 10:00 P.M. Similar to the fuel center hours of operation, deliveries for the entire shopping center will be limited to 7:00 A.M. to 10:00 P.M. per Mitigation Measure NOI-8 (Exhibit A). Traffic/Circulation There are no new changes to the project vehicular circulation. The vehicular circulation includes access from four driveways, two along Jefferson Street and two along Avenue 50. Two driveways will be restricted to right-in, right-out movements. The north driveway along Jefferson Street will be restricted to right-in, right-out and left-in movements. The easternmost driveway along Avenue 50 is proposed to allow full movements in and out of the site. The applicant proposes full movements at this driveway to facilitate access to the supermarket and fuel center. Pedestrian connectivity has been enhanced with pronounced stamped concrete walkways and same treatment at the driveway entrances to the site. Architecture The architectural style of the project has not changed since the March 3 meeting and is proposed to be contemporary utilizing materials such as glass, wood, and various metals (Attachment 3). Building forms are designed with clean, sharp horizontal and vertical planes. Architectural detailing has been enhanced using building projections and varying rooflines. Variations in color and materials are provided along building elevations facing Avenue 50 and Jefferson Street to break up building mass. Architectural plans (Attachment 2) show elevations, roof plans, and shell plans for the Pavilions building and fuel center (Building 7), Retail 1, Shops 1 and Buildings 3 through 6. These buildings are representative examples of the proposed architecture of the site. The architectural design of other retail pad buildings, Buildings 1, 2, 8, 9, and 10, will require separate SDP approval since they are not included in this package and will match the design of the currently proposed buildings. Landscaping and Lighting Landscaping for the project includes desert tolerant, water efficient plants (Attachment 2). The plans include landscape berms within the landscape setbacks along Jefferson Street and Avenue 50 to improve views into drive-through facilities and parking areas. Additional landscape treatment is proposed along the project’s western wall behind the Pavilions building to screen it from the views of the residences to the west. The applicant has revised the plant palette to include different shade trees including African Sumac and Tipuana Tipu trees in the parking area along with several palm varieties to enhance the architectural statement of the shopping center. In response 144 to concerns regarding shading, the applicant revised the landscape plan to add more shade trees in addition to the palms to provide more shade. The shading plan shows 70% shading of the parking lot which exceeds the minimum 50% required by the Code. Additionally, groupings of pindo palms are placed at the four entrances to create a sense of arrival. Landscaping around the corner plaza area consists of Washingtonia Hybrid palm trees within the plaza for shade and various shrubs including bougainvillea, barrel cactus, cassia and Mexican bird of paradise. A patio area has been included between Buildings 5 and 6. A short wall surrounds the patio and provides signage area for center identification. A condition of approval has been added requiring the applicant to add shade features and seating to the interior plaza areas as part of their final landscape plan. Regarding vacant pads and maintenance, conditions of approval have been incorporated. SDP Condition #109 requires vacant pads to be fully landscaped prior to issuance of Certificate of Occupancy for the Pavilions store. Additionally, to address landscape and property maintenance, the applicant will be required to record maintenance obligations in their CC&R’s, to which the City would be a third- party beneficiary (SDP Conditions #113 and 114), as well as enter into a maintenance agreement with the neighboring HOA’s (Renaissance and Palmilla), to which the City also would be a third-party beneficiary (SDP Condition #115). Parking lot lighting for the project will consist of LED lighting, no taller than 20 feet, which complies with height limits of the CC District (Attachment 2). Additionally, the conditions of approval restrict the height of the lights on the back of the Pavilions building to under 20 feet to reduce lighting impacts on the Renaissance neighborhood to the west. Tentative Parcel Map The current parcel configuration consists of five parcels on the property. The TPM proposes to reconfigure the property into 13 parcels (Attachment 2) to accommodate 13 buildings. This change is in response to changes made to the site plan which led to an increase in parcels from 12 to 13. Specific Plan Amendment There are no new changes to the Specific Plan Amendment. The Pavilion Palms Shopping Center project includes proposed deviations from the City’s Zoning standards and permitted uses (Attachment 1): • Reduce the minimum landscape setback along Jefferson Street and Avenue 50 from 20 to 18 feet—a 10% reduction • Allow retail stores over 50,000 sq. ft. as a permitted use (Pavilions building is proposed at 63,000 sq. ft.) • Allow a fuel center (automobile service station without repair facilities) as a permitted use, in conjunction with an anchor tenant. Should a fuel center be proposed without an anchor tenant, it would be subject to a Conditional Use Permit (CUP) 145 • Modify the current Master Design Theme from Spanish Mediterranean style to a Contemporary style. • Remove the sign program under the current Specific Plan to allow future sign programs to be considered without a SPA. If the revised site plan and building design changes are implemented, they would not require substantive changes to the Specific Plan amendment because they would not result in an increase in the intensity of the shopping center or propose new uses that were not previously considered. Per Government Code 65356, the project would not require Planning Commission review. PUBLIC NOTICE The public hearing notice was advertised in The Desert Sun newspaper on June 26, 2020 and was sent to property owners and occupants within a 500-foot radius of the project site, in accordance with Section 9.200.100 of the Municipal Code. ENVIRONMENTAL REVIEW The Design and Development Department has determined that a Mitigated Negative Declaration (MND) be prepared for the proposed project. Since the proposed project is essentially the same as the originally approved project in 1999 and amended in 2002, the MND reviewed the difference in the project between what was approved and what is currently proposed, (25,340 sq. ft. increase) in accordance with CEQA Guidelines Section 15162 regarding subsequent environmental review. The MND included mitigation measures from the previous environmental documents and proposed new mitigation measures where necessary. The MND was distributed to the City’s responsible agencies and sent to interested members of the public. Thirteen comments were received during the 30-day comment period. Responses to these comments were sent to each commenting party. Comments and responses are included in the Final MND, which has been included in Exhibit A of the proposed Resolution. The MND has been revised, subsequent to circulation for public review, to be consistent with the findings of the updated traffic analysis and includes suggested air quality mitigation measures from the South Coast Air Quality Management District. These revisions do not introduce any new impacts and do not trigger the need to recirculate the Draft MND for public review per CEQA Guidelines Section 15073.5. ALTERNATIVES x Council may elect to adopt the MND and approve the SPA, TPM and SDP, with the conditions of approval as presented, or with modified conditions of approval. x Council may elect not to adopt the MND and not to approve the SPA, TPM and SDP, which would leave SP 1998-034 Amendment No. 1 effective over the project site and a commercial shopping center project could be developed under that 2002 entitlement. 146 x Council may continue the public hearing and provide further direction on the design of the project. x Council may refer the application back to Planning Commission, although not required, for their review before returning to Council for final approval. Prepared by: Cheri Flores, Planning Manager Approved by: Danny Castro, Design and Development Director Attachments: 1. Specific Plan Modifications 2. Entitlement Plan Set 3. Colors and Materials Sample Exhibit 147 148 CITY COUNCIL RESOLUTION 2020 - A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF LA QUINTA, CALIFORNIA, TO ADOPT A MITIGATED NEGATIVE DECLARATION FOR THE PAVILION PALMS SHOPPING CENTER LOCATED AT THE NORTHWEST CORNER OF JEFFERSON STREET AND AVENUE 50. CASE NUMBER: ENVIRONMENTAL ASSESSMENT 2017-0006 APPLICANT: LUNDIN DEVELOPMENT COMPANY WHEREAS the City Council of the City of La Quinta, California did, on the 7th day of July, 2020, hold a duly noticed Public Hearing to consider a request by Lundin Development Company for approval of the Pavilion Palms Shopping Center consisting of approximately 125,800 sq. ft., generally located at the northwest corner of Jefferson Street and Avenue 50 more particularly described as: APN 602-180-004 WHEREAS, the Design and Development Department published a public hearing notice in The Desert Sun newspaper on June 26, 2020 as prescribed by the Municipal Code. Public hearing notices were also mailed to all property owners within 500 feet of the site; and WHEREAS, the City Council of the City of La Quinta, California did previously hold a duly noticed Public Hearing on May 5, 2020, to consider this project and continued the Public Hearing, at the applicant’s request, to allow the applicant additional time to revise the site plan and prepare the revised application package; and WHEREAS, the City Council of the City of La Quinta, California did previously hold a duly noticed Public Hearings on February 4 and March 3, 2020, to consider this project and continued the Public Hearing, to allow the applicant time to revise the site plan; and WHEREAS, the Planning Commission of the City of La Quinta, California did, on the 10th day of December, 2019, hold a duly noticed Public Hearing where the Planning Commission recommended approval of this project; and 149 City Council Resolution 2020 - Environmental Assessment 2017-0006 Pavilion Palms Shopping Center July 7, 2020 Page 2 of 4 WHEREAS, the Planning Commission of the City of La Quinta, California did previously hold a duly noticed Public Hearing on October 8, 2019 to consider this project and continued the Public Hearing, to allow the applicant time to revise the site plan; and WHEREAS, the Planning Commission of the City of La Quinta, California did previously hold a duly noticed Public Hearing on June 26, 2018 to consider this project and continued the Public Hearing, to allow the applicant time to revise the traffic study and include an analysis of other intersections in the area; and WHEREAS, Environmental Assessment 1998-375 was adopted by the City Council on May 18th, 1999 (City Council Resolution 1999-62) and analyzed the original project consisting of an approximate 110,000 sq. ft. shopping center, in compliance with the requirements of the California Environmental Quality Act (CEQA); and WHEREAS, an addendum to Environmental Assessment 1998-375 was prepared in compliance with the requirements of the CEQA and approved by the City Council on February 19, 2002 (City Council Resolution 2002-30), which analyzed an amendment to the project reducing the size of the shopping center to approximately 100,460 sq. ft.; and WHEREAS, the Design and Development Department has prepared Environmental Assessment 2017-0006 for this project, in compliance with the requirements of the CEQA, and determined that the project was substantially similar to the original project and amendment but that one or more conditions of CEQA Guidelines Section 15162 had been met requiring a subsequent analysis and determined that a Mitigated Negative Declaration (MND) be prepared to analyze the difference in impacts from the originally adopted MND (Environmental Assessment 1998-375) and subsequent addendum to the currently proposed project. The Design and Development Director has determined that although the proposed project could have a significant effect on the environment, there will not be a significant effect because revisions in the project have been made by or agreed to by the project proponent and mitigation measures have been incorporated; and WHEREAS, at said Public Hearing, upon hearing and considering all testimony and arguments, if any, of all interested persons desiring to be 150 City Council Resolution 2020 - Environmental Assessment 2017-0006 Pavilion Palms Shopping Center July 7, 2020 Page 3 of 4 heard, said City Council did make the following mandatory findings pursuant to Section 9.250.010 of the Municipal Code to justify approval of Environmental Assessment 2017-0006: 1. As conditioned, proposed application will not be detrimental to the health, safety, or general welfare of the community, either indirectly, or directly, in that no significant unmitigated impacts were identified by Environmental Assessment 2017-0006. 2. The proposed project will not have the potential to degrade the quality of the environment, substantially reduce the habitat of a fish or wildlife population to drop below self-sustaining levels, threaten to eliminate a plant or animal community, reduce the number or restrict the range of rare or endangered plants or animals or eliminate important examples of the major periods of California history or prehistory. Potential impacts can be mitigated to a less than significant level. 3. There is no evidence before the City that the proposed project will have the potential for an adverse effect on wildlife resources of the habitat on which the wildlife depends. 4. The proposed project will not result in impacts which are individually limited or cumulatively considerable when considering planned or proposed development in the immediate vicinity. Impacts which are individually limited or cumulatively considerable can be mitigated to be less than significant. 5. The proposed project will not have environmental effects that will adversely affect the human population, either directly or indirectly. Impacts associated with noise and air quality can be mitigated to be less than significant. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of La Quinta, California, as follows: SECTION 1. That the above recitations are true and constitute the Findings of the City Council in this case; 151 City Council Resolution 2020 - Environmental Assessment 2017-0006 Pavilion Palms Shopping Center July 7, 2020 Page 4 of 4 SECTION 2. That the City Council does hereby adopt Environmental Assessment 2017-0006. PASSED, APPROVED, and ADOPTED at a regular meeting of the City of La Quinta City Council, held on this the 7TH day of July, 2020, by the following vote: AYES: NOES: ABSENT: ABSTAIN: ________________________________ LINDA EVANS, Mayor City of La Quinta, California ATTEST: _________________________________________ MONIKA RADEVA, City Clerk City of La Quinta, California APPROVED AS TO FORM: _________________________________________ WILLIAM IHRKE, City Attorney City of La Quinta, California 152 ,QLWLDO6WXG\0LWLJDWHG1HJDWLYH'HFODUDWLRQ IRUWKH )DLUZD\3OD]D6SHFLILF3ODQ $PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU /D4XLQWD&$ ($ 3UHSDUHGIRU /HDG$JHQF\ &LW\RI/D4XLQWD &DOOH7DPSLFR /D4XLQWD&$ 3UHSDUHGE\ -HULFKR6\VWHPV,QF 1)LUVW6WUHHWVW6WUHHW 5HGODQGV&$ 0DUFK 153 [this page left intentionally blank] 154 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJHL 7$%/(2)&217(176 6(&7,21,1752'8&7,21 6(&7,21±5(*8/$725<)5$0(:25. 6(&7,21'(7$,/('352-(&7'(6&5,37,21 6(&7,21(19,5210(17$/&+(&./,67)250 ,$(67+(7,&6 ,,$*5,&8/785($1')25(675<5(6285&(6 ,,,$,548$/,7< ,9%,2/2*,&$/5(6285&(6 9&8/785$/5(6285&(6 9,*(2/2*<$1'62,/6 9,,*5((1+286(*$6(0,66,216 9,,,+$=$5'6$1'+$=$5'2860$7(5,$/6 ,;+<'52/2*<$1':$7(548$/,7< ;/$1'86($1'3/$11,1* ;,0,1(5$/5(6285&(6 ;,,12,6( ;,,,3238/$7,21$1'+286,1* ;,938%/,&6(59,&(6 ;95(&5($7,21 ;9,75$163257$7,2175$)),& ;9,,75,%$/&8/785$/5(6285&(6 ;9,,,87,/,7,(6$1'6(59,&(6<67(06 6(&7,216800$5<2)0,7,*$7,210($685(6 6(&7,215()(5(1&(6 ),*85(6 )LJXUH5HJLRQDO2YHUYLHZ )LJXUH6LWH/RFDWLRQ )LJXUH6LWH3ODQ 155 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($INITIAL STUDY 3DJHLL 7$%/(6 7DEOH3URSRVHG6LWH3ODQ 7DEOH6XPPHU&RQVWUXFWLRQ(PLVVLRQV6XPPDU\3RXQGVSHU'D\ 7DEOH:LQWHU&RQVWUXFWLRQ(PLVVLRQV6XPPDU\3RXQGVSHU'D\ 7DEOH6XPPHU2SHUDWLRQDO(PLVVLRQV6XPPDU\3RXQGVSHU'D\ 7DEOH:LQWHU2SHUDWLRQDO(PLVVLRQV6XPPDU\3RXQGVSHU'D\ 7DEOH/RFDOL]HG6LJQLILFDQFH7KUHVKROGV3RXQGVSHU'D\ 7DEOH*UHHQKRXVH*DV&RQVWUXFWLRQ(PLVVLRQV0HWULF7RQVSHU<HDU 7DEOH*UHHQKRXVH*DV2SHUDWLRQDO(PLVVLRQV0HWULF7RQVSHU<HDU 7DEOH&RQVWUXFWLRQ(TXLSPHQW1RLVH(PLVVLRQ/HYHOV 7DEOH9LEUDWLRQ6RXUFH/HYHOVIRU7\SLFDO&RQVWUXFWLRQ(TXLSPHQW 7DEOH([LVWLQJDQG3URMHFWHG)XWXUH2SHUDWLRQDO1RLVH 7DEOH([LVWLQJ&RQGLWLRQV±$YHQXHDW-HIIHUVRQ6WUHHW 7DEOH2SHQLQJ'D\±:LWK3URMHFW±$YHQXHDW-HIIHUVRQ6WUHHW 7DEOH)XWXUH%XLOGRXW<HDU±:LWK3URMHFW±$YHQXHDW-HIIHUVRQ6WUHHW $33(1',&(6 $SSHQGL[$6LWH/LJKWLQJ3ODQ $SSHQGL[%$LU4XDOLW\0RGHO5HVXOWV $SSHQGL[&%LRORJLFDO5HVRXUFHV5HSRUW $SSHQGL['&XOWXUDO5HVRXUFHV5HSRUW $SSHQGL[(1RLVH6WXG\ $SSHQGL[)7UDIILF6WXGLHV $SSHQGL[*&LW\RI/D4XLQWD(QJLQHHULQJ%XOOHWLQ 156 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 6(&7,21,1752'8&7,21 %DFNJURXQG /D4XLQWDLVDUHVRUWFLW\LQWKH&RDFKHOOD9DOOH\RI5LYHUVLGH&RXQW\ORFDWHGEHWZHHQ,QGLDQ:HOOVDQG ,QGLR$VRIWKHFHQVXVWKHSRSXODWLRQZDVDSSUR[LPDWHO\XSIURPWKHFHQVXVZKLFK UHFRUGHGDSSUR[LPDWHO\ 7KHFLW\OLPLWVHQFRPSDVVDSSUR[LPDWHO\PLOHVDQGDUHJHQHUDOO\ERXQGHGRQWKHZHVWE\:DVKLQJWRQ 6WUHHWDQGWKH6DQWD5RVD0RXQWDLQVRQWKHQRUWKE\ODQGVVRXWKRI+RYOH\/DQH(DVWRQWKHHDVWE\ -HIIHUVRQ6WUHHWDQG0RQURH6WUHHWDQGRQWKHVRXWKE\$YHQXHDQG$YHQXH)LJXUH 7RSRJUDSKLFDOO\WKH&LW\LVVLWXDWHGRQDIODWYDOOH\IORRUVXUURXQGHGE\ORZPRXQWDLQVIRRWKLOOVDQG DOOXYLDOIDQVFKDUDFWHULVWLFRIWKHGHVHUWHQYLURQPHQW7KHYDOOH\IORRULVWKHVLWHRIPRVWRIWKH&LW\¶V GHYHORSHGDUHDVZKLOHVXUURXQGLQJPRXQWDLQVDQGIRRWKLOOVKDYHEHHQGHVLJQDWHGDQGDUHUHWDLQHGDV RSHQVSDFH7KH&LW\KDVKLVWRULFDOO\FRQWDLQHGODUJHDUHDVRIDJULFXOWXUHRQWKHYDOOH\IORRUEXWWKLVKDV FKDQJHGLQUHFHQW\HDUVZLWKLQFUHDVHGXUEDQL]DWLRQ'HYHORSPHQWZLWKLQWKH&LW\OLPLWVLVQRZSULPDULO\ UHVLGHQWLDOFRPPHUFLDODQGUHVRUWRULHQWHG7HUUD1RYD-XO\ +Z\DPDMRUWKRURXJKIDUHWKDWSURYLGHVDFFHVVWRPRVWRIWKHFLWLHVLQWKH&RDFKHOOD9DOOH\ELVHFWV WKHFLW\¶VQRUWKHUQSRUWLRQ$PDMRULW\RIWKHPDMRUFRPPHUFLDODQGUHVRUWIDFLOLWLHVDUHIRXQGDORQJ+Z\ ZLWKWKHUHPDLQGHURIWKHFLW\GHVLJQHGIRUUHVLGHQWLDODQGOLJKWFRPPHUFLDOUHWDLO ,Q0D\WKH&LW\RI/D4XLQWDDSSURYHGWKH)DLUZD\3OD]D6KRSSLQJ&HQWHU6SHFLILF3ODQRI/DQG 8VHDQGDVVRFLDWHGSDUFHOPDSWRDOORZIRUWKHGHYHORSPHQWRIVTXDUHIHHWRIDVXSHUPDUNHW DQFKRUHGVKRSSLQJFHQWHUZLWKDGMDFHQWUHWDLOSDGVRQDFUHVDWWKHQRUWKZHVWFRUQHURI-HIIHUVRQ 6WUHHWDQGWK$YHQXH7KHSDUFHOLVGHVLJQDWHGDQG]RQHGIRU&RPPXQLW\&RPPHUFLDO&&XVH7KH 6SHFLILF3ODQDGRSWLRQLQFOXGHGDGRSWLRQRID0LWLJDWHG1HJDWLYH'HFODUDWLRQ,QDQDPHQGPHQWWR WKH6SHFLILF3ODQZDVDOVRDGRSWHG7RGDWHWKDWSURMHFWKDVQRWEHHQFRQVWUXFWHG 2Q)HEUXDU\WKH&LW\RI/D4XLQWDDGRSWHGWKH(QYLURQPHQWDO,PSDFW5HSRUW(,5IRULWV *HQHUDO3ODQ6&+ZKLFKLQFOXGHGWKHLPSDFWVRIDGGLQJWRFRPPHUFLDOXVHVZLWKLQWKH &LW\LQFOXGLQJWKHDSSURYHG)DLUZD\3OD]D6KRSSLQJ&HQWHU6SHFLILF3ODQ$6WDWHPHQWRI2YHUULGLQJ &RQVLGHUDWLRQVZDVDOVRDGRSWHGIRUHQYLURQPHQWDOLPSDFWVWKDWFRXOGQRWEHPLWLJDWHGWRDOHYHOEHORZ VLJQLILFDQFHIRU$LU4XDOLW\*UHHQKRXVH*DVDQG7UDIILF5HVROXWLRQ &XUUHQWO\WKH/XQGLQ'HYHORSPHQWLVUHTXHVWLQJWKH&LW\WRDXWKRUL]H$PHQGPHQW1RWRWKH)DLUZD\ 3OD]D6SHFLILF3ODQWRFKDQJHWKHQDPHRIWKHDSSURYHG6SHFLILF3ODQWR³3DYLOLRQ3DOPV´DQGFRQVWUXFWD WRWDORIVTXDUHIHHWRIDVXSHUPDUNHWDQFKRUHGVKRSSLQJFHQWHUDQGDGMDFHQWUHWDLOSDGVRQWKH DFUHVLWHDWWKHFRUQHURI-HIIHUVRQ6WUHHWDQGWK$YHQXHZLWKLQWKHVDPHDUHDRIWKHSUHYLRXVO\ DSSURYHG)DLUZD\3OD]D6SHFLILF3ODQDQGLWVVXEVHTXHQWDPHQGPHQW$PHQGPHQW1RZRXOGDGG VTXDUHIHHWRIUHWDLODQGDQFLOODU\XVHV3URSRVHGXVHVZLWKLQWKHFRPPHUFLDOFHQWHUGHYHORSPHQW DUHVLPLODUWRWKHSUHYLRXVO\DSSURYHGSODQDQGLQFOXGHEDQNVUHVWDXUDQWVJDVROLQHVHUYLFHVWDWLRQDQG JURFHU\VWRUH)LJXUH 157 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 6(&7,21±5(*8/$725<)5$0(:25. 7KH&LW\RI/D4XLQWDKDVLGHQWLILHGWKDWWKH3DYLOLRQ3DOPV6KRSSLQJ&HQWHU3URMHFWPHHWVWKH&DOLIRUQLD (QYLURQPHQWDO4XDOLW\$FW&(4$*XLGHOLQHV6HFWLRQGHILQLWLRQRID3URMHFW&(4$*XLGHOLQHV 6HFWLRQGHILQHVD3URMHFWDVWKHIROORZLQJ D3URMHFWPHDQVWKHZKROHRIDQDFWLRQZKLFKKDVDSRWHQWLDOIRUUHVXOWLQJLQHLWKHUD GLUHFWSK\VLFDOFKDQJHLQWKHHQYLURQPHQWRUDUHDVRQDEO\IRUHVHHDEOHLQGLUHFWSK\VLFDO FKDQJHLQWKHHQYLURQPHQW 7KLVGRFXPHQWLVDQ,QLWLDO6WXG\0LWLJDWHG1HJDWLYH'HFODUDWLRQ,601'SUHSDUHGLQDFFRUGDQFHZLWK WKH&DOLIRUQLD(QYLURQPHQWDO4XDOLW\$FW&(4$LQFOXGLQJDOOFULWHULDVWDQGDUGVDQGSURFHGXUHVRI &(4$&DOLIRUQLD3XEOLF5HVRXUFH&RGH6HFWLRQHWVHTDQGWKH&(4$*XLGHOLQHV&DOLIRUQLD &RGHRI5HJXODWLRQV7LWOH'LYLVLRQ&KDSWHU6HFWLRQHWVHT 7KLV,601'LVDQLQIRUPDWLRQDOGRFXPHQWLQWHQGHGIRUXVHE\WKH&LW\RI/D4XLQWD&LW\&RXQFLODQG 5HVSRQVLEOHDJHQFLHVDQGPHPEHUVRIWKHJHQHUDOSXEOLFLQHYDOXDWLQJWKHSK\VLFDOHQYLURQPHQWDOHIIHFWV RIWKHSURSRVHG3URMHFW,WZDVFRPSLOHGE\WKH&LW\RI/D4XLQWDZLWKWKHDVVLVWDQFHRI-HULFKR6\VWHPV ,QF-HULFKR7KH&LW\RI/D4XLQWDLVVHUYLQJDVWKH/HDG$JHQF\IRUWKHSURSRVHG3URMHFWSXUVXDQWWR &(4$DQG&(4$*XLGHOLQHV$UWLFOHDQG³/HDG$JHQF\´UHIHUVWRWKHSXEOLFDJHQF\ WKDWKDVWKHSULQFLSDOUHVSRQVLELOLW\IRUFDUU\LQJRXWRUDSSURYLQJD3URMHFW 2UJDQL]DWLRQRIWKH,QLWLDO6WXG\ 7KH,QLWLDO6WXG\LVRUJDQL]HGDVIROORZV ,QWURGXFWLRQ 3URYLGHV WKH UHJXODWRU\ FRQWH[W IRU WKH UHYLHZ DORQJ D EULHI VXPPDU\ RI WKH &(4$ SURFHVV 3URMHFW,QIRUPDWLRQ3URYLGHVIXQGDPHQWDO3URMHFWLQIRUPDWLRQVXFKDVWKH3URMHFWGHVFULSWLRQ3URMHFW ORFDWLRQDQGILJXUHV /HDG$JHQF\'HWHUPLQDWLRQ,GHQWLILHVHQYLURQPHQWDOIDFWRUVSRWHQWLDOO\DIIHFWHGE\WKH3URMHFWDQG LGHQWLILHVWKH/HDG$JHQF\ VGHWHUPLQDWLRQEDVHGRQWKHLQLWLDOHYDOXDWLRQ 0LWLJDWHG 1HJDWLYH 'HFODUDWLRQ 3UHSDUHG ZKHQ D GHWHUPLQDWLRQ FDQ EH PDGH WKDW QR VLJQLILFDQW HQYLURQPHQWDOHIIHFWVZLOORFFXUEHFDXVHUHYLVLRQVWRWKH3URMHFWKDYHEHHQPDGHRUPLWLJDWLRQPHDVXUHV ZLOOEHLPSOHPHQWHGZKLFKZLOOUHGXFHDOOSRWHQWLDOO\VLJQLILFDQWLPSDFWVWROHVVWKDQVLJQLILFDQWOHYHOV 0LWLJDWLRQ 0RQLWRULQJ 3URJUDP 7DEOH ,GHQWLILHV REMHFWLYHV FULWHULD DQG VSHFLILF SURFHGXUHV WR DGPLQLVWHUWKH6%9:&'¶VUHVSRQVLELOLWLHVXQGHU&(4$ (YDOXDWLQJ(QYLURQPHQWDO,PSDFWV3URYLGHVWKHSDUDPHWHUVWKH6%9:&'XVHVZKHQGHWHUPLQLQJ OHYHORILPSDFW &(4$&KHFNOLVW3URYLGHVDQHQYLURQPHQWDOFKHFNOLVWDQGDFFRPSDQ\LQJDQDO\VLVIRUUHVSRQGLQJWR FKHFNOLVWTXHVWLRQV 5HIHUHQFHV,QFOXGHVDOLVWRIUHIHUHQFHVDQGYDULRXVUHVRXUFHVXWLOL]HGLQSUHSDULQJWKHDQDO\VLV 158 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 6(&7,21'(7$,/('352-(&7'(6&5,37,21 ,QWURGXFWLRQ /XQGLQ'HYHORSPHQWDSULYDWHHQWLW\LVUHTXHVWLQJDXWKRUL]DWLRQIURPWKH&LW\RI/D4XLQWDWRDPHQGWKH SUHYLRXVO\DSSURYHG)DLUZD\6SHFLILF3ODQE\FKDQJLQJWKHQDPHWR³3DYLOLRQ3DOPV´DQGFRQVWUXFWLQJD WRWDORIVTXDUHIRRWPL[HGXVHFRPPHUFLDOFHQWHUGHYHORSPHQWSURMHFWRQWKHDFUHYDFDQW SDUFHODWWKHLQWHUVHFWLRQRI-HIIHUVRQ6WUHHWDQG$YHQXHLQWKH&LW\RI/D4XLQWD$PHQGPHQW1R ZRXOGDGGVTXDUHIHHWRIUHWDLODQGDQFLOODU\XVHVWRWKHVTXDUHIHHWSUHYLRXVO\DSSURYHG 3URSRVHGXVHVZLWKLQWKHFRPPHUFLDOFHQWHUGHYHORSPHQWLQFOXGHWKHVDPHXVHVDVSUHYLRXVO\DSSURYHG LQFOXGLQJEDQNVUHVWDXUDQWVJDVROLQHVHUYLFHVWDWLRQDQGJURFHU\VWRUH)LJXUH 7KHVLWH]RQLQJLV&RPPXQLW\&RPPHUFLDOZKLFKDOORZVIRUD0D[LPXP)ORRU$UHD5DWLR>)$5@ JURVVIORRUDUHDRIDOOEXLOGLQJVGLYLGHGE\WKHEXLOGLQJVLWHDUHD7KHDPHQGHG3URMHFWZLWKWKH VTXDUHIHHWUHSUHVHQWVDSSUR[LPDWHO\)$5EHORZWKHPD[LPXPDOORZHGXQGHUWKH&LW\¶V*HQHUDO 3ODQ 7KH$VVHVVRU3DUFHO1XPEHUVIRUWKLV3URMHFWDUH$31V DQG 3HU WKH &LW\ RI /D 4XLQWD *HQHUDO 3ODQ WKH 3URMHFW VLWH LV ]RQHG &RPPXQLW\&RPPHUFLDO&&IRUFRPPHUFLDOXVH 7KHVLWHLVERUGHUHGRQWKHQRUWKE\'HUHN$ODQ'ULYHDQGUHVLGHQWLDOGHYHORSPHQWWKDWIURQWV'HUHN $ODQ'ULYHRQWKHZHVWE\UHVLGHQWLDOGHYHORSPHQWWKDWIURQWV-HVV$QQH'ULYHRQWKHHDVWE\ -HIIHUVRQ 6WUHHW DQG FRPPHUFLDO GHYHORSPHQW DQG RQ WKH VRXWK E\ $YHQXH DQG UHVLGHQWLDO GHYHORSPHQW 'HWDLOHG3URMHFW'HVFULSWLRQ 6LWH3ODQ 7KH3URMHFWVLWHFRQVLVWVRIILYHSDUFHOVWKDWWRWDODSSUR[LPDWHO\DFUHV7KHSURSRVHG3URMHFWZLOOEH DQFKRUHGE\3DYLOLRQVJURFHU\VWRUHDQGLQFOXGHVUHVWDXUDQWVEDQNVDQGUHWDLOXQLWVDVZHOODVDIXHO FHQWHUFRQYHQLHQFHPDUNHW,QWRWDOWKHSURSRVHGGHYHORSPHQWZRXOGSURYLGHDSSUR[LPDWHO\ VTXDUHIHHWVIRIJURVVIORRUDUHDZKLFKLVGHWDLOHGE\EXLOGLQJDQGSURSRVHGXVHLQ7DEOH &RQVWUXFWLRQ6FHQDULR 7KH VLWH LV FXUUHQWO\ YDFDQW VR QR GHPROLWLRQ RI H[LVWLQJ VWUXFWXUHV DUH QHFHVVDU\ 7KH SURMHFW LV DQWLFLSDWHGWREHFRQVWUXFWHGDQGRSHQHGWRWKHSXEOLFLQDSSUR[LPDWHO\WZR\HDUV)RUWKLVDQDO\VLVWKH SURMHFWRSHQLQJGD\LVDVVXPHGWREHLQWKH\HDU *UDGLQJ 7KHVLWHLVUHODWLYHO\IODWDQGFRQWDLQVVSDUVHGHVHUWVFUXE6RLOEDODQFLQJZLOOEHXVHGGXULQJJUDGLQJVR WKDWWKHUHZLOOEHQRVRLOLPSRUWRUH[SRUW7KHGHVHUWVFUXEEUXVKRQVLWHZLOOEHUHPRYHGRUEXULHG GHSHQGLQJRQVL]HDQGW\SH 159 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 6LWH8WLOLWLHV $OOXWLOLWLHVDUHDYDLODEOHIRUFRQQHFWLRQIURPWKHPDLQOLQHVORFDWHGZLWKLQWKHSDYHGULJKWVRIZD\DORQJ -HIIHUVRQ6WUHHWDQG$YHQXH 6LWH,QJUHVV(JUHVV'HYHORSPHQW $FFHVVWRWKH3URMHFWLVSURSRVHGYLDILYHGULYHZD\VODEHOHG$(LQ)LJXUHWZRWRWKHVRXWKRQ $YHQXHWZRWRWKHHDVWRQ-HIIHUVRQ6WUHHWDQGRQHWRWKHQRUWKRQ'HUHN$ODQ'ULYH 7DEOH 3URSRVHG6LWH3ODQ 160 &LW\RI/D4XLQWD)DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH)LJXUH5HJLRQDO2YHUYLHZ161 &LW\RI/D4XLQWD)DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH)LJXUH6LWH/RFDWLRQ162 &LW\RI/D4XLQWD)DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJHFigure 3 Site Plan 163 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 6HFWLRQ(QYLURQPHQWDO&KHFNOLVW)RUP 3URMHFW7LWOH 3DYLOLRQ3DOPV6KRSSLQJ&HQWHU /HDG$JHQF\ 1DPH &LW\RI/D4XLQWD $GGUHVV&DOOH7DPSLFR /D4XLQWD&$ &RQWDFW3HUVRQ&KHUL)ORUHV6HQLRU3ODQQHU &LW\RI/D4XLQWD &DOOH7DPSLFR /D4XLQWD&$ 3KRQH1XPEHU 3URMHFW/RFDWLRQ$VVHVVRU3DUFHO1XPEHUV DQG ,QWHUVHFWLRQRI-HIIHUVRQ6WUHHWDQG$YHQXH 3URMHFW6SRQVRU¶V /XQGLQ'HYHORSPHQW 1DPHDQG$GGUHVV 3DFLILF&RDVW+LJKZD\6XLWH +XQWLQJWRQ%HDFK&$ *HQHUDO3ODQ'HVLJQDWLRQ*HQHUDO&RPPHUFLDO*& =RQLQJ &RPPXQLW\&RPPHUFLDO&& 3URMHFW'HVFULSWLRQ6XPPDU\ /XQGLQ'HYHORSPHQWDSULYDWHHQWLW\LVUHTXHVWLQJDXWKRUL]DWLRQIURPWKH&LW\RI/D4XLQWDWRDPHQGWKH SUHYLRXVO\ DSSURYHG )DLUZD\ 3OD]D 6SHFLILF 3ODQ E\ FKDQJLQJ WKH QDPH WR ³3DYLOLRQ 3DOPV´ DQG FRQVWUXFWLQJDWRWDORIVTXDUHIRRWPL[HGXVHFRPPHUFLDOFHQWHUGHYHORSPHQWSURMHFWRQWKH DFUH YDFDQW SDUFHO DW WKH LQWHUVHFWLRQ RI -HIIHUVRQ 6WUHHW DQG$YHQXH LQ WKH &LW\ RI /D 4XLQWD $PHQGPHQW1RZRXOGDGGVTXDUHIHHWRIUHWDLODQGDQFLOODU\XVHVWRWKHVTXDUHIHHW SUHYLRXVO\DSSURYHG3URSRVHGXVHVZLWKLQWKHFRPPHUFLDOFHQWHUGHYHORSPHQWLQFOXGHWKHVDPHXVHVDV SUHYLRXVO\DSSURYHGLQFOXGLQJEDQNVUHVWDXUDQWVJDVROLQHVHUYLFHVWDWLRQDQGJURFHU\VWRUH)LJXUH 7KHVLWHLVGHVLJQDWHGDQG]RQHGIRU&RPPXQLW\&RPPHUFLDO&&XVH7KHSURSRVHG3URMHFWZLOOEH DQFKRUHGE\3DYLOLRQVJURFHU\VWRUHDQGLQFOXGHVUHVWDXUDQWVEDQNVDQGUHWDLOXQLWVDVZHOODVDIXHO FHQWHUFRQYHQLHQFHPDUNHW 7KHSURMHFWLVDQWLFLSDWHGWREHFRQVWUXFWHGDQGRSHQHGWRWKHSXEOLFLQDSSUR[LPDWHO\WZR\HDUV)RUWKLV DQDO\VLVWKHSURMHFWRSHQLQJGD\LVDVVXPHGWREHLQWKH\HDU 3ULRUDSSURYDOVIRUWKLVVLWHLQFOXGHWKH)DLUZD\3OD]D6KRSSLQJ&HQWHU6SHFLILF3ODQDQGDVVRFLDWHG $PHQGPHQW1RZKLFKZDVDSSURYHGE\WKH&LW\RI/D4XLQWDLQDQGUHVSHFWLYHO\7KDW SODQLGHQWLILHGWKHGHYHORSPHQWRIVTXDUHIHHWRIDVXSHUPDUNHWDQFKRUHGVKRSSLQJFHQWHUZLWK DGMDFHQWUHWDLOSDGVRQDFUHVDWWKHFRUQHURI-HIIHUVRQ6WUHHWWK$YHQXH7KHDQG 164 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 6SHFLILF3ODQDGRSWLRQLQFOXGHGDGRSWLRQRID0LWLJDWHG1HJDWLYH'HFODUDWLRQ7KDWSURMHFWZDVQRW FRQVWUXFWHG 2Q)HEUXDU\WKH&LW\RI/D4XLQWDDGRSWHGWKH(QYLURQPHQWDO,PSDFW5HSRUW(,5IRULWV *HQHUDO3ODQ6&+ZKLFKLQFOXGHGWKHLPSDFWVRIDGGLQJWRFRPPHUFLDOXVHVZLWKLQWKH &LW\LQFOXGLQJWKHDSSURYHG)DLUZD\3OD]D6KRSSLQJ&HQWHU6SHFLILF3ODQ$6WDWHPHQWRI2YHUULGLQJ &RQVLGHUDWLRQVZDVDOVRDGRSWHGIRUHQYLURQPHQWDOLPSDFWVWKDWFRXOGQRWEHPLWLJDWHGWRDOHYHOEHORZ VLJQLILFDQFHIRU$LU4XDOLW\*UHHQKRXVH*DVDQG7UDIILF5HVROXWLRQ 7KH3URSRVHG3URMHFWUHSUHVHQWV$PHQGPHQW1RWRWKHH[LVWLQJDSSURYHG6SHFLILF3ODQ 6XUURXQGLQJ/DQG8VHVDQG6HWWLQJ 7KHVLWHLVORFDWHGRQDYDFDQWSDUFHODWWKHLQWHUVHFWLRQRI-HIIHUVRQ6WUHHWDQG$YHQXHLQWKH&LW\RI /D4XLQWD3URSRVHGXVHVZLWKLQWKHFRPPHUFLDOFHQWHUGHYHORSPHQWLQFOXGHEDQNVUHVWDXUDQWVJDVROLQH VHUYLFHVWDWLRQDQGJURFHU\VWRUH)LJXUH7KHVLWHLVERUGHUHGRQWKHQRUWKE\'HUHN$ODQ'ULYH DQGUHVLGHQWLDOGHYHORSPHQWWKDWIURQWV'HUHN$ODQ'ULYHRQWKHZHVWE\DODUJHUHWHQWLRQEDVLQZLWK UHVLGHQWLDOGHYHORSPHQWZHVWRIWKHUHWHQWLRQEDVLQRQWKHHDVWE\-HIIHUVRQ6WUHHWDQGFRPPHUFLDO GHYHORSPHQWZLWKLQWKH&LW\RI,QGLRDQGRQWKHVRXWKE\$YHQXHDQGUHVLGHQWLDOGHYHORSPHQW /HDG$JHQF\'LVFUHWLRQDU\$FWLRQV 'LVFUHWLRQDU\DFWLRQVWKDWPD\EHWDNHQE\WKH/HDG$JHQF\LQFOXGHEXWDUHQRWOLPLWHGWRWKHIROORZLQJ x*UDGLQJ3ODQDSSURYDO x$SSURYDORIDQ$PHQGPHQWWR63)DLUZD\3OD]D6SHFLILF3ODQ63 x$SSURYDORI7HQWDWLYH3DUFHO0DS730 x$SSURYDORI6LWH'HYHORSPHQW3HUPLW6'3 2WKHUDJHQFLHVZKRVHDSSURYDOLVUHTXLUHGHJSHUPLWVILQDQFLQJDSSURYDORUSDUWLFLSDWLRQ DJUHHPHQW &RQVWUXFWLRQ&RPSOLDQFH±6WRUPZDWHU'LVFKDUJH&RQVWUXFWLRQSURMHFWVWKDWGLVWXUEDFUHRIODQG RU PRUH DUH UHTXLUHG WR REWDLQ FRYHUDJH XQGHU WKH 13'(6 *HQHUDO 3HUPLW IRU &RQVWUXFWLRQ $FWLYLWLHV*HQHUDO&RQVWUXFWLRQ3HUPLWZKLFKUHTXLUHVWKHDSSOLFDQWWRILOHDQRWLFHRILQWHQW 12,WRGLVFKDUJHVWRUPZDWHUDQGWRSUHSDUHDQGLPSOHPHQWD6:3337KH6:333LQFOXGHVDQ RYHUYLHZRIWKH%HVW0DQDJHPHQW3UDFWLFHV%03VWKDWZRXOGEHLPSOHPHQWHGWRSUHYHQWVRLO HURVLRQDQGGLVFKDUJHRIRWKHUFRQVWUXFWLRQUHODWHGSROOXWDQWVWKDWFRXOGFRQWDPLQDWHQHDUE\ZDWHU UHVRXUFHV )HGHUDO6WDWHDQG/RFDOSHUPLWVIRUWKHIXHOVWDWLRQDVUHTXLUHG +DYH&DOLIRUQLD1DWLYH$PHULFDQWULEHVWUDGLWLRQDOO\DQGFXOWXUDOO\DIILOLDWHGZLWKWKHSURMHFW DUHDUHTXHVWHGFRQVXOWDWLRQSXUVXDQWWR3XEOLF5HVRXUFHV&RGHVHFWLRQ",IVRKDV FRQVXOWDWLRQEHJXQ" 1RWH &RQGXFWLQJ FRQVXOWDWLRQ HDUO\ LQ WKH &(4$ SURFHVV DOORZVWULEDO JRYHUQPHQWV OHDG DJHQFLHVDQGSURMHFWSURSRQHQWVWRGLVFXVVWKHOHYHORIHQYLURQPHQWDOUHYLHZLGHQWLI\DQGDGGUHVV SRWHQWLDO DGYHUVH LPSDFWV WR WULEDO FXOWXUDO UHVRXUFHV DQG UHGXFH WKH SRWHQWLDO IRU GHOD\ DQG FRQIOLFW LQ WKH HQYLURQPHQWDO UHYLHZ SURFHVV 6HH 3XEOLF 5HVRXUFHV &RGH VHFWLRQ 165 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH ,QIRUPDWLRQPD\DOVREHDYDLODEOHIURPWKH&DOLIRUQLD1DWLYH$PHULFDQ+HULWDJH&RPPLVVLRQ¶V 6DFUHG /DQGV )LOH SHU 3XEOLF 5HVRXUFHV &RGH VHFWLRQ DQG WKH &DOLIRUQLD +LVWRULFDO 5HVRXUFHV ,QIRUPDWLRQ 6\VWHP DGPLQLVWHUHG E\ WKH &DOLIRUQLD 2IILFH RI +LVWRULF 3UHVHUYDWLRQ 3OHDVHDOVRQRWHWKDW3XEOLF5HVRXUFHV&RGHVHFWLRQFFRQWDLQVSURYLVLRQVVSHFLILFWR FRQILGHQWLDOLW\ 7KH&LW\RI/D4XLQWDLQLWLDWHG$%SURFHVVEHJDQ2FWREHU/HWWHUVZHUHVHQWWRWULEHVRQ WKHOLVWUHFHLYHGIURPWKH1DWLYH$PHULFDQ+HULWDJH&RPPLVVLRQ 5HVSRQVHVZHUHUHFHLYHGIURP&DED]RQ%DQGRI0LVVLRQ,QGLDQV&DED]RQ$JXD&DOLHQWH%DQG RI &DKXLOOD ,QGLDQV $&%&, DQG 7ZHQW\1LQH 3DOPV %DQG RI 0LVVLRQ ,QGLDQV 7ZHQW\1LQH 3DOPV 7KH&XOWXUDO6WXG\IURP&507HFKZDVVHQWWR$&%&,DQG7ZHQW\1LQH3DOPVDVUHTXHVWHG %RWK$&%&,DQG7ZHQW\1LQH3DOPVDVNHGIRUDSSURYHG1DWLYH$PHULFDQ0RQLWRUVIURPWKH $&%&,DQG7ZHQW\1LQH3DOPVWREHSUHVHQWGXULQJJURXQGGLVWXUELQJDFWLYLWLHVRIWKHSURMHFW FRQVWUXFWLRQ 166 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($INITIAL STUDY 3DJH (QYLURQPHQWDO)DFWRUV3RWHQWLDOO\$IIHFWHG 7KHHQYLURQPHQWDOIDFWRUVFKHFNHGEHORZZRXOGEHSRWHQWLDOO\DIIHFWHGE\WKLVSURMHFWLQYROYLQJDWOHDVWRQHLPSDFW WKDWLVD3RWHQWLDOO\6LJQLILFDQW,PSDFWDVLQGLFDWHGE\WKHFKHFNOLVWRQWKHIROORZLQJSDJHV Ғ $HVWKHWLFV $JULFXOWXUHDQG)RUHVWU\5HVRXUFHV $LU4XDOLW\ %LRORJLFDO5HVRXUFHV &XOWXUDO5HVRXUFHV *HRORJ\6RLOV *UHHQKRXVH*DV(PLVVLRQV +D]DUGV +D]DUGRXV0DWHULDOV +\GURORJ\ :DWHU4XDOLW\ /DQG8VH3ODQQLQJ 0LQHUDO5HVRXUFHV 1RLVH 3RSXODWLRQ+RXVLQJ 3XEOLF6HUYLFHV 5HFUHDWLRQ 7UDQVSRUWDWLRQ7UDIILF 8WLOLWLHV6HUYLFH6\VWHPV 0DQGDWRU\)LQGLQJVRI 6LJQLILFDQFH 'HWHUPLQDWLRQ 7REHFRPSOHWHGE\WKH/HDG$JHQF\ 2QWKHEDVLVRIWKLVLQLWLDOHYDOXDWLRQWKHIROORZLQJILQGLQJLVPDGH 7KHSURSRVHGSURMHFW&28/'127KDYHDVLJQLILFDQWHIIHFWRQWKHHQYLURQPHQWDQGD1(*$7,9( '(&/$5$7,21ZLOOEHSUHSDUHG ; $OWKRXJKWKHSURSRVHGSURMHFWFRXOGKDYHDVLJQLILFDQWHIIHFWRQWKHHQYLURQPHQWWKHUHZLOOQRWEHD VLJQLILFDQWHIIHFWLQWKLVFDVHEHFDXVHUHYLVLRQVLQWKHSURMHFWKDYHEHHQPDGHE\RUDJUHHGWRE\WKH SURMHFWSURSRQHQW$0,7,*$7('1(*$7,9('(&/$5$7,21ZLOOEHSUHSDUHG 7KHSURSRVHGSURMHFW0$<KDYHDVLJQLILFDQWHIIHFWRQWKHHQYLURQPHQWDQGDQ(19,5210(17$/ ,03$&75(3257LVUHTXLUHG 7KHSURSRVHGSURMHFW0$<KDYHDSRWHQWLDOO\VLJQLILFDQWLPSDFWRUSRWHQWLDOO\VLJQLILFDQWXQOHVV PLWLJDWHGLPSDFWRQWKHHQYLURQPHQWEXWDWOHDVWRQHHIIHFWKDVEHHQDGHTXDWHO\DQDO\]HGLQDQ HDUOLHUGRFXPHQWSXUVXDQWWRDSSOLFDEOHOHJDOVWDQGDUGVDQGKDVEHHQDGGUHVVHGE\PLWLJDWLRQ PHDVXUHVEDVHGRQWKHHDUOLHUDQDO\VLVDVGHVFULEHGRQDWWDFKHGVKHHWV$Q(19,5210(17$/ ,03$&75(3257LVUHTXLUHGEXWLWPXVWDQDO\]HRQO\WKHHIIHFWVWKDWUHPDLQWREHDGGUHVVHG $OWKRXJKWKHSURSRVHGSURMHFWFRXOGKDYHDVLJQLILFDQWHIIHFWRQWKHHQYLURQPHQWEHFDXVHDOOSRWHQWLDOO\ VLJQLILFDQWHIIHFWVDKDYHEHHQDQDO\]HGDGHTXDWHO\LQDQHDUOLHU(,5RU1(*$7,9('(&/$5$7,21 SXUVXDQWWRDSSOLFDEOHVWDQGDUGVDQGEKDYHEHHQDYRLGHGRUPLWLJDWHGSXUVXDQWWRWKDWHDUOLHU(,5RU 1(*$7,9('(&/$5$7,21LQFOXGLQJUHYLVLRQVRUPLWLJDWLRQPHDVXUHVWKDWDUHLPSRVHGXSRQWKH SURSRVHGSURMHFWQRWKLQJIXUWKHULVUHTXLUHG 6LJQDWXUHSUHSDUHGE\-HULFKR6\VWHPV,QF 'DWH 6LJQDWXUH/HDG$JHQF\&LW\RI/D4XLQWD 'DWH 167 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH (9$/8$7,212)(19,5210(17$/,03$&76 $EULHIH[SODQDWLRQLVUHTXLUHGIRUDOODQVZHUVH[FHSW1R,PSDFWDQVZHUVWKDWDUHDGHTXDWHO\VXSSRUWHGE\ WKHLQIRUPDWLRQVRXUFHVDOHDGDJHQF\FLWHVLQWKHSDUHQWKHVHVIROORZLQJHDFKTXHVWLRQ$1R,PSDFW DQVZHULVDGHTXDWHO\VXSSRUWHGLIWKHUHIHUHQFHGLQIRUPDWLRQVRXUFHVVKRZWKDWWKHLPSDFWVLPSO\GRHVQRW DSSO\WRSURMHFWVOLNHWKHRQHLQYROYHGHJWKHSURMHFWIDOOVRXWVLGHDIDXOWUXSWXUH]RQH$1R,PSDFW DQVZHUVKRXOGEHH[SODLQHGZKHUHLWLVEDVHGRQSURMHFWVSHFLILFIDFWRUVDVZHOODVJHQHUDOVWDQGDUGVHJWKH SURMHFWZRXOGQRWH[SRVHVHQVLWLYHUHFHSWRUVWRSROOXWDQWVEDVHGRQDSURMHFWVSHFLILFVFUHHQLQJDQDO\VLV $OODQVZHUVPXVWWDNHDFFRXQWRIWKHZKROHDFWLRQLQYROYHGLQFOXGLQJRIIVLWHDVZHOODVRQVLWHFXPXODWLYH DVZHOODVSURMHFWOHYHOLQGLUHFWDVZHOODVGLUHFWDQGFRQVWUXFWLRQDVZHOODVRSHUDWLRQDOLPSDFWV 2QFHWKHOHDGDJHQF\KDVGHWHUPLQHGWKDWDSDUWLFXODUSK\VLFDOLPSDFWPD\RFFXUWKHQWKHFKHFNOLVWDQVZHUV PXVWLQGLFDWHZKHWKHUWKHLPSDFWLVSRWHQWLDOO\VLJQLILFDQWOHVVWKDQVLJQLILFDQWZLWKPLWLJDWLRQRUOHVVWKDQ VLJQLILFDQW3RWHQWLDOO\6LJQLILFDQW,PSDFWLVDSSURSULDWHLIWKHUHLVVXEVWDQWLDOHYLGHQFHWKDWDQHIIHFWLV VLJQLILFDQW,IWKHUHDUHRQHRUPRUH3RWHQWLDOO\6LJQLILFDQW,PSDFWHQWULHVZKHQWKHGHWHUPLQDWLRQLVPDGH DQ(,5LVUHTXLUHG ³1HJDWLYH 'HFODUDWLRQ /HVV7KDQ 6LJQLILFDQW :LWK 0LWLJDWLRQ ,QFRUSRUDWHG DSSOLHV ZKHUH WKH LQFRUSRUDWLRQRIPLWLJDWLRQPHDVXUHVKDVUHGXFHGDQHIIHFWIURP3RWHQWLDOO\6LJQLILFDQW,PSDFWWRD/HVV WKDQ6LJQLILFDQW,PSDFW7KHOHDGDJHQF\PXVWGHVFULEHWKHPLWLJDWLRQPHDVXUHVDQGEULHIO\H[SODLQKRZ WKH\ UHGXFH WKH HIIHFW WR D OHVV WKDQ VLJQLILFDQW OHYHO PLWLJDWLRQ PHDVXUHV IURP 6HFWLRQ ;9,, (DUOLHU $QDO\VHVPD\EHFURVVUHIHUHQFHG (DUOLHUDQDO\VHVPD\EHXVHGZKHUHSXUVXDQWWRWKHWLHULQJSURJUDP(,5RURWKHU&(4$SURFHVVDQHIIHFW KDVEHHQDGHTXDWHO\DQDO\]HGLQDQHDUOLHU(,5RUQHJDWLYHGHFODUDWLRQ6HFWLRQF',QWKLVFDVH DEULHIGLVFXVVLRQVKRXOGLGHQWLI\WKHIROORZLQJ D (DUOLHU$QDO\VHV8VHG,GHQWLI\DQGVWDWHZKHUHWKH\DUHDYDLODEOHIRUUHYLHZ E ,PSDFWV$GHTXDWHO\$GGUHVVHG,GHQWLI\ZKLFKHIIHFWVIURPWKHDERYHFKHFNOLVWZHUHZLWKLQWKHVFRSH RIDQGDGHTXDWHO\DQDO\]HGLQDQHDUOLHUGRFXPHQWSXUVXDQWWRDSSOLFDEOHOHJDOVWDQGDUGVDQGVWDWH ZKHWKHUVXFKHIIHFWVZHUHDGGUHVVHGE\PLWLJDWLRQPHDVXUHVEDVHGRQWKHHDUOLHUDQDO\VLV G 0LWLJDWLRQ 0HDVXUHV )RU HIIHFWV WKDW DUH ³/HVV WKDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ 0HDVXUHV ,QFRUSRUDWHG´GHVFULEHWKHPLWLJDWLRQPHDVXUHVZKLFKZHUHLQFRUSRUDWHGRUUHILQHGIURPWKHHDUOLHU GRFXPHQWDQGWKHH[WHQWWRZKLFKWKH\DGGUHVVVLWHVSHFLILFFRQGLWLRQVIRUWKHSURMHFW /HDGDJHQFLHVDUHHQFRXUDJHGWRLQFRUSRUDWHLQWRWKHFKHFNOLVWUHIHUHQFHVWRLQIRUPDWLRQVRXUFHVIRUSRWHQWLDO LPSDFWVHJJHQHUDOSODQV]RQLQJRUGLQDQFHV5HIHUHQFHWRDSUHYLRXVO\SUHSDUHGRURXWVLGHGRFXPHQW VKRXOGZKHUHDSSURSULDWHLQFOXGHDUHIHUHQFHWRWKHSDJHRUSDJHVZKHUHWKHVWDWHPHQWLVVXEVWDQWLDWHG 6XSSRUWLQJ,QIRUPDWLRQ6RXUFHV$VRXUFHOLVWVKRXOGEHDWWDFKHGDQGRWKHUVRXUFHVXVHGRULQGLYLGXDOV FRQWDFWHGVKRXOGEHFLWHGLQWKHGLVFXVVLRQ 7KLVLVRQO\DVXJJHVWHGIRUPDQGOHDGDJHQFLHVDUHIUHHWRXVHGLIIHUHQWIRUPDWVKRZHYHUOHDGDJHQFLHV VKRXOGQRUPDOO\DGGUHVVWKHTXHVWLRQVIURPWKLVFKHFNOLVWWKDWDUHUHOHYDQWWRDSURMHFW¶VHQYLURQPHQWDOHIIHFWV LQZKDWHYHUIRUPDWLVVHOHFWHG 7KHH[SODQDWLRQRIHDFKLVVXHVKRXOGLGHQWLI\ D WKHVLJQLILFDQFHFULWHULDRUWKUHVKROGLIDQ\XVHGWRHYDOXDWHHDFKTXHVWLRQDQG E WKHPLWLJDWLRQPHDVXUHLGHQWLILHGLIDQ\WRUHGXFHWKHLPSDFWWROHVVWKDQVLJQLILFDQFH 168 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ ,$HVWKHWLFV :RXOGWKHSURMHFW D+DYHDVXEVWDQWLDODGYHUVHHIIHFWRQDVFHQLFYLVWD"; E6XEVWDQWLDOO\GDPDJHVFHQLFUHVRXUFHVLQFOXGLQJ EXWQRWOLPLWHGWRWUHHVURFNRXWFURSSLQJVDQG KLVWRULFEXLOGLQJVZLWKLQDVWDWHVFHQLFKLJKZD\" ; F6XEVWDQWLDOO\GHJUDGHWKHH[LVWLQJYLVXDOFKDUDFWHU RUTXDOLW\RIWKHVLWHDQGLWVVXUURXQGLQJV"; G&UHDWHDQHZVRXUFHRIVXEVWDQWLDOOLJKWRUJODUH ZKLFKZRXOGDGYHUVHO\DIIHFWGD\RUQLJKWWLPHYLHZV LQWKHDUHD" ; (QYLURQPHQWDO6HWWLQJ /D4XLQWDLQFOXGHVDPL[WXUHRIEXLOGLQJW\SHVEXLOWRYHUYDULRXVWLPHSHULRGVDQGZLWKDYDULHW\RI DUFKLWHFWXUDOVW\OHV'HYHORSPHQWLQFOXGHVVWUXFWXUHVEXLOWLQWKHHDUO\WZHQWLHWKFHQWXU\DQGQHZPDVWHU SODQQHGFRPPXQLWLHVEXLOWZLWKLQWKHODVWGHFDGH$UFKLWHFWXUDOVW\OHVLQFOXGHWKRVHW\SLFDORI6SDQLVK &RORQLDO0HGLWHUUDQHDQ&RQWHPSRUDU\7XVFDQDQG0RGHUQVW\OHV6SDQLVK&RORQLDODUFKLWHFWXUHLVWKH PRVWSUHYDOHQWVW\OHXVHGLQ/D4XLQWDDQGH[DPSOHVLQFOXGHWKH/D4XLQWD5HVRUW 6SDDQG2OG7RZQH LQWKH9LOODJH7HUUD1RYD3ODQQLQJ 5HVHDUFK,QF-XO\ 7KH3URMHFWVLWHLVFXUUHQWO\YDFDQW7KHVXUURXQGLQJODQGXVHGHVLJQDWLRQVFRQVLVWSULPDULO\RIUHVLGHQWLDO DQGFRPPHUFLDO7KHVLWHLVERUGHUHGRQWKHQRUWKE\'HUHN$ODQ'ULYHDQGUHVLGHQWLDOGHYHORSPHQWWKDW IURQWV'HUHN$ODQ'ULYHRQWKHZHVWE\DUHWHQWLRQEDVLQZLWKUHVLGHQWLDOGHYHORSPHQWZHVWRIWKH UHWHQWLRQEDVLQRQWKHHDVWE\-HIIHUVRQ6WUHHWDQGFRPPHUFLDOGHYHORSPHQWDQGRQWKHVRXWKE\$YHQXH DQGUHVLGHQWLDOGHYHORSPHQW 3URSRVHGXVHVZLWKLQWKHFRPPHUFLDOFHQWHUGHYHORSPHQWLQFOXGHEDQNVUHVWDXUDQWVJDVROLQHVHUYLFH VWDWLRQDQGJURFHU\VWRUH &RQVLVWHQWZLWKWKHDSSURYHG)DLUZD\3OD]D6SHFLILF3ODQWKH3URMHFWDVUHYLVHGZLOOVWLOOFRQWDLQGHVLJQ HOHPHQWVFRQVLVWHQWZLWKWKH&LW\¶VGHVLJQVWDQGDUGVLQFOXGLQJ&RQWHPSRUDU\DUFKLWHFWXUDOVW\OHXVLQJ DUFKHGFRORQQDGHVZLWKWLOHURRIV$GGLWLRQDODUFKLWHFWXUDOHOHPHQWVVXFKDVWH[WXUHGILQLVKHVURXQGHOV DFFHQWWLOHDQGUDLVHGWUHOOLVHVZLOOEHXVHGWRSURYLGHIXUWKHUGHWDLOVDQGLQWHUHVWWKXVIXUWKHUHQKDQFLQJ WKHLQGLYLGXDOEXLOGLQJVDQGWKHTXDOLW\DSSHDUDQFHRIWKHVKRSSLQJFHQWHULQJHQHUDO 7KHODQGVFDSHGVHWEDFNVDORQJ$YHQXHDQG-HIIHUVRQ6WUHHWZLOOLQFRUSRUDWHVLGHZDONVZLWKDYDULHW\ RIWUHHVVKUXEVDQGIORZHUVZKLFKDFFRPSDQLHGE\WKHSDUNLQJORWODQGVFDSLQJDUHGHVLJQHGWRSURYLGH DQLQYLWLQJDWPRVSKHUHWRGUDZVKRSSHUVWRWKHFHQWHU ,PSDFW$QDO\VLV a) Have a substantial adverse effect on a scenic vista? 169 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH /HVV7KDQ6LJQLILFDQW,PSDFW7KH&(4$*XLGHOLQHVGRQRWSURYLGHDGHILQLWLRQRIZKDWFRQVWLWXWHVD ³VFHQLFYLVWD´RU³VFHQLFUHVRXUFH´RUDUHIHUHQFHDVWRIURPZKDWYDQWDJHSRLQWVWKHVFHQLFYLVWDDQGRU UHVRXUFHLIDQ\VKRXOGEHREVHUYHG+RZHYHUDVFHQLFYLVWDFDQJHQHUDOO\EHGHILQHGDVDYLHZSRLQW IURPDSXEOLFYDQWDJHWKDWSURYLGHVH[SDQVLYHYLHZVRIDKLJKO\YDOXHGODQGVFDSHIRUWKHEHQHILWRIWKH JHQHUDOSXEOLF&RPPRQH[DPSOHVLQFOXGHXQGHYHORSHGKLOOVLGHVULGJHOLQHVDQGRSHQVSDFHDUHDVWKDW SURYLGHDXQLI\LQJYLVXDOEDFNGURSWRDGHYHORSHGDUHD6FHQLFUHVRXUFHVFDQJHQHUDOO\EHGHILQHGDV WKRVH ODQGVFDSH SDWWHUQV DQG IHDWXUHV WKDW DUH YLVXDOO\ RU DHVWKHWLFDOO\ SOHDVLQJ DQG WKDW FRQWULEXWH DIILUPDWLYHO\WRWKHGHILQLWLRQRIDGLVWLQFWFRPPXQLW\RUUHJLRQVXFKDVWUHHVURFNRXWFURSSLQJVDQG KLVWRULFEXLOGLQJV 7KH3URMHFWVLWHFXUUHQWO\FRQVLVWVRIYDFDQWGLVWXUEHGODQG7KH3URMHFWVLWHLVQRWFRQVLGHUHGWREHD VFHQLFYLVWD$VSUHYLRXVO\GLVFXVVHGWKHVXUURXQGLQJODQGXVHVLQFOXGHUHVLGHQWLDODQGFRPPHUFLDOXVH 7KHKHLJKWVRIWKHSURSRVHGEXLOGLQJVDUHFRQVLVWHQWZLWKWKHPXQLFLSDOFRGHDQGRWKHUFRPPHUFLDODUHDV LQWKHYLFLQLW\DQGDUHQRWFRQVLGHUHGWREHREWUXVLYHZKHQFRPSDUHGWRWKHVXUURXQGLQJDUHD7KHUHIRUH OHVVWKDQVLJQLILFDQWLPSDFWVZRXOGRFFXU b) Substantially damage scenic resources, including, but not limited to, trees, rock outcroppings, and historic buildings within a state scenic highway? 1R,PSDFW7KH3URMHFWLVQRWORFDWHGZLWKLQDVWDWHVFHQLFKLJKZD\DQGWKHUHIRUHQRLPSDFWWRWUHHVRU URFNRXWFURSSLQJVRUKLVWRULFEXLOGLQJVZLWKLQDVWDWHVFHQLFKLJKZD\ZRXOGRFFXU c) Substantially degrade the existing visual character or quality of the site and its surroundings? /HVV 7KDQ 6LJQLILFDQW ,PSDFW 7KH 3URMHFW VLWH FXUUHQWO\ FRQVLVWV RI YDFDQW GLVWXUEHG ODQG$V SUHYLRXVO\GLVFXVVHGWKHVXUURXQGLQJODQGXVHVLQFOXGHUHVLGHQWLDODQGFRPPHUFLDOXVHV7KHKHLJKWDQG VFDOHRIWKHSURSRVHGEXLOGLQJVDUHFRQVLVWHQWZLWKRWKHUFRPPHUFLDODUHDVLQWKHYLFLQLW\DQGLVQRW FRQVLGHUHGWREHREWUXVLYHZKHQFRPSDUHGWRWKHVXUURXQGLQJDUHD7KHUHIRUHOHVVWKDQVLJQLILFDQW LPSDFWVZRXOGRFFXU d) Create a new source of substantial light or glare which would adversely affect day or nighttime views in the area? /HVV7KDQ6LJQLILFDQW,PSDFW7KH&LW\RI/D4XLQWDGRHVQRWSHUPLWFRQVWUXFWLRQDFWLYLWLHVRXWVLGHRI GD\OLJKWKRXUVVRWKHFRQVWUXFWLRQDVVRFLDWHGZLWKWKHSURSRVHG3URMHFWZRXOGQRWFDXVHWKHHPLVVLRQRI OLJKW EH\RQG H[LVWLQJ FLUFXPVWDQFHV LQ WKDW DUHD :LWKLQ WKH &LW\ OLPLWV WKH PDMRULW\ RI ODQGV DUH GHYHORSHGDQGGD\WLPHDQGQLJKWWLPHVNLHVDUHDOUHDG\LPSDFWHGWRDOLPLWHGH[WHQWE\OLJKWDQGJODUH 7KHVLWHOLJKWLQJLQFOXGHVSROHVIRUWKHHQWLUHVTXDUHIRRWORW7KHOLJKWLQJSODQLGHQWLILHVWKH XVHRI/('OLJKWLQJSODFHGLQDPDQQHUZKHUHWKHOLJKWZLOOVSUHDGRXWXQLIRUPO\DFURVVWKHORWZKLOH PDLQWDLQLQJDORZHUSRZHUGHQVLW\%DVHGRQWKHSKRWRPHWULFSODQVWKHUHLVDOPRVWQROHDNDJHRQWRRII VLWHDUHDV7KHOLJKWLQWHQVLW\EHJLQVWRIDGHORQJEHIRUHUHDFKLQJDQ\ZKHUHRXWVLGHWKHORW$OLJKWLQJ SODQDQGVWXG\ZDVFRPSOHWHGRQ$XJXVWE\,QQRYDWLYH'HVLJQ(QJLQHHUV$SSHQGL[$7KH GXDOKHDGSROHLQWKHVRXWKZHVWFRUQHUZLOOQHHGWREHVKLHOGHGWRSUHYHQWVSLOODJHLQWRWKHUHVLGHQWLDO DUHD 170 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH $GGLWLRQDOO\&DOLIRUQLD&RGHRI5HJXODWLRQV&&57LWOH3DUWVDQG%XLOGLQJ(QHUJ\(IILFLHQF\ 6WDQGDUGVHVWDEOLVKHVUHTXLUHPHQWVIRURXWGRRUOLJKWLQJIRUUHVLGHQWLDODQGQRQUHVLGHQWLDOGHYHORSPHQW 7KHVWDQGDUGVUHJXODWHOLJKWLQJFKDUDFWHULVWLFVVXFKDVPD[LPXPSRZHUDQGEULJKWQHVVVKLHOGLQJDQG VHQVRUFRQWUROVWRWXUQOLJKWLQJRQDQGRII7KH&LW\UHTXLUHVWKDWFRPPHUFLDOVWUXFWXUHVFRPSO\ZLWK7LWOH 7KHUHIRUHOHVVWKDQVLJQLILFDQWLPSDFWVZRXOGRFFXU 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGWREHDVVRFLDWHGZLWKWKHSUHYLRXVO\DSSURYHGSURMHFW 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV $(63URYLGHVKLHOGLQJIRUWKHGXDOKHDGSROHLQWKHVRXWKZHVWFRUQHUDVSHUWKHOLJKWLQJGHVLJQ HQJLQHHULQJUHFRPPHQGDWLRQV ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHHIIHFWVDUHDQWLFLSDWHGZLWKWKHLQFOXVLRQRIWKHDERYHPLWLJDWLRQPHDVXUH 171 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH ,,$JULFXOWXUHDQG)RUHVWU\5HVRXUFHV 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ ,QGHWHUPLQLQJZKHWKHULPSDFWVWRDJULFXOWXUDO UHVRXUFHVDUHVLJQLILFDQWHQYLURQPHQWDOHIIHFWVOHDG DJHQFLHVPD\UHIHUWRWKH&DOLIRUQLD$JULFXOWXUDO/DQG (YDOXDWLRQDQG6LWH$VVHVVPHQW0RGHO SUHSDUHGE\WKH&DOLIRUQLD'HSWRI&RQVHUYDWLRQDVDQ RSWLRQDOPRGHOWRXVHLQDVVHVVLQJLPSDFWVRQ DJULFXOWXUHDQGIDUPODQG,QGHWHUPLQLQJZKHWKHU LPSDFWVWRIRUHVWUHVRXUFHVLQFOXGLQJWLPEHUODQGDUH VLJQLILFDQWHQYLURQPHQWDOHIIHFWVOHDGDJHQFLHVPD\ UHIHUWRLQIRUPDWLRQFRPSLOHGE\WKH&DOLIRUQLD 'HSDUWPHQWRI)RUHVWU\DQG)LUH3URWHFWLRQUHJDUGLQJ WKHVWDWH¶VLQYHQWRU\RIIRUHVWODQGLQFOXGLQJWKH )RUHVWDQG5DQJH$VVHVVPHQW3URMHFWDQGWKH)RUHVW /HJDF\$VVHVVPHQWSURMHFWDQGIRUHVWFDUERQ PHDVXUHPHQWPHWKRGRORJ\SURYLGHGLQ)RUHVW 3URWRFROVDGRSWHGE\WKH&DOLIRUQLD$LU5HVRXUFHV %RDUG:RXOGWKHSURMHFW D&RQYHUW3ULPH)DUPODQG8QLTXH)DUPODQGRU )DUPODQGRI6WDWHZLGH,PSRUWDQFH)DUPODQGDV VKRZQRQWKHPDSVSUHSDUHGSXUVXDQWWRWKH)DUPODQG 0DSSLQJDQG0RQLWRULQJ3URJUDPRIWKH&DOLIRUQLD 5HVRXUFHV$JHQF\WRQRQDJULFXOWXUDOXVH" ; E&RQIOLFWZLWKH[LVWLQJ]RQLQJIRUDJULFXOWXUDOXVHRU D:LOOLDPVRQ$FWFRQWUDFW"; F&RQIOLFWZLWKH[LVWLQJ]RQLQJIRURUFDXVHUH]RQLQJ RIIRUHVWODQGDVGHILQHGLQ3XEOLF5HVRXUFHV&RGH VHFWLRQJWLPEHUODQGDVGHILQHGE\3XEOLF 5HVRXUFHV&RGHVHFWLRQRUWLPEHUODQG]RQHG 7LPEHUODQG3URGXFWLRQDVGHILQHGE\*RYHUQPHQW &RGHVHFWLRQJ" ; G5HVXOWLQWKHORVVRIIRUHVWODQGRUFRQYHUVLRQRI IRUHVWODQGWRQRQIRUHVWXVH"; H,QYROYHRWKHUFKDQJHVLQWKHH[LVWLQJHQYLURQPHQW ZKLFKGXHWRWKHLUORFDWLRQRUQDWXUHFRXOGUHVXOWLQ FRQYHUVLRQRI)DUPODQGWRQRQDJULFXOWXUDOXVHRU FRQYHUVLRQRIIRUHVWODQGWRQRQIRUHVWXVH" ; (QYLURQPHQWDO6HWWLQJ $JULFXOWXUHKDVKLVWRULFDOO\EHHQDPDMRUHFRQRPLFVHFWRULQWKHHDVWHUQSRUWLRQRIWKH&RDFKHOOD9DOOH\ LQFOXGLQJ/D4XLQWD$OWKRXJKPRVWRIWKHIDUPVKDYHZLWKLQWKHLQFRUSRUDWHGUHJLRQVRI/D4XLQWDQR ORQJHUH[LVWDJULFXOWXUHLVVWLOODQHFRQRPLFIDFWRUHDVWRIWKHLQFRUSRUDWHGERXQGDU\ZLWKLQWKHSURSRVHG 6SKHUHRI,QIOXHQFHDQGEH\RQG7HUUD1RYD-XO\ 7KH 5LYHUVLGH &RXQW\ ,PSRUWDQW )DUPODQG 0DS GHYHORSHG E\WKH &DOLIRUQLD 'HSDUWPHQW RI &RQVHUYDWLRQ KLJKOLJKWV DUHDV ZLWKLQ WKH &RDFKHOOD 9DOOH\ WKDW DUH LPSRUWDQW DJULFXOWXUDO SURGXFLQJ ODQGV3ULPH)DUPODQGLQFOXGHVDUHDVZLWKERWKJRRGSK\VLFDODQGFKHPLFDODWWULEXWHVDEOHWRVXVWDLQ 172 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH ORQJWHUP DJULFXOWXUH SURGXFWLRQ 8QLTXH )DUPODQG DUHDV SURGXFH FURSV RI VWDWHZLGH LPSRUWDQFH KRZHYHUFRQWDLQORZHUTXDOLW\VRLOVWKDQWKRVHZLWKLQ3ULPH)DUPODQG 7KHVLWHZDVIRUPHUO\XWLOL]HGIRUFLWUXVJURYHIDUPLQJEXWWKHJURYHVZHUHUHPRYHGLQWKHHDUO\V 7KH VLWH LV LGHQWLILHG E\ WKH 6WDWH RI &DOLIRUQLD 'HSDUWPHQW RI &RQVHUYDWLRQ DV )DUPODQGV RI /RFDO ,PSRUWDQFH)DUPODQGRI/RFDO,PSRUWDQFHDUHODQGVJHQHUDOO\ZLWKRXWLUULJDWLRQDQGZKLFKSURGXFHGU\ FURSVWKDWPD\EHLPSRUWDQWORFDOO\EXWDUHQRWLPSRUWDQWIRUVWDWHZLGHDJULFXOWXUHSURGXFWLRQ 7KH3URMHFWVLWHLVFXUUHQWO\YDFDQWODQGWKDWLV]RQHGIRUFRPPHUFLDOXVHV ,PSDFW$QDO\VLV a) Convert Prime Farmland, Unique Farmland or Farmland of Statewide Importance (Farmland), as shown on the maps prepared pursuant to the Farmland Mapping and Monitoring Program of the California Resources Agency, to non-agricultural use? /HVV7KDQ6LJQLILFDQW7KHVLWHZDVIRUPHUO\XWLOL]HGIRUFLWUXVJURYHIDUPLQJEXWWKHJURYHVZHUH UHPRYHGLQWKHHDUO\V7KHVLWHLVLGHQWLILHGE\WKH6WDWHRI&DOLIRUQLD'HSDUWPHQWRI&RQVHUYDWLRQ DV)DUPODQGVRI/RFDO,PSRUWDQFH)DUPODQGRI/RFDO,PSRUWDQFHDUHODQGVJHQHUDOO\ZLWKRXWLUULJDWLRQ DQG ZKLFK SURGXFH GU\ FURSV WKDW PD\ EH LPSRUWDQW ORFDOO\ EXWDUH QRW LPSRUWDQW IRU VWDWHZLGH DJULFXOWXUHSURGXFWLRQ 7KH3URMHFWVLWHLVRQO\DSSUR[LPDWHO\DFUHVZKLFKLVQRWVXLWDEOHIRUVXVWDLQDEOHFRPPHUFLDOFURSV 7KH&LW\RI/D4XLQWDKDVGHVLJQDWHGWKH6LWHDV&RPPXQLW\&RPPHUFLDOIRUGHYHORSPHQWRIFRPPHUFLDO XVH 7KHUHIRUHWKHUHLVDOHVVWKDQVLJQLILFDQWLPSDFWWRWKLVFULWHULRQEHFDXVHZKLOHWKHVLWHLVGHVLJQDWHGIRU ORFDOLPSRUWDQFHLWLVQRWGHVLJQDWHGDV3ULPH)DUPODQG8QLTXH)DUPODQGRU)DUPODQGRI6WDWHZLGH ,PSRUWDQFH b) Conflict with existing zoning for agricultural use or a Williamson Act contract? 1R ,PSDFW 7KHUH DUH QR DJULFXOWXUDO RU :LOOLDPVRQ $FW FRQWUDFW ODQGV ZLWKLQ WKH 3URMHFW VLWH 7KHUHIRUHQRLPSDFWZRXOGRFFXU c) Conflict with existing zoning for, or cause rezoning of, forest land (as defined in Public Resources Code section 12220(g)), timberland (as defined by Public Resources Code section 4526), or timberland zoned Timberland Production (as defined by Government Code section 51104(g))? 1R,PSDFW7KH3URMHFWVLWHFXUUHQWO\FRQVLVWVRIYDFDQWODQGDQGLV]RQHG&RPPXQLW\&RPPHUFLDO &&7KH3URMHFWVLWHGRHVQRWFRQWDLQIRUHVWODQG7KHUHIRUHQRLPSDFWZRXOGRFFXU d) Result in the loss of forest land or conversion of forest land to non-forest use? 1R,PSDFW7KHUHLVQRIRUHVWODQGLQWKH3URMHFWDUHD7KHUHIRUHQRLPSDFWZRXOGRFFXULQWKLVUHJDUG e) Involve other changes in the existing environment which, due to their location or nature, could result in conversion of Farmland, to non-agricultural use or conversion of forest land to non- forest use? 173 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 1R,PSDFW7KH3URMHFW$UHDFRQVLVWVRIYDFDQWGLVWXUEHGODQGDQGLV]RQHG&RPPXQLW\&RPPHUFLDO &&7KHUHIRUHQRLPSDFWVZRXOGRFFXULQWKLVUHJDUG 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGZLWKWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQIRUWKLVFULWHULRQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV 1RPLWLJDWLRQPHDVXUHVDUHUHTXLUHG ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHLPSDFWVDUHLGHQWLILHGRUDQWLFLSDWHGDQGQRPLWLJDWLRQPHDVXUHVDUHUHTXLUHG 174 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH ,,,$LU4XDOLW\ 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ :KHUHDYDLODEOHWKHVLJQLILFDQFHFULWHULDHVWDEOLVKHG E\WKHDSSOLFDEOHDLUTXDOLW\PDQDJHPHQWRUDLU SROOXWLRQFRQWUROGLVWULFWPD\EHUHOLHGXSRQWRPDNH WKHIROORZLQJGHWHUPLQDWLRQV:RXOGWKHSURMHFW D&RQIOLFWZLWKRUREVWUXFWLPSOHPHQWDWLRQRIWKH DSSOLFDEOHDLUTXDOLW\SODQ"; E9LRODWHDQ\DLUTXDOLW\VWDQGDUGRUFRQWULEXWH VXEVWDQWLDOO\WRDQH[LVWLQJRUSURMHFWHGDLUTXDOLW\ YLRODWLRQ" ; F5HVXOWLQDFXPXODWLYHO\FRQVLGHUDEOHQHWLQFUHDVH RIDQ\FULWHULDSROOXWDQWIRUZKLFKWKHSURMHFWUHJLRQLV QRQDWWDLQPHQWXQGHUDQDSSOLFDEOHIHGHUDORUVWDWH DPELHQWDLUTXDOLW\VWDQGDUGLQFOXGLQJUHOHDVLQJ HPLVVLRQVZKLFKH[FHHGTXDQWLWDWLYHWKUHVKROGVIRU R]RQHSUHFXUVRUV" ; G([SRVHVHQVLWLYHUHFHSWRUVWRVXEVWDQWLDOSROOXWDQW FRQFHQWUDWLRQV"; H&UHDWHREMHFWLRQDEOHRGRUVDIIHFWLQJDVXEVWDQWLDO QXPEHURISHRSOH"; (QYLURQPHQWDO6HWWLQJ /XQGLQ 'HYHORSPHQW LV SURSRVLQJ D VTXDUHIRRW PL[HGXVHFRPPHUFLDOFHQWHUSURMHFWRQ DSSUR[LPDWHO\DFUHV,Q0D\WKH&LW\RI/D4XLQWDDSSURYHGDVTXDUHIRRWPL[HGXVH FRPPHUFLDOFHQWHU6SHFLILF3ODQIRUWKHDFUH3URMHFW6LWH7KHDSSURYDORIWKH6SHFLILF3ODQLQFOXGHG DGRSWLRQRID0LWLJDWHG1HJDWLYH'HFODUDWLRQ01'7KH&LW\DOVRDGRSWHGD6WDWHPHQWRI2YHUULGLQJ &RQVLGHUDWLRQVIRUVLJQLILFDQWDQGXQDYRLGDEOHDLUTXDOLW\LPSDFWVLGHQWLILHGLQWKHXSGDWHG*HQHUDO3ODQ (,5RQ)HEUXDU\7KHUHIRUHWKHDQDO\VLVKHUHLQLVEDVHGRQWKHQHWLQFUHDVHRIDSSUR[LPDWHO\ VTXDUHIHHW RI QHZ XVHV QRW SUHYLRXVO\ UHYLHZHG RU DSSURYHG LQ WKH 6SHFLILF 3ODQ DQG VXEVHTXHQW8SGDWHG*HQHUDO3ODQ ,PSDFW$QDO\VLV±$LU4XDOLW\ a) Conflict with or obstruct implementation of the applicable air quality plan? /HVV7KDQ6LJQLILFDQW7KH3URMHFW6LWHLVORFDWHGLQWKH6DOWRQ6HD$LU%DVLQ66$%7KH6RXWK&RDVW $LU4XDOLW\0DQDJHPHQW'LVWULFW6&$40'KDVMXULVGLFWLRQRYHUDLUTXDOLW\LVVXHVDQGUHJXODWLRQV ZLWKLQWKH66$%7KH$LU4XDOLW\0DQDJHPHQW3ODQ$403IRUWKHEDVLQHVWDEOLVKHVDSURJUDPRIUXOHV DQG UHJXODWLRQV DGPLQLVWHUHG E\ 6&$40' WR REWDLQ DWWDLQPHQW RIWKH VWDWH DQG IHGHUDO DLU TXDOLW\ VWDQGDUGV7KHPRVWUHFHQW$403$403ZDVDGRSWHGE\WKH6&$40'RQ0DUFK7KH $403LQFRUSRUDWHVWKHODWHVWVFLHQWLILFDQGWHFKQRORJLFDOLQIRUPDWLRQDQGSODQQLQJDVVXPSWLRQV LQFOXGLQJ WKH 5HJLRQDO 7UDQVSRUWDWLRQ 3ODQ6XVWDLQDEOH &RPPXQLWLHV 6WUDWHJ\ DQG XSGDWHG HPLVVLRQLQYHQWRU\PHWKRGRORJLHVIRUYDULRXVVRXUFHFDWHJRULHV7KH$403ZDVDGRSWHGE\WKH 6RXWKHUQ&DOLIRUQLD$VVRFLDWLRQRI*RYHUQPHQWV6&$*5HJLRQDO&RXQFLORQ$SULO 175 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 7KH3URSRVHG3URMHFWLVORFDWHGZLWKLQWKH&RPPXQLW\&RPPHUFLDO&&ODQGXVHGHVLJQDWLRQRIWKH 6SHFLILF3ODQ*HQHUDO3ODQ7KHSURSRVHGPL[HGXVHFRPPHUFLDOXVHVDUHDOORZHGZLWKLQWKH&&ODQGXVH DUHDZKLFKKDYHEHHQUHYLHZHGDQGDSSURYHGZLWKLQWKH*HQHUDO3ODQXSGDWH$SSURYDORIWKH SURSRVHGUHYLVLRQZRXOGQRWUHTXLUHD]RQHFKDQJHQRUD*HQHUDO3ODQ$PHQGPHQW7KHUHIRUHDSSURYDO RIWKH3URSRVHG3URMHFWZRXOGQRWFRQIOLFWZLWKWKH$403/HVVWKDQVLJQLILFDQWLPSDFWLVDQWLFLSDWHG b) Violate any air quality standard or contribute substantially to an existing or projected air quality violation? /HVV 7KDQ 6LJQLILFDQW :LWK 0LWLJDWLRQ ,QFRUSRUDWHG 7KH 3URSRVHG 3URMHFW¶V FRQVWUXFWLRQ DQG RSHUDWLRQDOHPLVVLRQVEDVHGRQQHWWKHLQFUHDVHRIDSSUR[LPDWHO\VTXDUHIHHWRIQHZXVHVZHUH VFUHHQHGXVLQJ&DOLIRUQLD(PLVVLRQV(VWLPDWRU0RGHO&DO((0RGYHUVLRQSUHSDUHGE\WKH 6&$40'$SSHQGL[%&DO((0RGZDVXVHGWRHVWLPDWHWKHRQVLWHDQGRIIVLWHFRQVWUXFWLRQHPLVVLRQV 7KHHPLVVLRQVLQFRUSRUDWH5XOHDQGE\GHIDXOWDVUHTXLUHGGXULQJFRQVWUXFWLRQ7KHFULWHULD SROOXWDQWVVFUHHQHGIRULQFOXGHUHDFWLYHRUJDQLFJDVHV52*QLWURXVR[LGHV12[FDUERQPRQR[LGH &2VXOIXUGLR[LGH62DQGSDUWLFXODWHV30DQG30,QDGGLWLRQUHDFWLYHRUJDQLFJDV52* HPLVVLRQVDUHDQDO\]HG7ZRRIWKHDQDO\]HGSROOXWDQWV52*DQG12;DUHR]RQHSUHFXUVRUV%RWK VXPPHUDQGZLQWHUVHDVRQHPLVVLRQOHYHOVZHUHHVWLPDWHG &RQVWUXFWLRQ(PLVVLRQV &RQVWUXFWLRQ HPLVVLRQV DUH FRQVLGHUHG VKRUWWHUP WHPSRUDU\ HPLVVLRQV DQG ZHUH PRGHOHG ZLWK WKH IROORZLQJFRQVWUXFWLRQSDUDPHWHUVVLWHJUDGLQJPDVVDQGILQHJUDGLQJEXLOGLQJFRQVWUXFWLRQSDYLQJ DQGDUFKLWHFWXUDOFRDWLQJ7KHUHVXOWLQJHPLVVLRQVJHQHUDWHGE\FRQVWUXFWLRQRIWKH3URSRVHG3URMHFWDUH VKRZQLQ7DEOHDQG7DEOHVXPPHUDQGZLQWHUFRQVWUXFWLRQHPLVVLRQVUHVSHFWLYHO\ $VVKRZQLQ7DEOHDQG7DEOHFRQVWUXFWLRQHPLVVLRQVZRXOGQRWH[FHHG6&$40'WKUHVKROGVZLWK WKH LPSOHPHQWDWLRQ RI D GD\ SDLQWLQJ VFKHGXOH 7KHUHIRUH0LWLJDWLRQ 0HDVXUH $,5LV UHFRPPHQGHGGXULQJWKHFRQVWUXFWLRQ3KDVH 7DEOH 6XPPHU&RQVWUXFWLRQ(PLVVLRQV6XPPDU\ 3RXQGVSHU'D\ 6RXUFH3KDVH 52* 12;&2 623030 6LWH3UHSDUDWLRQ *UDGLQJ %XLOGLQJ&RQVWUXFWLRQ 3DYLQJ $UFKLWHFWXUDO&RDWLQJ +LJKHVW9DOXHOEVGD\ 6&$40'7KUHVKROG 6LJQLILFDQW 1R 1R 1R 1R 1R 1R 6RXUFH&DO((0RG6XPPHU(PLVVLRQV 3KDVHVGRQRWRYHUODSDQGUHSUHVHQWWKHKLJKHVWFRQFHQWUDWLRQ 176 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 7DEOH :LQWHU&RQVWUXFWLRQ(PLVVLRQV6XPPDU\ 3RXQGVSHU'D\ 6RXUFH3KDVH 52* 12;&2 623030 6LWH3UHSDUDWLRQ *UDGLQJ %XLOGLQJ&RQVWUXFWLRQ 3DYLQJ $UFKLWHFWXUDO&RDWLQJ +LJKHVW9DOXHOEVGD\ 6&$40'7KUHVKROG 6LJQLILFDQW 1R 1R 1R 1R 1R 1R 6RXUFH&DO((0RG:LQWHU(PLVVLRQV 3KDVHVGRQRWRYHUODSDQGUHSUHVHQWWKHKLJKHVWFRQFHQWUDWLRQ &RPSOLDQFHZLWK6&$40'5XOHVDQG $OWKRXJKWKH3URSRVHG3URMHFWGRHVQRWH[FHHG6&$40'WKUHVKROGVIRUFRQVWUXFWLRQHPLVVLRQVWKH $SSOLFDQWZRXOGEHUHTXLUHGWRFRPSO\ZLWKDOODSSOLFDEOH6&$40'UXOHVDQGUHJXODWLRQVDVWKH66$% LVLQQRQDWWDLQPHQWVWDWXVIRUR]RQHDQGVXVSHQGHGSDUWLFXODWHV30 &RPSOLDQFHZLWK6&$40'5XOHDQG 7KH3URMHFW$SSOLFDQWZRXOGEHUHTXLUHGWRFRPSO\ZLWK5XOHVQXLVDQFHDQGIXJLWLYHGXVW ZKLFKUHTXLUHWKHLPSOHPHQWDWLRQRI%HVW$YDLODEOH&RQWURO0HDVXUHV%$&0VIRUHDFKIXJLWLYHGXVW VRXUFHDQGWKH$403ZKLFKLGHQWLILHV%HVW$YDLODEOH&RQWURO7HFKQRORJLHV%$&7VIRUDUHDVRXUFHV DQGSRLQWVRXUFHV7KH%$&0VDQG%$&7VZRXOGLQFOXGHEXWQRWEHOLPLWHGWRWKHIROORZLQJ 7KH3URMHFW3URSRQHQWVKDOOHQVXUHWKDWDQ\SRUWLRQRIWKHVLWHWREHJUDGHGVKDOOEHSUHZDWHUHG SULRUWRWKHRQVHWRIJUDGLQJDFWLYLWLHV D7KH3URMHFW3URSRQHQWVKDOOHQVXUHWKDWZDWHULQJRIWKHVLWHRURWKHUVRLOVWDELOL]DWLRQPHWKRG VKDOOEHHPSOR\HGRQDQRQJRLQJEDVLVDIWHUWKHLQLWLDWLRQRIDQ\JUDGLQJDFWLYLW\RQWKHVLWH 3RUWLRQVRIWKHVLWHWKDWDUHDFWLYHO\EHLQJJUDGHGVKDOOEHZDWHUHGUHJXODUO\WLPHVGDLO\WR HQVXUHWKDWDFUXVWLVIRUPHGRQWKHJURXQGVXUIDFHDQGVKDOOEHZDWHUHGDWWKHHQGRIHDFK ZRUNGD\ E7KH3URMHFW3URSRQHQWVKDOOHQVXUHWKDWDOOGLVWXUEHGDUHDVDUHWUHDWHGWRSUHYHQWHURVLRQXQWLOWKH VLWHLVFRQVWUXFWHGXSRQ F7KH3URMHFW3URSRQHQWVKDOOHQVXUHWKDWODQGVFDSHGDUHDVDUHLQVWDOOHGDVVRRQDVRUHGXFHWKH SRWHQWLDOIRUZLQGHURVLRQ G7KH3URMHFW3URSRQHQWVKDOOHQVXUHWKDWDOOJUDGLQJDFWLYLWLHVDUHVXVSHQGHGGXULQJILUVWDQG VHFRQGVWDJHR]RQHHSLVRGHVRUZKHQZLQGVH[FHHGPLOHVSHUKRXU 'XULQJ FRQVWUXFWLRQ H[KDXVW HPLVVLRQV IURP FRQVWUXFWLRQ YHKLFOHV DQG HTXLSPHQW DQG IXJLWLYH GXVW JHQHUDWHGE\HTXLSPHQWWUDYHOLQJRYHUH[SRVHGVXUIDFHVZRXOGLQFUHDVH12;DQG30OHYHOVLQWKH DUHD $OWKRXJK WKH 3URSRVHG 3URMHFW GRHV QRW H[FHHG 6&$40' WKUHVKROGV GXULQJ FRQVWUXFWLRQ WKH $SSOLFDQW&RQWUDFWRUZRXOGEHUHTXLUHGWRLPSOHPHQWWKHIROORZLQJFRQGLWLRQVDVUHTXLUHGE\6&$40' 177 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 7RUHGXFHHPLVVLRQVDOOHTXLSPHQWXVHGLQJUDGLQJDQGFRQVWUXFWLRQPXVWEHWXQHGDQGPDLQWDLQHGWR WKHPDQXIDFWXUHU¶VVSHFLILFDWLRQWRPD[LPL]HHIILFLHQWEXUQLQJRIYHKLFOHIXHO 7KH3URMHFW3URSRQHQWVKDOOHQVXUHWKDWH[LVWLQJSRZHUVRXUFHVDUHXWLOL]HGZKHUHIHDVLEOHYLD WHPSRUDU\SRZHUSROHVWRDYRLGRQVLWHSRZHUJHQHUDWLRQGXULQJFRQVWUXFWLRQ 7KH3URMHFW3URSRQHQWVKDOOHQVXUHWKDWFRQVWUXFWLRQSHUVRQQHODUHLQIRUPHGRIULGHVKDULQJDQG WUDQVLWRSSRUWXQLWLHV $OOEXLOGLQJVRQWKH3URMHFW6LWHVKDOOFRQIRUPWRHQHUJ\XVHJXLGHOLQHVLQ7LWOHRIWKH&DOLIRUQLD $GPLQLVWUDWLYH&RGH 7KHRSHUDWRUVKDOOPDLQWDLQDQGHIIHFWLYHO\XWLOL]HDQGVFKHGXOHRQVLWHHTXLSPHQWLQRUGHUWR PLQLPL]HH[KDXVWHPLVVLRQVIURPWUXFNLGOLQJ 7KHRSHUDWRUVKDOOFRPSO\ZLWKDOOH[LVWLQJDQGIXWXUH&DOLIRUQLD$LU5HVRXUFHV%RDUG&$5%DQG 6&$40'UHJXODWLRQVUHODWHGWRGLHVHOIXHOHGWUXFNVZKLFKPD\LQFOXGHDPRQJRWKHUVPHHWLQJ PRUHVWULQJHQWHPLVVLRQVWDQGDUGVUHWURILWWLQJH[LVWLQJHQJLQHVZLWKSDUWLFXODWHWUDSVXVHRI ORZVXOIXUIXHODQGXVHRIDOWHUQDWLYHIXHOVRUHTXLSPHQW 2SHUDWLRQDO(PLVVLRQV 7KH RSHUDWLRQDO PRELOH VRXUFH HPLVVLRQV ZHUH FDOFXODWHG XVLQJ WKH 7UDIILF ,PSDFW $QDO\VLV 7,$ SUHSDUHGE\$OEHUW*URYHU $VVRFLDWHVRQ-XO\7KH7,$GHWHUPLQHGWKDWWKHVKRSSLQJFHQWHU ZRXOGJHQHUDWHDSSUR[LPDWHO\GDLO\WULSV6HH7DEOHRI$SSHQGL[)7ULSVZHUHEURNHQGRZQ E\ODQGXVHDQGODQGXVHVL]H7KH7,$DOVRLQFOXGHGDSHUFHQWUHGXFWLRQLQWUDIILFWRDFFRXQWIRUSDVV E\FUHGLW$VWKH3URSRVHG3URMHFWLVHYDOXDWHGDVWKH6SHFLILF3ODQGHOWDRIVTXDUHIHHWRIQHZ XVHV DSSUR[LPDWHO\ SHUFHQW JUHDWHU WKDQ ZDV DSSURYHG LQ WKH 6SHFLILF 3ODQ GDLO\ WULSV DSSUR[LPDWHO\SHUFHQWRIWKHGHYHORSPHQWEDVHGRQPRUHLQWHQVHXVHVZHUHPRGHOHGWRUHSUHVHQWD ZRUVWFDVH VFHQDULR (PLVVLRQV DVVRFLDWHG ZLWK WKH 3URSRVHG 3URMHFW¶V HVWLPDWHG YHKLFOH WULSV ZHUH PRGHOHGDQGDUHOLVWHGLQ7DEOHDQG7DEOHVXPPHUDQGZLQWHURSHUDWLRQDOHPLVVLRQVUHVSHFWLYHO\$V VKRZQERWKVXPPHUDQGZLQWHUVHDVRQRSHUDWLRQDOHPLVVLRQVDUHEHORZ6&$40'WKUHVKROGV,PSDFWV DUHDQWLFLSDWHGWREHOHVVWKDQVLJQLILFDQWDQGQRPLWLJDWLRQPHDVXUHVDUHUHTXLUHG 7DEOH 6XPPHU2SHUDWLRQDO(PLVVLRQV6XPPDU\ 3RXQGVSHU'D\ 6RXUFH 52* 12;&2 623030 $UHD (QHUJ\ 0RELOH 7RWDOVOEVGD\ 6&$40'7KUHVKROG 6LJQLILFDQFH 1R 1R 1R 1R 1R 1R 6RXUFH&DO((0RG6XPPHU(PLVVLRQV 178 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 7DEOH :LQWHU2SHUDWLRQDO(PLVVLRQV6XPPDU\ 3RXQGVSHU'D\ 6RXUFH 52* 12;&2 623030 $UHD (QHUJ\ 0RELOH 7RWDOVOEVGD\ 6&$40'7KUHVKROG 6LJQLILFDQFH 1R 1R 1R 1R 1R 1R 6RXUFH&DO((0RG:LQWHU(PLVVLRQV 7KH3URSRVHG3URMHFWGRHVQRWH[FHHGDSSOLFDEOH6&$40'UHJLRQDOWKUHVKROGVGXULQJWKHVKRUWWHUP FRQVWUXFWLRQSKDVHZLWKWKHLPSOHPHQWDWLRQRIDWDPLQLPXPGD\SDLQWLQJVFKHGXOHRURSHUDWLRQDO DFWLYLWLHVDQGWKHDVVRFLDWHGLPSDFWVDUHFRQVLGHUHGWREHOHVVWKDQVLJQLILFDQWZLWKWKHPLWLJDWLRQPHDVXUH LQFRUSRUDWHG c) Result in a cumulatively considerable net increase of any criteria pollutant for which the project region is non-attainment under an applicable federal or state ambient air quality standard (including releasing emissions which exceed quantitative thresholds for ozone precursors)? /HVV 7KDQ 6LJQLILFDQW7KH SURMHFW ZDV SUHYLRXVO\ UHYLHZHG DQG DSSURYHG DV WKH )DLUZD\ 3OD]D 6KRSSLQJ&HQWHU3URMHFWGHVLJQHGWRSURYLGHDSSUR[LPDWHO\VTXDUHIHHWRIUHWDLOVSDFH ZLWKDFFRPPRGDWLQJSDUNLQJDQGODQGVFDSLQJDUHDV7KH3URSRVHG3URMHFWUHYLVHGDVWKH3DYLOLRQ3DOPV 6KRSSLQJ&HQWHULQFOXGHVWKHRULJLQDOVTXDUHIHHWRIUHWDLOVSDFHZLWKDFFRPPRGDWLQJSDUNLQJ DQGODQGVFDSHDUHDSOXVDQDGGLWLRQDOVTXDUHIHHWRIFRPSOHPHQWDU\XVHV7KHDGGLWLRQDOXVHV ZRXOGQRWFXPXODWLYHO\JHQHUDWHDFRQVLGHUDEOHQHWLQFUHDVHRIDQ\FULWHULDSROOXWDQWQRUYLRODWHDQ\DLU TXDOLW\VWDQGDUGGXULQJFRQVWUXFWLRQDQGRSHUDWLRQRIWKH3URSRVHG3URMHFWUHIHUWR7DEOHWKURXJK (UURU5HIHUHQFHVRXUFHQRWIRXQG7KHVLWH]RQLQJLV&RPPXQLW\&RPPHUFLDOZKLFKDOORZVIRUD 0D[LPXP)ORRU$UHD5DWLR>)$5@JURVVIORRUDUHDRIDOOEXLOGLQJVGLYLGHGE\WKHEXLOGLQJVLWH DUHD7KHSURSRVHG3URMHFWUHSUHVHQWVDSSUR[LPDWHO\)$57KHUHIRUHEHFDXVHWKH3URMHFWSURSRVHV WRXVHOHVVWKDQWKHPD[LPXPDOORZHGXQGHUWKH]RQLQJDOHVVWKDQVLJQLILFDQWLPSDFWLVDQWLFLSDWHG d) Expose sensitive receptors to substantial pollutant concentrations? /HVV 7KDQ 6LJQLILFDQW6&$40' KDV GHYHORSHG D PHWKRGRORJ\ WR DVVHVV WKH ORFDOL]HG LPSDFWV RI HPLVVLRQV IURP D 3URSRVHG 3URMHFW DV RXWOLQHG ZLWKLQ WKH )LQDO/RFDOL]HG 6LJQLILFDQFH 7KUHVKROG 0HWKRGRORJ\UHSRUWFRPSOHWHGLQ-XQHDQGUHYLVHGLQ-XO\7KHXVHRI/RFDOL]HG6LJQLILFDQFH 7KUHVKROGV/67LVYROXQWDU\WREHLPSOHPHQWHGDWWKHGLVFUHWLRQRIORFDOSXEOLFDJHQFLHVDFWLQJDVD OHDGDJHQF\SXUVXDQWWR&(4$$OWKRXJKWKHSURSRVHGXVHZRXOGQRWH[FHHG6&$40'7KUHVKROGV 7DEOH WKURXJK 7DEOH /67V LQFOXGLQJ WKH UHVWDXUDQW GULYHWKURXJK IDFLOLWLHV ZHUH HYDOXDWHG WR IXUWKHUGHPRQVWUDWHDWDORFDOOHYHOWKDWLPSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW/67VZRXOGW\SLFDOO\RQO\ DSSO\WRSURMHFWVWKDWPXVWXQGHUJR&(4$RUWKH1DWLRQDO(QYLURQPHQWDO3ROLF\$FW1(3$DQGDUHILYH DFUHVRUOHVV$OWKRXJKWKH3URSRVHG3URMHFWFDOOVIRUDFUHVRIQHWGHYHORSPHQW/67PHWKRGRORJ\ ZLOOEHLQFRUSRUDWHGWRUHSUHVHQWZRUVWFDVHVFHQDULRHPLVVLRQVWKUHVKROGV&DO((0RGYHUVLRQ ZDVXVHGWRHVWLPDWHWKHRQVLWHDQGRIIVLWHFRQVWUXFWLRQHPLVVLRQV7KH/67VZHUHGHYHORSHGWRDQDO\]H WKHVLJQLILFDQFHRISRWHQWLDODLUTXDOLW\LPSDFWVRISURSRVHGSURMHFWVWRVHQVLWLYHUHFHSWRUVLHVFKRROV VLQJOHIDPLO\UHVLGHQFHVHWFDQGSURYLGHVVFUHHQLQJWDEOHVIRUVPDOOSURMHFWVRQHWZRRUILYHDFUHV 3URMHFWVDUHHYDOXDWHGEDVHGRQJHRJUDSKLFORFDWLRQDQGGLVWDQFHIURPWKHVHQVLWLYHUHFHSWRU RUPHWHUVIRUPWKHVLWH 179 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH )RUWKHSXUSRVHVRID&(4$DQDO\VLVWKH6&$40'FRQVLGHUVDVHQVLWLYHUHFHSWRUWREHDUHFHSWRUVXFK DVUHVLGHQFHKRVSLWDOFRQYDOHVFHQWIDFLOLW\RUDQ\ZKHUHWKDWLWLVSRVVLEOHIRUDQLQGLYLGXDOWRUHPDLQIRU KRXUV $GGLWLRQDOO\ VFKRROV SOD\JURXQGV FKLOG FDUH FHQWHUV DQG DWKOHWLF IDFLOLWLHV FDQ DOVR EH FRQVLGHUHGDVVHQVLWLYHUHFHSWRUV&RPPHUFLDODQGLQGXVWULDOIDFLOLWLHVDUHQRWLQFOXGHGLQWKHGHILQLWLRQRI VHQVLWLYHUHFHSWRUEHFDXVHHPSOR\HHVGRQRWW\SLFDOO\UHPDLQRQVLWHIRUDIXOOKRXUVEXWDUHXVXDOO\ SUHVHQWIRUVKRUWHUSHULRGVRIWLPHVXFKDVHLJKWKRXUV 7KH3URSRVHG3URMHFWLQFOXGHVDSSUR[LPDWHO\DFUHVRIGHYHORSPHQW7KH³DFUHVVFHQDULR´ZDVXVHG WRUHSUHVHQWDZRUVWFDVHVFHQDULRDVWKHODUJHUWKHVLWHWKHJUHDWHUWKHHPLVVLRQDOORZDQFH7KH3URMHFW 6LWHLVORFDWHGDWWKHLQWHUVHFWLRQRI-HIIHUVRQ6WUHHWDQG$YHQXHDQGLVERUGHUHGWRWKHQRUWKE\'HUHN $ODQ'ULYHDQGUHVLGHQWLDOGHYHORSPHQWWRWKHZHVWE\-HVV$QQH'ULYHDQGUHVLGHQWLDOGHYHORSPHQWWR WKHHDVWE\-HIIHUVRQ6WUHHWDQGFRPPHUFLDOGHYHORSPHQWDQGWRWKHVRXWKE\$YHQXHDQGUHVLGHQWLDO GHYHORSPHQW7KHQHDUHVWVHQVLWLYHUHFHSWRUODQGXVHVDUHWKHUHVLGHQWLDOGHYHORSPHQWVORFDWHGDGMDFHQWWR WKHQRUWKZHVWDQGVRXWKERXQGDU\RIWKH3URMHFW6LWHDQGWKHUHIRUH/67VDUHEDVHGRQDPHWHU GLVWDQFH $ FRPSDULVRQ RI WKH FRQVWUXFWLRQ DQG RSHUDWLRQDO HPLVVLRQV ZLWK WKH DSSURSULDWH /67 SHU GLVWDQFHIURPWKH3URMHFW6LWHERXQGDU\JHRJUDSKLFDODUHDRI6RXUFH5HFHSWRU$UHD65$1R± &RDFKHOOD9DOOH\DFUHVLWHDFFRUGLQJWRWKH6&$40'0DVV5DWH/RRNXS7DEOHVDUHOLVWHGLQ7DEOH 7DEOH /RFDOL]HG6LJQLILFDQFH7KUHVKROGV3RXQGVSHU'D\ 12[ &2 30 30 &RQVWUXFWLRQ(PLVVLRQV0D[IURP7DEOHDQGRU7DEOH 2SHUDWLRQDO(PLVVLRQV0D[7RWDOIURP7DEOHDQGRU 7DEOH +LJKHVW9DOXHOEVGD\ /677KUHVKROGV *UHDWHU7KDQ7KUHVKROG 1R 1R 1R 1R 1R 1R 1RWH30DQG30HPLVVLRQVDUHVHSDUDWHGLQWRFRQVWUXFWLRQDQGRSHUDWLRQDOWKUHVKROGVLQDFFRUGDQFHZLWK WKH6&$40'0DVV5DWH/67/RRNXS7DEOHV &RQVWUXFWLRQHPLVVLRQV/67WKUHVKROG 2SHUDWLRQDOHPLVVLRQV/67WKUHVKROG 3HU/670HWKRGRORJ\PRELOHVRXUFHHPLVVLRQVGRQRWQHHGWREHLQFOXGHGH[FHSWIRUODQGXVHHPLVVLRQVDQG RQVLWHYHKLFOHHPLVVLRQV,WLVHVWLPDWHGWKDWDSSUR[LPDWHO\RIPRELOHHPLVVLRQVZLOORFFXURQWKH3URMHFW 6LWH 6RXUFH&DO((0RG6XPPHU :LQWHU(PLVVLRQV6&$40')LQDO/RFDOL]HG6LJQLILFDQFH7KUHVKROG 0HWKRGRORJ\6&$40'0DVV5DWH/RRNXS7DEOHVIRUDFUHVLWHLQ65$1RGLVWDQFHRIPHWHUV $VVKRZQLQ7DEOHWKH3URSRVHG3URMHFW¶VHPLVVLRQVDUHQRWDQWLFLSDWHGWRH[FHHGWKH/67V7KHUHIRUH WKH 3URSRVHG 3URMHFW LV QRW DQWLFLSDWHG WR H[SRVH VHQVLWLYH UHFHSWRUV WR VXEVWDQWLDO SROOXWDQW FRQFHQWUDWLRQV/HVVWKDQVLJQLILFDQWLPSDFWLVDQWLFLSDWHGDQGQRPLWLJDWLRQPHDVXUHVDUHUHTXLUHG e) Create objectionable odors affecting a substantial number of people? /HVVWKDQ6LJQLILFDQW7KH3URSRVHG3URMHFWGRHVQRWFRQWDLQODQGXVHVW\SLFDOO\DVVRFLDWHGZLWKWKH HPLVVLRQRIREMHFWLRQDEOHRGRUV3RWHQWLDORGRUVRXUFHVDVVRFLDWHGZLWKWKH3URSRVHG3URMHFWPD\UHVXOW IURPFRQVWUXFWLRQHTXLSPHQWH[KDXVWDQGWKHDSSOLFDWLRQRIDVSKDOWDQGDUFKLWHFWXUDOFRDWLQJVGXULQJ FRQVWUXFWLRQDFWLYLWLHVDQGWKHWHPSRUDU\VWRUDJHRIGRPHVWLFVROLGZDVWHUHIXVHDVVRFLDWHGZLWKWKH 3URMHFWV¶ORQJWHUPRSHUDWLRQDOXVHV6WDQGDUGFRQVWUXFWLRQUHTXLUHPHQWVZRXOGPLQLPL]HRGRULPSDFWV UHVXOWLQJIURPFRQVWUXFWLRQDFWLYLW\$Q\FRQVWUXFWLRQRGRUHPLVVLRQVJHQHUDWHGZRXOGEHWHPSRUDU\ VKRUWWHUP DQG LQWHUPLWWHQW LQ QDWXUH DQG ZRXOG FHDVH XSRQ FRPSOHWLRQ RI WKH UHVSHFWLYH SKDVH RI 180 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH FRQVWUXFWLRQDFWLYLW\,WLVH[SHFWHGWKDW3URMHFWJHQHUDWHGUHIXVHZRXOGEHVWRUHGLQFRYHUHGFRQWDLQHUV DQGUHPRYHGDWUHJXODULQWHUYDOVLQFRPSOLDQFHZLWKWKH&LW\RI/D4XLQWD¶VVROLGZDVWHUHJXODWLRQV7KH 3URMHFWZRXOGEHDOVRUHTXLUHGWRFRPSO\ZLWK6&$40'5XOHWRSUHYHQWRFFXUUHQFHVRISXEOLF QXLVDQFHV7KHUHIRUHRGRUVDVVRFLDWHGZLWKWKH3URSRVHG3URMHFWFRQVWUXFWLRQDQGRSHUDWLRQVZRXOGEH OHVVWKDQVLJQLILFDQWDQGQRPLWLJDWLRQPHDVXUHVDUHUHTXLUHG 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ x$OOFRQVWUXFWLRQHTXLSPHQWVKDOOEHPDLQWDLQHGLQJRRGRSHUDWLQJFRQGLWLRQDQGVKDOOEHSURSHUO\ VHUYLFHGDQGUHSDLUHGDVQHHGHGā x3ULRUWRWKHLVVXDQFHRIWKHILUVWJUDGLQJSHUPLWWKHSURMHFWSURSRQHQWVKDOOGHPRQVWUDWHRUFDXVH WREHGHPRQVWUDWHGWRWKH&RPPXQLW\'HYHORSPHQW'HSDUWPHQWWKDWDOOFRQVWUXFWLRQHTXLSPHQW WREHXWLOL]HGVKDOOEHORZHPLVVLRQRUKRZWKHXVHRIORZHPLVVLRQFRQVWUXFWLRQHTXLSPHQWLV LQIHDVLEOH x/RZ92&SDLQWVSULPHUVDQGFRDWLQJVVKDOOEHUHTXLUHGIRUDOOEXLOGLQJVRQWKHSURMHFWVLWH$OO SDLQWVVKDOOEHDSSOLHGXVLQJHLWKHUDKLJKYROXPHORZSUHVVXUHVSUD\RUE\KDQG x7KH SURSRVHG SURMHFW VKDOO SURYLGH D EXV WXUQRXW VKHOWHU DQG DVVRFLDWHG LPSURYHPHQWV RQ -HIIHUVRQ6WUHHWDQGRQ$YHQXHXQOHVV6XQOLQH7UDQVLWSURYLGHVZULWWHQFRQILUPDWLRQWKDWQR VXFKWXUQRXWVRUVKHOWHUVDUHQHHGHG x$VUHTXLUHGE\WKH0XQLFLSDO&RGHWKHEXVLQHVVHVRSHUDWLQJZLWKLQWKHSURSRVHGSURMHFWVKDOO FRQIRUPWRWKH7UDQVSRUWDWLRQ'HPDQG0DQDJHPHQWUHTXLUHPHQWVLQSODFHDWWKHWLPHWKH\EHJLQ RSHUDWLRQ x'HOLYHULHVWRWKHSURMHFWVLWHVKDOORFFXUGXULQJRIISHDNSHULRGV 0LWLJDWLRQ0HDVXUHV $,5 &RQWUDFWRULVWRLPSOHPHQWDWDPLQLPXPDGD\SDLQWLQJVFKHGXOH ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHHIIHFWVDUHDQWLFLSDWHGZLWKWKHLQFOXVLRQRIWKHDERYHPLWLJDWLRQPHDVXUH 181 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH ,9%LRORJLFDO5HVRXUFHV 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ :RXOGWKHSURMHFW D+DYHDVXEVWDQWLDODGYHUVHHIIHFWHLWKHUGLUHFWO\RU WKURXJKKDELWDWPRGLILFDWLRQVRQDQ\VSHFLHV LGHQWLILHGDVDFDQGLGDWHVHQVLWLYHRUVSHFLDOVWDWXV VSHFLHVLQORFDORUUHJLRQDOSODQVSROLFLHVRU UHJXODWLRQVRUE\WKH&DOLIRUQLD'HSDUWPHQWRI)LVK DQG*DPHRU86)LVKDQG:LOGOLIH6HUYLFH" ; E+DYHDVXEVWDQWLDODGYHUVHHIIHFWRQDQ\ULSDULDQ KDELWDWRURWKHUVHQVLWLYHQDWXUDOFRPPXQLW\LGHQWLILHG LQORFDORUUHJLRQDOSODQVSROLFLHVUHJXODWLRQVRUE\ WKH&DOLIRUQLD'HSDUWPHQWRI)LVKDQG*DPHRU86 )LVKDQG:LOGOLIH6HUYLFH" ; F+DYHDVXEVWDQWLDODGYHUVHHIIHFWRQIHGHUDOO\ SURWHFWHGZHWODQGVDVGHILQHGE\6HFWLRQRIWKH &OHDQ:DWHU$FWLQFOXGLQJEXWQRWOLPLWHGWRPDUVK YHUQDOSRROFRDVWDOHWFWKURXJKGLUHFWUHPRYDO ILOOLQJK\GURORJLFDOLQWHUUXSWLRQRURWKHUPHDQV" ; G,QWHUIHUHVXEVWDQWLDOO\ZLWKWKHPRYHPHQWRIDQ\ QDWLYHUHVLGHQWRUPLJUDWRU\ILVKRUZLOGOLIHVSHFLHVRU ZLWKHVWDEOLVKHGQDWLYHUHVLGHQWRUPLJUDWRU\ZLOGOLIH FRUULGRUVRULPSHGHWKHXVHRIQDWLYHZLOGOLIHQXUVHU\ VLWHV" ; H&RQIOLFWZLWKDQ\ORFDOSROLFLHVRURUGLQDQFHV SURWHFWLQJELRORJLFDOUHVRXUFHVVXFKDVDWUHH SUHVHUYDWLRQSROLF\RURUGLQDQFH" ; I&RQIOLFWZLWKWKHSURYLVLRQVRIDQDGRSWHG+DELWDW &RQVHUYDWLRQ3ODQ1DWXUDO&RPPXQLW\&RQVHUYDWLRQ 3ODQRURWKHUDSSURYHGORFDOUHJLRQDORUVWDWHKDELWDW FRQVHUYDWLRQSODQ" ; (QYLURQPHQWDO6HWWLQJ 7KHVXEMHFWSDUFHOLVPDSSHGRQWKH86*HRORJLFDO6XUYH\86*6±/D4XLQWD0LQXWH6HULHV 7RSRJUDSKLF4XDGUDQJOH0DSQHDUWKHVRXWKHUQERXQGDU\RI6HFWLRQ7RZQVKLS6RXWK5DQJH (DVW6DQ%HUQDUGLQR%DVHDQG0HULGLDQ 7KHHOHYDWLRQRIWKHFHQWHURIWKHSURMHFWVLWHLVIHHWDERYHPHDQVHDOHYHODPVO7KHH[LVWLQJ WRSRJUDSK\RIWKLVVLWHLVUHODWLYHO\IODW7KHVRLOVZLWKLQWKHVXEMHFWSDUFHOFRQVLVWRI0\RPDILQHVDQG WRSHUFHQWVORSHVDQG0\RPDILQHVDQGWRSHUFHQWVORSHV7KLVVRLOW\SHFRQVLVWVRIZLQGEORZQ VDQG\DOOXYLXPDQGLVVRPHZKDWH[FHVVLYHO\GUDLQHG 7KH ORFDO FOLPDWLF FRQGLWLRQV LQ WKH SURMHFW DUHD DUH FKDUDFWHUL]HG E\ KRW VXPPHUV PLOG ZLQWHUV LQIUHTXHQWUDLQIDOODQGORZKXPLGLW\7KHDYHUDJHDQQXDOWHPSHUDWXUHUDQJHVIURPDQDYHUDJHORZRI GHJUHHV)DKUHQKHLW)LQ'HFHPEHUWRDQDYHUDJHKLJKRI)LQ-XO\$XJXVW7KHUDLQ\VHDVRQ EHJLQVLQ1RYHPEHUDQGFRQWLQXHVWKURXJK0DUFKZLWKWKHTXDQWLW\DQGIUHTXHQF\RIUDLQYDU\LQJIURP \HDUWR\HDU7KHDYHUDJHDQQXDOUDLQIDOOLVDSSUR[LPDWHO\LQFKHV 182 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH %LRORJLFDO6XUYH\V -HULFKR 6\VWHPV ,QF -HULFKR SUHSDUHG D *HQHUDO %LRORJLFDO 5HVRXUFHV $VVHVVPHQW DQG &RDFKHOOD 9DOOH\0XOWLSOH6SHFLHV+DELWDW&RQVHUYDWLRQ3ODQ&RQVLVWHQF\5HYLHZLQ0D\-HULFKR0D\ 7KH&LW\RI/D4XLQWDIDOOVHQWLUHO\ZLWKLQWKH&RDFKHOOD9DOOH\0XOWLSOH6SHFLHV+DELWDW&RQVHUYDWLRQ 3ODQ&906+&3DUHD7KHVXEMHFWSDUFHOLVQRWORFDWHGZLWKLQRUDGMDFHQWD&RQVHUYDWLRQ$UHD7KH &906+&3UHTXLUHVDKDELWDWDVVHVVPHQWIRUWKHEXUURZLQJRZO%82:,IKDELWDWIRUWKH%82:LV SUHVHQWDIRFXVHGVXUYH\LVUHTXLUHG 6HYHUDOVHQVLWLYHVSHFLHVKDYHEHHQGRFXPHQWHGZLWKLQWKHYLFLQLW\RIWKHVXEMHFWSDUFHOLQFOXGLQJWKH 6WDWHDQGRUIHGHUDOO\OLVWHGDVWKUHDWHQHGRUHQGDQJHUHGIODWWDLOHGKRUQHGOL]DUG3KU\QRVRPDPFDOOLL &RDFKHOOD9DOOH\PLONYHWFK$VWUDJDOXVOHQWLJLQRVXVYDUFRDFKHOODHDQG&RDFKHOOD9DOOH\IULQJHWRHG OL]DUG8PDLQRUQDWDDVZHOODVEXUURZLQJRZO$WKHQHFXQLFXODULDZKLFKLVFRQVLGHUHGD6SHFLHVRI 6SHFLDO&RQFHUQE\WKH&DOLIRUQLD'HSDUWPHQWRI)LVKDQG:LOGOLIH&'): 2Q 0D\ -HULFKR %LRORJLVW (XJHQH -HQQLQJV FRQGXFWHG D V\VWHPDWLF DQG FRPSUHKHQVLYH SHGHVWULDQVXUYH\RQVLWHWRDVVHVVWKHKDELWDWVXLWDELOLW\IRUEXUURZLQJRZOWRVDWLVI\WKHUHTXLUHPHQWVVHW IRUWKLQWKH&906+&3DQGWRGHWHUPLQHLIIRFXVHGSUHVHQFHDEVHQFHVXUYH\VIRUDQ\RIWKHVSHFLHV ZRXOGEHUHTXLUHG7KHKDELWDWDVVHVVPHQWLQFOXGHGDSHUFHQWFRYHUDJHSHGHVWULDQILHOGVXUYH\DQG DGKHUHQFHWRWKH06+&3%XUURZLQJ2ZO&DOLIRUQLD'HSDUWPHQWRI)LVKDQG:LOGOLIH&'):VXUYH\ SURWRFROV 6XUYH\V ZHUH FRQGXFWHG GXULQJ RSWLPDO EXUURZLQJ RZO DFWLYLW\ WLPHV FRQVLVWHQW ZLWK FRQVHUYDWLRQHWKLFVV\VWHPDWLFDQGFRYHUHGDOOKDELWDWW\SHVRQWKHVLWHDQGGXULQJDJRRGUDLQIDOO\HDU 6XUYH\5HVXOWV 7KHELRORJLFDOVXUYH\UHSRUW-HULFKR0D\LQGLFDWHGWKDWWKHHQWLUHVXEMHFWSDUFHOLVZLWKLQDQ XUEDQGHYHORSHGDUHDDQGFRQVLVWVRIGLVWXUEHGXQGHYHORSHGODQGWKDWKDVSUHYLRXVO\EHHQURXJKJUDGHG 7KHSURMHFWVLWHLVFRPSOHWHO\GLVWXUEHGFRQVLVWLQJHQWLUHO\RISUHYLRXVO\JUDGHGVRLOVZLWKVSDUVHZHHG\ YHJHWDWLRQDQGUHVSURXWHGFUHRVRWHEXVKVFUXE/DUUHDWULGHQWDWD6KUXEODQG$OOLDQFHDVVRFLDWHGVSHFLHV 3ODQWVSHFLHVREVHUYHGRQVLWHLQFOXGHFUHRVRWHDVZHOODVUXGHUDODQGQRQQDWLYHVSHFLHVLQFOXGLQJ 5XVVLDQWKLVWOH6DOVRODWUDJXVDQGVDOWFHGDU7DPDUL[UDPRVLVVLPD 1RVXLWDEOH%82:KDELWDWZDVLGHQWLILHGRQVLWHGXULQJWKHEXUURZLQJRZOKDELWDWDVVHVVPHQWVXUYH\ 7KHUHIRUHQRDGGLWLRQDOSURWRFROOHYHOIRFXVHGVXUYH\VZLOOEHUHTXLUHG 1RRWKHUOLVWHGRUVHQVLWLYHVSHFLHVRUVHQVLWLYHKDELWDWZHUHREVHUYHGRQWKHVLWH7KHVXEMHFWSDUFHOGRHV QRWFRQWDLQVXLWDEOHKDELWDWIRUDQ\RIWKHVHQVLWLYHVSHFLHVWKDWKDYHEHHQGRFXPHQWHGLQWKHSURMHFW YLFLQLW\ 7KHUHZHUHQRVWUHDPFKDQQHOVZDVKHVRUVZDOHVDVGHILQHGE\6HFWLRQRIWKH6WDWHRI&DOLIRUQLD )LVKDQG*DPH&RGH)*&XQGHUMXULVGLFWLRQRIWKH&'):RU³:DWHUVRIWKH8QLWHG6WDWHV´:R86DV GHILQHGE\6HFWLRQRIWKH&OHDQ:DWHU$FW&:$XQGHUWKHMXULVGLFWLRQRIWKH86$UP\&RUSVRI (QJLQHHUV&RUSVZLWKLQWKHVXEMHFWSDUFHO 183 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH ,PSDFW$QDO\VLV a) Have a substantial adverse effect, either directly or through habitat modifications, on any species identified as a candidate, sensitive, or special status species in local or regional plans, policies, or regulations, or by the California Department of Fish and Game or U.S. Fish and Wildlife Service? /HVV 7KDQ 6LJQLILFDQW 6HYHUDO VHQVLWLYH VSHFLHV KDYH EHHQ GRFXPHQWHG ZLWKLQ WKH YLFLQLW\ RI WKH VXEMHFWSDUFHOLQFOXGLQJWKH6WDWHDQGRUIHGHUDOO\OLVWHGDVWKUHDWHQHGRUHQGDQJHUHGIODWWDLOHGKRUQHG OL]DUG3KU\QRVRPDPFDOOLL&RDFKHOOD9DOOH\PLONYHWFK$VWUDJDOXVOHQWLJLQRVXVYDUFRDFKHOODHDQG &RDFKHOOD 9DOOH\ IULQJHWRHG OL]DUG 8PD LQRUQDWD DV ZHOO DV EXUURZLQJ RZO $WKHQH FXQLFXODULD ZKLFKLVFRQVLGHUHGD6SHFLHVRI6SHFLDO&RQFHUQE\WKH&DOLIRUQLD'HSDUWPHQWRI)LVKDQG:LOGOLIH &'): 7KHELRORJLFDOVXUYH\UHVXOWVLGHQWLILHGWKDWWKHHQWLUHVXEMHFWSDUFHOLVZLWKLQDQXUEDQGHYHORSHGDUHD DQGFRQVLVWVRIGLVWXUEHGXQGHYHORSHGODQGWKDWKDVSUHYLRXVO\EHHQURXJKJUDGHG1RVXLWDEOH%82: KDELWDWZDVLGHQWLILHGRQVLWHGXULQJWKHEXUURZLQJRZOKDELWDWDVVHVVPHQWVXUYH\WKHUHIRUHQRDGGLWLRQDO SURWRFROOHYHOIRFXVHGVXUYH\VDUHUHTXLUHG 1RRWKHUOLVWHGRUVHQVLWLYHVSHFLHVRUVHQVLWLYHKDELWDWZHUHREVHUYHGRQWKHVLWH7KHVXEMHFWSDUFHOGRHV QRWFRQWDLQVXLWDEOHKDELWDWIRUDQ\RIWKHVHQVLWLYHVSHFLHVWKDWKDYHEHHQGRFXPHQWHGLQWKHSURMHFW YLFLQLW\7KHUHIRUHWKHUHLVDOHVVWKDQVLJQLILFDQWLPSDFW b) Have a substantial adverse effect on any riparian habitat or other sensitive natural community identified in local or regional plans, policies, regulations, or by the California Department of Fish and Game or U.S. Fish and Wildlife Service? 1R,PSDFW5LSDULDQFRPPXQLWLHVRFFXUDORQJVWUHDPFRXUVHVDQGGUDLQDJHVDQGDUHIORULVWLFDOO\DQG VWUXFWXUDOO\GLVWLQFWIURPWKHDGMDFHQWXSODQGFRPPXQLWLHV7KHELRORJLFDOVXUYH\UHVXOWVLGHQWLILHGWKDW WKHHQWLUHVXEMHFWSDUFHOLVZLWKLQDQXUEDQGHYHORSHGDUHDDQGFRQVLVWVRIGLVWXUEHGXQGHYHORSHGODQG WKDWKDVSUHYLRXVO\EHHQURXJKJUDGHG7KHUHZHUHQRVWUHDPFKDQQHOVZDVKHVRUVZDOHVDVGHILQHGE\ 6HFWLRQRIWKH)*&XQGHUMXULVGLFWLRQRIWKH&'):RU:R86DVGHILQHGE\6HFWLRQRIWKH &:$ XQGHU WKH MXULVGLFWLRQ RI WKH &RUSV ZLWKLQ WKH VXEMHFW SDUFHO 7KH 3URMHFW VLWH LV FRPSOHWHO\ GLVWXUEHGDQGEDUUHQZLWKQRK\GURORJLFDOSURFHVVRQVLWH7KHUHDUHQRQDWXUDOVWUHDPVRUGUDLQDJHVWKDW WUDYHUVHWKH3URMHFWVLWH7KHODFNRIK\GURORJ\RQVLWHPDNHVLWQRQVXLWDEOHIRUULSDULDQKDELWDW1R DGYHUVHLPSDFWVWRULSDULDQRUVHQVLWLYHQDWXUDOKDELWDWZRXOGRFFXU c) Have a substantial adverse effect on federally protected wetlands as defined by Section 404 of the Clean Water Act (including, but not limited to, marsh, vernal pool, coastal, etc.) through direct removal, filling, hydrological interruption, or other means? 1R,PSDFW7KHELRORJLFDOVXUYH\UHVXOWVLGHQWLILHGWKDWWKHHQWLUHVXEMHFWSDUFHOLVZLWKLQDQXUEDQ GHYHORSHGDUHDDQGFRQVLVWVRIGLVWXUEHGXQGHYHORSHGODQGWKDWKDVSUHYLRXVO\EHHQURXJKJUDGHG7KHUH ZHUHQRVWUHDPFKDQQHOVZDVKHVRUVZDOHVDVGHILQHGE\6HFWLRQRIWKH)*&XQGHUMXULVGLFWLRQRI WKH&'):RU:R86DVGHILQHGE\6HFWLRQRIWKH&:$XQGHUWKHMXULVGLFWLRQRIWKH&RUSVZLWKLQ WKHVXEMHFWSDUFHO7KH3URMHFWVLWHLVFRPSOHWHO\GLVWXUEHGDQGEDUUHQZLWKQRK\GURORJLFDOSURFHVVRQ VLWH7KHUHDUHQRQDWXUDOVWUHDPVRUGUDLQDJHVWKDWWUDYHUVHWKH3URMHFWVLWH7KHODFNRIK\GURORJ\RQ VLWHPDNHVLWQRQVXLWDEOHIRUULSDULDQKDELWDW7KHUHIRUHWKHUHLVQRLPSDFWVEHFDXVHQRZHWODQGVRFFXU RQVLWHQRUDUHWKHUHIOXYLDOSURFHVVHVZKHUHZHWODQGVZRXOGEHSUHVHQW 184 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH d) Interfere substantially with the movement of any native resident or migratory fish or wildlife species or with established native resident or migratory wildlife corridors, or impede the use of native wildlife nursery sites? /HVV 7KDQ 6LJQLILFDQW :LWK 0LWLJDWLRQ ,QFRUSRUDWHG7KH 3URMHFW VLWH LV VXUURXQGHG E\ XUEDQ GHYHORSPHQW$GGLWLRQDOO\WKH3URMHFWVLWHLWVHOILVIXOO\GLVWXUEHGZLWKQRDELOLW\WRSURYLGHPRYHPHQW RIILVKRUZLOGOLIHVSHFLHV$GGLWLRQDOO\QRNQRZQZLOGOLIHFRUULGRUVDUHLGHQWLILHGZLWKLQWKH3URMHFWVLWH RUWKHLPPHGLDWHYLFLQLW\1RDGYHUVHLPSDFWVWRZLOGOLIHPRYHPHQWZRXOGRFFXU +RZHYHUWKHSURMHFWVLWHFRQWDLQVVSDUVHZHHG\YHJHWDWLRQDQGUHVSURXWHGFUHRVRWHEXVKVFUXE/DUUHD WULGHQWDWD6KUXEODQG$OOLDQFHDVVRFLDWHGVSHFLHVDVZHOODVUXGHUDODQGQRQQDWLYHVSHFLHVLQFOXGLQJ 5XVVLDQWKLVWOH6DOVRODWUDJXVDQGVDOWFHGDU7DPDUL[UDPRVLVVLPDZKLFKUHSUHVHQWVSRWHQWLDOIRUDJLQJ DQGQHVWLQJKDELWDWIRUPLJUDWRU\ELUGVSHFLHV7KHLPSDFWVIRUWKHVHELUGVSHFLHVKRZHYHUDUHQRW FRQVLGHUHGUHJLRQDOO\RUORFDOO\VLJQLILFDQWEXWWKH6WDWHRI&DOLIRUQLDSURKLELWVWKH³WDNH´RIDFWLYHELUG QHVWV7RDYRLGDQLOOHJDOWDNHRIDFWLYHELUGQHVWV0LWLJDWLRQ0HDVXUH%,2LVUHTXLUHGWRUHGXFH LPSDFWVWROHVVWKDQVLJQLILFDQW0LWLJDWLRQPHDVXUH%,2LVORFDWHGDWWKHHQGRIWKLVVHFWLRQ e) Conflict with any local policies or ordinances protecting biological resources, such as a tree preservation policy or ordinance? 1R,PSDFW$VELRORJLFDOUHVRXUFHVLQFOXGLQJWKUHDWHQHGUHVRXUFHVDQGKDELWDWWKDWFRXOGVXSSRUWVXFK VSHFLHVDUHQRWSUHVHQWRQRUQHDUWKH3URMHFWVLWHQRSROLFLHVRURUGLQDQFHVSURWHFWLQJVXFKUHVRXUFHV ZRXOGDSSO\7KLVLQFOXGHVWUHHSUHVHUYDWLRQSROLFLHV7KHUHIRUHWKHUHDUHQRFRQIOLFWVZLWKORFDOSROLFLHV RURUGLQDQFHV f) Conflict with the provisions of an adopted Habitat Conservation Plan, Natural Community Conservation Plan, or other approved local, regional, or state habitat conservation plan? /HVV7KDQ6LJQLILFDQW7KH&LW\RI/D4XLQWDIDOOVHQWLUHO\ZLWKLQWKH&906+&3DUHD7KHVXEMHFW SDUFHOLVQRWORFDWHGZLWKLQRUDGMDFHQWWRD&RQVHUYDWLRQ$UHD7KH&906+&3UHTXLUHVDKDELWDW DVVHVVPHQWIRUWKH%82:ZKLFKUHTXLUHVIRFXVHGVXUYH\VLISUHVHQW6HYHUDOVHQVLWLYHVSHFLHVKDYHEHHQ GRFXPHQWHG ZLWKLQ WKH YLFLQLW\ RI WKH VXEMHFW SDUFHO LQFOXGLQJ WKH 6WDWH DQGRU IHGHUDOO\OLVWHG DV WKUHDWHQHGRUHQGDQJHUHGIODWWDLOHGKRUQHGOL]DUG3KU\QRVRPDPFDOOLL&RDFKHOOD9DOOH\PLONYHWFK $VWUDJDOXVOHQWLJLQRVXVYDUFRDFKHOODHDQG&RDFKHOOD9DOOH\IULQJHWRHGOL]DUG8PDLQRUQDWDDVZHOO DV EXUURZLQJ RZO $WKHQH FXQLFXODULD ZKLFK LV FRQVLGHUHG D 6SHFLHV RI 6SHFLDO &RQFHUQ E\ WKH &DOLIRUQLD'HSDUWPHQWRI)LVKDQG:LOGOLIH&'): +RZHYHUVLWHVXUYH\VIRUWKH%82:LQGLFDWHGWKDWWKHUHLVQRVXLWDEOHKDELWDWIRUWKH%82:RUDQ\ VHQVLWLYHVSHFLHVGRFXPHQWHGZLWKLQWKHYLFLQLW\7KHUHIRUHWKHUHDUHQRFRQIOLFWVZLWKDQ\DGRSWHG FRQVHUYDWLRQSODQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGZLWKWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQIRUWKLVFULWHULRQ 185 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV %,2± $Q\ JUXEELQJ EUXVKLQJ RU WUHH UHPRYDO VKRXOG EH FRQGXFWHG RXWVLGH RI WKH 6WDWH LGHQWLILHG QHVWLQJ VHDVRQ IRU PLJUDWRU\ ELUGV ZKLFK LV W\SLFDOO\ 0DUFK WKURXJK 6HSWHPEHU,IZRUNFDQQRWEHFRQGXFWHGRXWVLGHRIQHVWLQJVHDVRQDPLJUDWRU\QHVWLQJ ELUG VXUYH\ZLWKLQ DQG DGMDFHQW WR WKH SURMHFW VLWH VKDOO EH FRQGXFWHGE\ D TXDOLILHG ELRORJLVWZLWKLQWKUHHGD\VSULRUWRLQLWLDWLQJWKHFRQVWUXFWLRQDFWLYLWLHV,IDFWLYHQHVWV DUHIRXQGGXULQJWKHSUHFRQVWUXFWLRQQHVWLQJELUGVXUYH\VD1HVWLQJ%LUG3ODQ1%3 ZLOOEHSUHSDUHGDQGLPSOHPHQWHG$WDPLQLPXPWKH1%3ZLOOLQFOXGHJXLGHOLQHVIRU DGGUHVVLQJDFWLYHQHVWVHVWDEOLVKLQJEXIIHUVPRQLWRULQJDQGUHSRUWLQJ7KH1%3ZLOO LQFOXGHDFRS\RIPDSVVKRZLQJWKHORFDWLRQRIDOOQHVWVDQGDQDSSURSULDWHEXIIHU]RQH DURXQGHDFKQHVWVXIILFLHQWWRSURWHFWWKHQHVWIURPGLUHFWDQGLQGLUHFWLPSDFW7KHVL]H DQGORFDWLRQRIDOOEXIIHU]RQHVLIUHTXLUHGVKDOOEHGHWHUPLQHGE\WKHELRORJLVWDQG VKDOOEHEDVHGRQWKHQHVWLQJVSHFLHVLWVVHQVLWLYLW\WRGLVWXUEDQFHDQGH[SHFWHGW\SHVRI GLVWXUEDQFH7KHQHVWVDQGEXIIHU]RQHVVKDOOEHILHOGFKHFNHGZHHNO\E\DTXDOLILHG ELRORJLFDO PRQLWRU 7KH DSSURYHG EXIIHU ]RQH VKDOO EH PDUNHG LQ WKH ILHOG ZLWK FRQVWUXFWLRQIHQFLQJZLWKLQZKLFKQRYHJHWDWLRQFOHDULQJRUJURXQGGLVWXUEDQFHVKDOO FRPPHQFHXQWLOWKHTXDOLILHGELRORJLVWKDVGHWHUPLQHGWKH\RXQJELUGVKDYHVXFFHVVIXOO\ IOHGJHGDQGDPRQLWRULQJUHSRUWKDVEHHQVXEPLWWHGUHYLHZHGDQGDSSURYHGE\WKH&LW\ RI/D4XLQWD ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHHIIHFWVDUHDQWLFLSDWHGZLWKWKHLQFOXVLRQRIWKHDERYHPLWLJDWLRQPHDVXUH 186 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 9&XOWXUDO5HVRXUFHV 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ :RXOGWKHSURMHFW D&DXVHDVXEVWDQWLDODGYHUVHFKDQJHLQWKH VLJQLILFDQFHRIDKLVWRULFDOUHVRXUFHDVGHILQHGLQ " ; E&DXVHDVXEVWDQWLDODGYHUVHFKDQJHLQWKH VLJQLILFDQFHRIDQDUFKDHRORJLFDOUHVRXUFHSXUVXDQWWR " ; F'LUHFWO\RULQGLUHFWO\GHVWUR\DXQLTXHSDOHRQ WRORJLFDOUHVRXUFHRUVLWHRUXQLTXHJHRORJLFIHDWXUH"; G'LVWXUEDQ\KXPDQUHPDLQVLQFOXGLQJWKRVH LQWHUUHGRXWVLGHRIIRUPDOFHPHWHULHV"; H&DXVHDVXEVWDQWLDODGYHUVHFKDQJHLQWKH VLJQLILFDQFHRIDWULEDOFXOWXUDOUHVRXUFHDVGHILQHGLQ 3XEOLF5HVRXUFHV&RGH" ; (QYLURQPHQWDO6HWWLQJ 7KH&RDFKHOOD9DOOH\LVDKLVWRULFDOFHQWHURI1DWLYH$PHULFDQVHWWOHPHQWZKHUHDODUJHQXPEHURI,QGLDQ YLOODJHVDQGUDQFKHULDVZHUHREVHUYHGLQWKHPLGQLQHWHHQWKFHQWXU\ 7KH &DKXLOOD SHRSOH DUH JHQHUDOO\ GLYLGHG E\ DQWKURSRORJLVWVLQWR WKUHH JURXSV DFFRUGLQJ WR WKHLU JHRJUDSKLFVHWWLQJWKH3DVV&DKXLOODLQWKH%DQQLQJ%HDXPRQWDUHDWKH0RXQWDLQ&DKXLOODLQWKH6DQ -DFLQWRDQG6DQWD5RVD0RXQWDLQVDQGWKH&DKXLOOD9DOOH\DQGWKH'HVHUW&DKXLOODLQWKH&RDFKHOOD 9DOOH\ 7KH &DKXLOOD GLG QRW KDYH D VLQJOH QDPH WKDW UHIHUUHG WR DQ DOOLQFOXVLYH WULEDO DIILOLDWLRQ 0HPEHUVKLS ZDV LQ WHUPV RI OLQHDJHV RU FODQV ,QGLYLGXDO FODQVKDG YLOODJHV RU FHQWUDO SODFHV DQG WHUULWRULHVWKH\FDOOHGWKHLURZQ7KHVHZHUHODQGVWKH\FRQVLGHUHGWKHLUVIRUSXUSRVHVRIKXQWLQJJDPH JDWKHULQJIRRGRUXWLOL]LQJRWKHUQHFHVVDU\UHVRXUFHVLQWKHIRUPVRIWUDGHLQWHUPDUULDJHDQGFHUHPRQLHV &XOWXUDO6XUYH\V &507HFKSUHSDUHGWZRVWXGLHVIRUWKH3URMHFWVLWH7KHILUVWFRQVLVWHGRI3KDVH,DQG3KDVH,,FXOWXUDO DVVHVVPHQWV FRQGXFWHG LQ DQG IRU DSSUR[LPDWH DFUHV RI XQGHYHORSHG ODQG DV SDUW RI 7HQWDWLYH 3DUFHO 0DS 1R DQG 7HQWDWLYH 7UDFW 0DS 1R ZKLFK LQFOXGHG D UHVLGHQWLDO GHYHORSPHQWDQGWKHFXUUHQWFRPPHUFLDO3URMHFWVLWH7KHVWXG\ZDVSDUWRIWKHHQYLURQPHQWDOLPSDFW UHYLHZSURFHVVIRUWKHSURSRVHGVXEGLYLVLRQDQGGHYHORSPHQWRIWKHSURSHUW\DVUHTXLUHGE\WKH&LW\RI /D4XLQWD/HDG$JHQF\IRUWKHSURMHFWLQFRPSOLDQFHZLWKWKH&DOLIRUQLD(QYLURQPHQWDO4XDOLW\$FW &(4$35&HWVHT 7KHVHFRQGVWXG\ZDVFRQGXFWHGLQ-XQHDQGFRQVLVWHGRIDKLVWRULFDODUFKDHRORJLFDOUHVRXUFHV UHFRUGVVHDUFKKLVWRULFDOEDFNJURXQGUHYLHZDQGDQDUFKDHRORJLFDOILHOGLQVSHFWLRQRIWKHDSSUR[LPDWHO\ DFUH3URMHFWVLWH&507HFK-XQH 7KH3KDVH,VXUYH\LQLGHQWLILHGDQGUHFRUGHGDWRWDORIVHYHQSUHKLVWRULFLH1DWLYH$PHULFDQ DUFKDHRORJLFDOVLWHVWKUHHRIZKLFKZHUHORFDWHGZLWKLQRUSDUWLDOO\ZLWKLQWKHFXUUHQWSURMHFWDUHD&50 7HFK-XQH$OOWKUHHRIWKHVHVLWHVUHSUHVHQWHGSUHKLVWRULFKDELWDWLRQUHPDLQVIHDWXULQJVXUIDFH 187 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH VFDWWHUVRIOLWKLFDQGFHUDPLFDUWLIDFWV7KHSUHVHQFHRIWKHVHVLWHVDORQJZLWKWKHSUHYLRXVGLVFRYHU\RID GHQVHFOXVWHURIVLPLODUVLWHVLQWKHVXUURXQGLQJDUHDZKLFKOLHVRQWKHIRUPHUVKRUHOLQHRI+RORFHQH/DNH &DKXLOODSURPSWHGWKHVXEVHTXHQW3KDVH,,DUFKDHRORJLFDOWHVWLQJDQGHYDOXDWLRQSURJUDP 7KH3KDVH,,VWXG\HQWDLOHGVXUIDFHFROOHFWLRQRIDOODUWLIDFWVDQGH[FDYDWLRQRIVWDQGDUGKDQGGXJ RQHVTXDUHPHWHUDUFKDHRORJLFDOWHVWLQJXQLWVWRWKHGHSWKRIRQHPHWHUDWWKHWKUHHVLWHVDQGZLWKLQD PRGLILHGPHVTXLWHVDQGGXQHQHDURQHRIWKHVLWHV,QDGGLWLRQWR&507(&+VWDIIDUFKDHRORJLVWVWKH ILHOGFUHZLQFOXGHGWKUHH1DWLYH$PHULFDQVDIILOLDWHGZLWKWKHQHDUE\7RUUHV0DUWLQH]'HVHUW&DKXLOOD ,QGLDQV $WRWDORIDUWLIDFWVZHUHUHFRYHUHGWKURXJKVXUIDFHFROOHFWLRQEXWWKHWHVWXQLWVLQGLFDWHG³DQ DOPRVWFRPSOHWHDEVHQFH´RIVXEVXUIDFHFXOWXUDOPDWHULDO2QO\WKUHHSRWWHU\VKHUGVDQGWZRIODNHVRI FKLSSHGTXDUW]ZHUHSURGXFHGIURPWKHH[FDYDWHGXQLWV,QOLJKWRIWKHVHILQGLQJVQRQHRIWKHWKUHH VLWHVZDVIRXQGWRPHHW&(4$FULWHULDIRUVLJQLILFDQFH&507HFK-XQH 7KH3KDVH,,VWXG\FRQFOXGHGWKDWWKHSURSRVHGGHYHORSPHQWRIWKHVXEMHFWSURSHUW\ZRXOGQRWFDXVHD VXEVWDQWLDO DGYHUVH FKDQJH WR DQ\ KLVWRULFDO UHVRXUFHV RU LPSRUWDQW DUFKDHRORJLFDO UHVRXUFHV EXW UHFRPPHQGHGDUFKDHRORJLFDOPRQLWRULQJRIHDUWKPRYLQJDFWLYLWLHVLQWKHDUHDRIWKHPRGLILHGGXQH7KH DUWLIDFWFROOHFWLRQDQGFDWDORJXHKDYHVLQFHEHHQFXUDWHGDWWKH/D4XLQWD+LVWRULFDO6RFLHW\ 5HFRUGV6HDUFK $VWDQGDUGRQHPLOHUDGLXVUHFRUGVVHDUFKZDVFRQGXFWHGRQ0D\E\&507(&+7KHUHFRUGV LQGLFDWHGWKDWQRIXUWKHUDUFKDHRORJLFDOVWXGLHVKDYHRFFXUUHGLQWKHSURMHFWDUHDVLQFHDQGQR DGGLWLRQDOVLWHVKDYHEHHQLGHQWLILHGRQWKHSURSHUW\,QWKHSURMHFWDUHDZDVLQFOXGHGLQDFLW\ZLGH VXUYH\IRFXVLQJRQEXLOWHQYLURQPHQWUHVRXUFHVRIKLVWRULFDORULJLQEXWQRQHZDVIRXQGLQRUQHDUWKH SURMHFWDUHD 2XWVLGHWKHSURMHFWDUHDEXWZLWKLQWKHRQHPLOHVFRSHKLVWRULFDOUHFRUGVLGHQWLILHGWKDWPRUHWKDQ SUHYLRXVFXOWXUDOUHVRXUFHVVWXGLHVKDYHEHHQFRPSOHWHGRQYDULRXVWUDFWVRIODQGDQGOLQHDUIHDWXUHV RIWKHPVLQFH&ROOHFWLYHO\WKHVHVWXGLHVFRYHUHGURXJKO\SHUFHQWRIWKHODQGZLWKLQWKHVFRSHRI WKHUHFRUGVDQGUHVXOWHGLQWKHLGHQWLILFDWLRQRIKLVWRULFDODUFKDHRORJLFDOVLWHVDQGLVRODWHVLH ORFDOLWLHVZLWKIHZHUWKDQWKUHHDUWLIDFWVZLWKLQWKHRQHPLOHUDGLXV1HDUO\DOORIWKHVHVLWHVDQGLVRODWHV ZHUHRISUHKLVWRULFRULJLQDQGPRVWZHUHIRXQGDORQJRUQHDUWKHDQFLHQWVKRUHOLQHRI/DNH&DKXLOOD 1RQHRIWKHVHVLWHVRULVRODWHVZDVIRXQGLQWKHLPPHGLDWHYLFLQLW\RIWKH3URMHFWDUHDEXWWKHLUSUHVHQFH FHUWDLQO\VXSSRUWVWKHKLJKDUFKDHRORJLFDOVHQVLWLYLW\DVVHVVPHQWIRUWKHSURMHFWYLFLQLW\ )LHOG,QVSHFWLRQ 2Q0D\&507(&+DUFKHRORJLVW'DQLHO%DOOHVWHU06FDUULHGRXWWKHILHOGLQVSHFWLRQE\ ZDONLQJDVHULHVRISDUDOOHOQRUWKVRXWKWUDQVHFWVVSDFHGPHWHUVDSSUR[LPDWHO\IHHWDSDUW 6XUYH\5HVXOWV ,QWKHSURMHFWDUHDZDVQRWHGDVIRUPHUDJULFXOWXUDOODQGWKDWKDGEHHQFOHDUHGRILWVJURYHVZLWKD UHFWDQJXODUVKDSHGPRXQGUHSUHVHQWLQJWKHPRGLILHGGXQHQHDU$YHQXH7KHUHSRUWQRWHGWKDW WKHVLQFHWKHUHSRUWWKHSURMHFWDUHDKDVXQGHUJRQHDGGLWLRQDOGLVWXUEDQFHIURPWKHLQVWDOODWLRQRI XQGHUJURXQGVHZDJHSLSHVDVHYLGHQFHGE\VHYHUDOPDQKROHVDFURVVWKHSURSHUW\7KHPRXQGKDVEHHQ UHPRYHGDQGDIRRW[IRRWHDUWKHQSDGKDVEHHQFUHDWHGQHDUWKHFHQWHURIWKHSURSHUW\VLQFH-XO\ *RRJOH(DUWK)XUWKHUPRUHWKHJURXQGVXUIDFHEHDUVHYLGHQFHRIUHFHQWPHFKDQLFDOFOHDULQJ 188 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 1RDUFKDHRORJLFDOIHDWXUHVRUDUWLIDFWVHLWKHUSUHKLVWRULFRUKLVWRULFDOZHUHHQFRXQWHUHGGXULQJWKHILHOG LQVSHFWLRQ 7KHVXUYH\FRQFOXGHGWKDWWKHRULJLQDOFRQFOXVLRQRIWKH3KDVH,,VWXG\WKDWWKHSURSRVHG GHYHORSPHQWZRXOGKDYH1R,PSDFWRQDQ\NQRZQ³KLVWRULFDOUHVRXUFHV´DVGHILQHGE\&(4$UHPDLQV YDOLGDQGDSSURSULDWHIRUWKHFXUUHQW3URMHFW1HYHUWKHOHVVLQOLJKWRISDVWGLVFRYHULHVLQWKHYLFLQLW\WKH RYHUDOODUFKDHRORJLFDOVHQVLWLYLW\RIWKHSURMHFWORFDWLRQUHPDLQVKLJKDQGWKHSRWHQWLDORIHQFRXQWHULQJ VXEVXUIDFHSUHKLVWRULFFXOWXUDOUHPDLQVZLWKLQWKHSURMHFWERXQGDULHVFDQQRWEHRYHUORRNHG&507HFK -XQH 3DOHRQWRORJLFDO5HVRXUFHV 7KH6DQ%HUQDUGLQR&RXQW\0XVHXPSHUIRUPHGD3DOHRQWRORJ\/LWHUDWXUH5HFRUGV5HYLHZRQ0D\ IRUWKHVXEMHFWSDUFHO$SSHQGL['7KHUHSRUWLGHQWLILHGWKDWDOWKRXJKWKHUHZHUHQRUHFRUGHG SDOHRQWRORJLFDOUHVRXUFHORFDOLWLHVDUHSUHVHQWZLWKLQWKHSURMHFWDUHDRUZLWKLQPLOHRIWKHSURMHFW SDOHRQWRORJLFDOUHVRXUFHVKDYHEHHQLGHQWLILHGRQVLWHVZLWKLQDSSUR[LPDWHO\PLOHVRIWKHSURSRVHG 3URMHFWVLWH$GGLWLRQDOO\WKH5LYHUVLGH&RXQW\¶V3DOHRQWRORJLFDO5HVRXUFH6HQVLWLYLW\0DS5&3760 LGHQWLILHVWKDWWKH3URMHFWVLWHLVORFDWHGRQVHGLPHQWDU\URFNVWKDWKDYHDKLJKSDOHRQWRORJLFDOVHQVLWLYLW\ 7KH&LW\¶V*HQHUDO3ODQ(,5DOVRLGHQWLILHVWKH3URMHFWDUHDDVRQHZLWK+LJK3DOHRQWRORJLFDO6HQVLWLYLW\ 7HUUD1RYD3ODQQLQJ 5HVHDUFK,QF-XO\ ,PSDFW$QDO\VLV±&XOWXUDO5HVRXUFHV a) Cause a substantial adverse change in the significance of a historical resource as defined in 15064.5? 1R,PSDFW+LVWRULFUHVRXUFHVJHQHUDOO\FRQVLVWRIEXLOGLQJVVWUXFWXUHVLPSURYHPHQWVDQGUHPQDQWV DVVRFLDWHGZLWKDVLJQLILFDQWKLVWRULFHYHQRUSHUVRQVDQGRUKDYHDKLVWRULFDOO\VLJQLILFDQWVW\OHGHVLJQ RUDFKLHYHPHQW'DPDJLQJRUGHPROLWLRQRIKLVWRULFUHVRXUFHVLVW\SLFDOO\FRQVLGHUHGWREHDVLJQLILFDQW LPSDFW,PSDFWVWRKLVWRULFUHVRXUFHVFDQRFFXUWKURXJKGLUHFWLPSDFWVVXFKDVGHVWUXFWLRQRUUHPRYDO DQGLQGLUHFWLPSDFWVVXFKDVDFKDQJHLQWKHVHWWLQJRIDKLVWRULFUHVRXUFH ,PSOHPHQWDWLRQRIWKHSURSRVHG3URMHFWZRXOGQRWFDXVHDVXEVWDQWLDODGYHUVHFKDQJHLQWKHVLJQLILFDQFH RIDKLVWRULFDOUHVRXUFHDVGHILQHGLQ$FFRUGLQJWRWKHUHFRUGVVHDUFKFRQGXFWHGIRUWKLVVLWHQR UHVRXUFHV WKDW DUH FRQVLGHUHG KLVWRULFDOO\ VLJQLILFDQW H[LVW RQ VLWH 7KHUHIRUH QR DGYHUVH LPSDFWV WR KLVWRULFUHVRXUFHVZRXOGRFFXU b) Cause a substantial adverse change in the significance of an archaeological resource pursuant to 15064.5? /HVV7KDQ6LJQLILFDQWZLWK0LWLJDWLRQ,QFRUSRUDWHG$UFKDHRORJLFDOVLWHVDUHORFDWLRQVWKDWFRQWDLQ UHVRXUFHVDVVRFLDWHGZLWKIRUPHUKXPDQDFWLYLWLHVDQGPD\FRQWDLQVXFKUHVRXUFHVDVKXPDQVNHOHWDO UHPDLQVZDVWHIURPWRROPDQXIDFWXUHWRROFRQFHQWUDWLRQVDQGRUGLVFRORUDWLRQRUDFFXPXODWLRQRIVRLORU IRRGUHPDLQV 7KH3KDVH,DQG3KDVH,,VWXG\UHVXOWVLQGLFDWHGWKDWWKHUHZRXOGEHQRLPSDFW+RZHYHUWKHVXUYH\ LGHQWLILHG WKDW EHFDXVH WKHUH KDYH EHHQ SDVW GLVFRYHULHV LQ WKH YLFLQLW\ WKH RYHUDOO DUFKDHRORJLFDO VHQVLWLYLW\RIWKHSURMHFWORFDWLRQUHPDLQVKLJKDQGWKHSRWHQWLDORIHQFRXQWHULQJVXEVXUIDFHSUHKLVWRULF FXOWXUDOUHPDLQVZLWKLQWKHSURMHFWERXQGDULHVLVDSRWHQWLDO 189 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 7KHUHIRUH DGYHUVH LPSDFWV WR DUFKDHRORJLFDO UHVRXUFHV ZRXOG EH OHVV WKDQ VLJQLILFDQW +RZHYHU 0LWLJDWLRQ 0HDVXUH &8/ ZLOO EH LPSOHPHQWHG WR DGGUHVV XQDQWLFLSDWHG GLVFRYHULHV RI FXOWXUDO UHVRXUFHV0LWLJDWLRQ0HDVXUHVDUHOLVWHGDWWKHHQGRIWKLVVHFWLRQ c) Directly or indirectly destroy a unique paleontological resource or site or unique geologic feature? /HVV7KDQ6LJQLILFDQWZLWK0LWLJDWLRQ,QFRUSRUDWHG,PSOHPHQWDWLRQRIWKHSURSRVHG3URMHFWFRXOG FDXVHDVXEVWDQWLDODGYHUVHFKDQJHLQWKHVLJQLILFDQFHRIDSDOHRQWRORJLFDOUHVRXUFHDVGHILQHGLQ VLQFH LW LV ORFDWHG LQ DQ DUHD RI +LJK 3DOHRQWRORJLFDO 6HQVLWLYLW\ ,W LV QRW DQWLFLSDWHG WKDW SURSRVHG H[FDYDWLRQV WR VXSSRUW WKH SURSRVHG 3URMHFW ZLOO HQFRXQWHU QDWLYH PDWHULDO WKDW FRXOG LPSDFW SDOHRQWRORJLFDOUHVRXUFHV+RZHYHU0LWLJDWLRQ0HDVXUH&8/ZLOOEHLPSOHPHQWHGWRDGGUHVV XQDQWLFLSDWHGGLVFRYHULHVRISDOHRQWRORJLFDOUHVRXUFHV0LWLJDWLRQ0HDVXUHVDUHOLVWHGDWWKHHQGRIWKLV VHFWLRQ d) Disturb any human remains, including those interred outside of formal cemeteries? /HVV7KDQ6LJQLILFDQWZLWK0LWLJDWLRQ,QFRUSRUDWHG,PSOHPHQWDWLRQRIWKHSURSRVHG3URMHFWZRXOG QRWGLVWXUEDQ\KXPDQUHPDLQVLQFOXGLQJWKRVHLQWHUUHGRXWVLGHRIIRUPDOFHPHWHULHV6KRXOGKXPDQ UHPDLQVEHIRXQGGXULQJFRQVWUXFWLRQ0LWLJDWLRQ0HDVXUH&8/ZRXOGUHGXFHDQ\SRWHQWLDOLPSDFWV WRDOHYHORIOHVVWKDQVLJQLILFDQW0LWLJDWLRQ0HDVXUHVDUHOLVWHGDWWKHHQGRIWKLVVHFWLRQ e) Cause a substantial adverse change in the significance of a tribal cultural resource as defined in Public Resources Code 21074? /HVV7KDQ6LJQLILFDQWZLWK0LWLJDWLRQ,QFRUSRUDWHG$OWKRXJKWKH3URMHFWVLWHLVORFDWHGLQDQDUHD WKDWKDVEHHQKRPHWR1DWLYH$PHULFDQWULEHVIRUFHQWXULHVWKH3URMHFWVLWHLVQRWDQWLFLSDWHGWRFRQWDLQ WULEDO FXOWXUDO UHVRXUFHV +RZHYHU0LWLJDWLRQ 0HDVXUH &8/DQG&8/ZLOOEHLPSOHPHQWHGWR DGGUHVVXQDQWLFLSDWHGGLVFRYHULHVRIFXOWXUDOUHVRXUFHV0LWLJDWLRQPHDVXUHVDUHOLVWHGDWWKHHQGRIWKLV VHFWLRQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGZLWKWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQIRUWKLVFULWHULRQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV &8/*UDGLQJDFWLYLWLHVVKDOOEHRYHUVHHQE\DTXDOLILHGDUFKHRORJLFDOPRQLWRU,QWKHHYHQW XQDQWLFLSDWHGDUFKDHRORJLFDOUHVRXUFHVDUHGLVFRYHUHG x7KH$UFKDHRORJLFDOPRQLWRUVKDOOQRWLI\WKHSURMHFWIRUHPDQ x7KH$UFKDHRORJLFDOPRQLWRUKDVWKHDXWKRULW\WRWHPSRUDULO\KDOWZRUNLQWKHDUHDRI DUFKDHRORJLFDOGLVFRYHULHVXQWLOWKHUHVRXUFHKDVEHHQHYDOXDWHG x$OOZRUNLQWKHYLFLQLW\RIWKHILQGVKDOOKDOW x:RUNLQWKHDUHDRIWKHGLVFRYHU\VKDOOQRWUHVXPHXQWLOZULWWHQQRWLILFDWLRQLV UHFHLYHGIURPWKH3URMHFWDUFKDHRORJLVW 190 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH &8/ *UDGLQJ DFWLYLWLHV VKDOO EH RYHUVHHQ E\ D TXDOLILHG SDOHRQWRORJLFDO PRQLWRU 3DOHRQWRORJLFDOPRQLWRUVVKRXOGEHHTXLSSHGWRVDOYDJHIRVVLOVDVWKH\DUHXQHDUWKHGWR DYRLGFRQVWUXFWLRQGHOD\VDQGWRUHPRYHVDPSOHVRIVHGLPHQWVWKDWDUHOLNHO\WRFRQWDLQ WKHUHPDLQVRIVPDOOIRVVLOLQYHUWHEUDWHVDQGYHUWHEUDWHV0RQLWRUVZLOOEHHPSRZHUHGWR WHPSRUDULO\KDOWRUGLYHUWHTXLSPHQWWRDOORZUHPRYDORIDEXQGDQWRUODUJHVSHFLPHQV 0RQLWRULQJZLOOEHUHGXFHGLIWKHSRWHQWLDOO\IRVVLOLIHURXVXQLWVDVGHVFULEHGE\WKH6DQ %HUQDUGLQR&RXQW\ 0XVHXP 'LYLVLRQ RI (DUWK 6FLHQFHV 0D\ UHSRUW DUH QRW SUHVHQW RU LI SUHVHQW DUH GHWHUPLQHG XSRQ H[SRVXUH DQG H[DPLQDWLRQ E\ TXDOLILHG SDOHRQWRORJLFDOSHUVRQQHOWRKDYHORZSRWHQWLDOWRFRQWDLQIRVVLOUHVRXUFHV &8/ ,IKXPDQUHPDLQVDUHHQFRXQWHUHGGXULQJWKHXQGHUWDNLQJ6WDWH+HDOWKDQG6DIHW\&RGH 6HFWLRQVWDWHVWKDWQRIXUWKHUGLVWXUEDQFHVKDOORFFXUXQWLOWKH&RXQW\&RURQHUKDV PDGH D GHWHUPLQDWLRQ RI RULJLQ DQG GLVSRVLWLRQ SXUVXDQW WR 3XEOLF 5HVRXUFHV &RGH 6HFWLRQ7KHORFDODXWKRULWLHVPXVWEHQRWLILHGRIWKHILQGLPPHGLDWHO\,IWKH UHPDLQVDUHGHWHUPLQHGWREHSUHKLVWRULFWKH&RURQHUZLOOQRWLI\WKH1DWLYH$PHULFDQ +HULWDJH &RPPLVVLRQ 1$+& ZKLFK ZLOO GHWHUPLQH DQG QRWLI\ D 0RVW /LNHO\ 'HVFHQGDQW 0/' :LWK WKH SHUPLVVLRQ RI WKH ODQGRZQHU RU KLVKHU DXWKRUL]HG UHSUHVHQWDWLYHWKH0/'PD\LQVSHFWWKHVLWHRIWKHGLVFRYHU\7KH0/'VKDOOFRPSOHWH WKHLQVSHFWLRQZLWKLQKRXUVRIQRWLILFDWLRQE\WKH1$+& ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHHIIHFWVDUHDQWLFLSDWHGZLWKWKHLQFOXVLRQRIWKHDERYHPLWLJDWLRQPHDVXUHV 191 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 9,*HRORJ\DQG6RLOV 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ :RXOGWKHSURMHFW D([SRVHSHRSOHRUVWUXFWXUHVWRSRWHQWLDOVXEVWDQWLDO DGYHUVHHIIHFWVLQFOXGLQJWKHULVNRIORVVLQMXU\RU GHDWKLQYROYLQJ ; x5XSWXUHRIDNQRZQHDUWKTXDNHIDXOWDV GHOLQHDWHGRQWKHPRVWUHFHQW$OTXLVW3ULROR (DUWKTXDNH)DXOW=RQLQJ0DSLVVXHGE\WKH 6WDWH*HRORJLVWIRUWKHDUHDRUEDVHGRQRWKHU VXEVWDQWLDOHYLGHQFHRIDNQRZQIDXOW"5HIHU WR'LYLVLRQRI0LQHVDQG*HRORJ\6SHFLDO 3XEOLFDWLRQ x6WURQJVHLVPLFJURXQGVKDNLQJ" x6HLVPLFUHODWHGJURXQGIDLOXUHLQFOXGLQJ OLTXHIDFWLRQ" x/DQGVOLGHV" E5HVXOWLQVXEVWDQWLDOVRLOHURVLRQRUWKHORVVRI WRSVRLO"; F%HORFDWHGRQDJHRORJLFXQLWRUVRLOWKDWLVXQVWDEOH RUWKDWZRXOGEHFRPHXQVWDEOHDVDUHVXOWRIWKH SURMHFWDQGSRWHQWLDOO\UHVXOWLQRQVLWHRURIIVLWH ODQGVOLGHODWHUDOVSUHDGLQJVXEVLGHQFHOLTXHIDFWLRQRU FROODSVH" ; G%HORFDWHGRQH[SDQVLYHVRLODVGHILQHGLQ7DEOH %RIWKH8QLIRUP%XLOGLQJ&RGHFUHDWLQJ VXEVWDQWLDOULVNVWROLIHRUSURSHUW\" ; H+DYHVRLOVLQFDSDEOHRIDGHTXDWHO\VXSSRUWLQJWKH XVHRIVHSWLFWDQNVRUDOWHUQDWLYHZDVWHZDWHUGLVSRVDO V\VWHPVZKHUHVHZHUVDUHQRWDYDLODEOHIRUWKH GLVSRVDORIZDVWHZDWHU" ; (QYLURQPHQWDO6HWWLQJ $JHRWHFKQLFDOUHSRUWZDVSUHSDUHGIRUWKHVLWHLQDQGXSGDWHGLQ/DQGPDUN*HR(QJLQHHUV DQG*HRORJLVWV$XJXVW 7KH SURMHFW VLWH LV DW WKH QRUWKHUQ SRUWLRQ RI WKH 6DOWRQ 7URXJK SK\VLRJUDSKLF SURYLQFH 7KH 6DOWRQ 7URXJKLVDJHRORJLFVWUXFWXUDOGHSUHVVLRQUHVXOWLQJIURPODUJHVFDOHUHJLRQDOIDXOWLQJ7KHWURXJKLV ERXQGHGRQWKHQRUWKHDVWE\WKH6DQ$QGUHDV)DXOWDQGWKHVRXWKZHVWE\IDXOWVRIWKH6DQ-DFLQWR)DXOW =RQH7KH6DOWRQ7URXJKUHSUHVHQWVWKHQRUWKZDUGH[WHQVLRQRIWKH*XOIRI&DOLIRUQLDZLWKFRQWLQXDOLQ ILOOLQJZLWKERWKPDULQHDQGQRQPDULQHVHGLPHQWVVLQFHWKH0LRFHQH(SRFK6RXWKODQG*HRWHFKQLFDO 1RYHPEHU 192 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH (DUWKTXDNH)DXOWV $UHYLHZRIWKHFXUUHQW$OTXLVW3ULROR(DUWKTXDNH)DXOW=RQHPDSVLQGLFDWHWKDWWKHQHDUHVWPDSSHG (DUWKTXDNH)DXOW=RQHLVWKH6DQ$QGUHDV&RDFKHOODIDXOWORFDWHGDSSUR[LPDWHO\PLOHQRUWKHDVWRI WKHSURMHFWVLWH/DQGPDUN*HR(QJLQHHUVDQG*HRORJLVWV$XJXVW 6RLOVDQG/LTXHIDFWLRQ /LTXHIDFWLRQRFFXUVZKHQDVDWXUDWHGRUSDUWLDOO\VDWXUDWHGVRLOVXEVWDQWLDOO\ORVHVVWUHQJWKDQGVWLIIQHVVLQ UHVSRQVHWRDQDSSOLHGVWUHVVXVXDOO\HDUWKTXDNHVKDNLQJRURWKHUVXGGHQFKDQJHLQVWUHVVFRQGLWLRQ FDXVLQJLWWREHKDYHOLNHDOLTXLG *URXQGZDWHUZDVHQFRXQWHUHGDWIHHWGHHSGXULQJH[SORUDWLRQHIIRUWVLQ*URXQGZDWHUZDVQRW HQFRXQWHUHGLQVDPSOLQJHIIRUWVZKLFKFRQVLVWHGRIWUHQFKH[FDYDWLRQWRDGHSWKRIEHWZHHQDQG IHHW*URXQGZDWHULVEHOLHYHGWRH[LVWDWDGHSWKRIIWEDVHGRQZDWHUOHYHOLQQHDUE\ZDWHUZHOOVLQ DVUHSRUWHGLQ86*6:DWHU5HVRXUFHV5HSRUW6RXWKODQG*HRWHFKQLFDO1RYHPEHU DQG/DQGPDUN*HR(QJLQHHUVDQG*HRORJLVWV$XJXVW 7KHILHOGH[SORUDWLRQFRQGXFWHGIURP2FWREHUWR1RYHPEHULQGLFDWHVWKDWWKHVXUILFLDODQG VXEVXUIDFHVRLOVFRQVLVWJHQHUDOO\PHGLXPGHQVH6LOW\6DQG6DQG\6LOWDQGILQH6DQG600/DQG63 60/D\HUVRI6DQG\6LOWWR6LOW0/H[LVWDWGHSWKVJUHDWHUWKDQIHHW7KHXSSHUVXUILFLDOVRLOVKDV YDU\LQJFRQFHQWUDWLRQVRIZRRGEUDQFKHVDQGURRWVIURPWKHROGFLWUXVJURYH6RXWKODQG*HRWHFKQLFDO 1RYHPEHU /DQGVOLGHV 7KHVLWHDQGWKHVXUURXQGLQJVDUHIODWDQGWKHUHDUHQRPRXQWDLQRXVRUKLOOVLGHDUHDVDGMDFHQWWRWKHVLWH :LQG(URVLRQ 0XFKRIWKH9DOOH\DUHLQ/D4XLQWDLVVXVFHSWLEOHWRZLQGDQGZLQGEORZQVDQGKD]DUGV7KLVPHDQV WKDWVRLOVPD\EHORRVHQHGDQGWUDQVSRUWHGGXULQJJUDGLQJDQGFRQVWUXFWLRQDFWLYLWLHV$FFRUGLQJWRWKH &LW\RI/D4XLQWD¶V*HQHUDO3ODQWKHSURMHFWVLWH¶V:LQG(URGLELOLW\5DWLQJLV³+LJK´ ,PSDFW$QDO\VLV±*HRORJ\DQG6RLOV a) Expose people or structures to potential substantial adverse effects, including the risk of loss, injury, or death involving: • Rupture of a known earthquake fault, as delineated on the most recent Alquist Priolo Earthquake Fault Zoning Map issued by the State Geologist for the area or based on other substantial evidence of a known fault? Refer to Division of Mines and Geology Special Publication 42. • Strong seismic ground shaking? • Seismic related ground failure, including liquefaction? • Landslides? /HVV7KDQ6LJQLILFDQW7KH3URMHFWVLWHOLHVZLWKLQDVHLVPLFDOO\DFWLYHUHJLRQRI6RXWKHUQ&DOLIRUQLD $FFRUGLQJWR$OTXLVW3ULROR(DUWKTXDNH)DXOW=RQHPDSVWKH3URMHFWVLWHLVQRWORFDWHGLQDQ$OTXLVW 3ULROR6SHFLDO6WXG\=RQHQRULVWKH3URMHFWVLWHRULWVLPPHGLDWHYLFLQLW\VLWXDWHGDERYHDQ\DFWLYHIDXOWV 7RPLQLPL]HSRWHQWLDOGDPDJHWRWKHSURSRVHGDFFHVVURDGDQGURFNSODFHPHQWFDXVHGE\JURXQGVKDNLQJ 193 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH DOOFRQVWUXFWLRQZRXOGFRPSO\ZLWKWKHODWHVW8QLIRUP%XLOGLQJ&RGHDQGDQ\DSSOLFDEOHFULWHULDVHWIRUWK E\WKH&LW\DQGZRXOGQRWH[SRVHSHRSOHRUVWUXFWXUHVWRSRWHQWLDODGYHUVHHIIHFWVLQFOXGLQJWKHULVNRI ORVV LQMXU\ RU GHDWK LQYROYLQJ WKH UXSWXUH RI NQRZQ HDUWKTXDNH IDXOWV ,PSDFWV DVVRFLDWHG ZLWK WKH UXSWXUHRIDNQRZQHDUWKTXDNHIDXOWDUHFRQVLGHUHGOHVVWKDQVLJQLILFDQW /LTXHIDFWLRQRFFXUVSULPDULO\LQVDWXUDWHGORRVHILQHWRPHGLXPJUDLQHGVRLOVLQDUHDVZKHUHWKHJURXQG ZDWHUWDEOHLVIHHWRUOHVVEHORZWKHJURXQGVXUIDFH:KHQWKHVHVHGLPHQWVDUHVKDNHQVXFKDVGXULQJ DQHDUWKTXDNHDVXGGHQLQFUHDVHLQSRUHZDWHUSUHVVXUHFDXVHVWKHVRLOVWRORVHVWUHQJWKDQGEHKDYHDVD OLTXLG7KHUHVXOWLQJIHDWXUHVDUHFDOOHGVDQGERLOVVDQGEORZVRUVDQGYROFDQRHV/LTXHIDFWLRQUHODWHG HIIHFWVLQFOXGHORVVRIEHDULQJVWUHQJWKJURXQGRVFLOODWLRQVDQGODWHUDOVSUHDGLQJ $FFRUGLQJWRWKHDQDO\VLVFRQGXFWHGIRUWKHDQG)DLUZD\6SHFLILF3ODQDSSURYDOVWKHSURSRVHG SURMHFWRFFXULQD=RQH,OOJURXQGVKDNLQJ]RQHDSSUR[LPDWHO\RQHTXDUWHUPLOHHDVWRIDQLQIHUUHGDQG LQDFWLYHIDXOW7KHSURMHFWVLWHFDQH[SHFWWRH[SHULHQFHVLJQLILFDQWJURXQGVKDNLQJLQWKHHYHQWRIDPDMRU HDUWKTXDNH LQ WKH &RDFKHOOD 9DOOH\ ,Q RUGHU WR PLWLJDWH WKH SRWHQWLDO LPSDFWV RI JURXQGVKDNLQJ RQ EXLOGLQJVWKURXJKRXWWKH&LW\WKH%XLOGLQJ'HSDUWPHQWKDVLPSOHPHQWHGWKH8QLIRUP%XLOGLQJ&RGHDV DPHQGHGZKLFKUHTXLUHVUHLQIRUFHGFRQVWUXFWLRQLQJURXQGVKDNLQJ]RQHV 7KH3URMHFWVLWHGRHVQRWRFFXULQDQDUHDSURQHWROLTXHIDFWLRQDQGLWVGLVWDQFHIURPDQDFWLYHIDXOW PDNHVJURXQGUXSWXUHXQOLNHO\/DQGPDUN$XJXVW7KH3URMHFWZLOOEHUHTXLUHGWRPHHWWKH &LW\¶V%XLOGLQJVWDQGDUGVWKHUHE\UHGXFLQJWKHSRWHQWLDOLPSDFWIURPJURXQGVKDNLQJKD]DUGVWRDOHVV WKDQVLJQLILFDQWOHYHO:DUQHU(QJLQHHULQJ)HEUXDU\ b) Result in substantial soil erosion or the loss of topsoil? /HVV7KDQ6LJQLILFDQWZLWK0LWLJDWLRQ,QFRUSRUDWHG0LQRUVRLOHURVLRQPD\RFFXUGXULQJWKHJUDGLQJ DQGFRQVWUXFWLRQSHULRGRIWKHQHZEXLOGLQJV7KHSURMHFWVLWHRFFXUVZLWKLQWKH&LW\ VEORZVDQGKD]DUG DUHDZKHUHVRLOVDWWKH3URMHFWVLWHKDYHDKLJKSRWHQWLDOIRUZLQGHURVLRQ,PSOHPHQWDWLRQRI0LWLJDWLRQ 0HDVXUHV*(2DQG*(2ZLOOUHGXFHWKHLPSDFWVWROHVVWKDQVLJQLILFDQW0LWLJDWLRQPHDVXUHVDUH OLVWHGDWWKHHQGRIWKLVVHFWLRQ c) Be located on a geologic unit or soil that is unstable, or that would become unstable as a result of the project, and potentially result in onsite or offsite landslide, lateral spreading, subsidence, liquefaction or collapse? /HVV 7KDQ 6LJQLILFDQW 8QVWDEOH VRLOV WKDW FDQ UHVXOW LQ D ODQGVOLGH ODWHUDO VSUHDGLQJ VXEVLGHQFH OLTXHIDFWLRQRUFROODSVHJHQHUDOO\RFFXUVLQZKHQVKDOORZJURXQGZDWHUOLTXHILHVVRLOHVSHFLDOO\GXULQJD VHLVPLFHYHQW7KH3URMHFWVLWHLVJHQHUDOO\IODWDQGIXOO\JUDGHG7KHJHRWHFKQLFDOUHSRUWVSUHSDUHGIRU WKH3URMHFWLGHQWLI\WKDWOLTXHIDFWLRQLVXQOLNHO\GXHWRJURXQGZDWHUEHLQJJUHDWHUWKDQIHHW/DQGPDUN $XJXVW7KHUHIRUHWKHULVNRIVRLOLQVWDELOLW\LVORZ,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW d) Be located on expansive soil, as defined in Table 18-1-B of the Uniform Building Code (1994), creating substantial risks to life or property? /HVV7KDQ6LJQLILFDQW([SDQVLYHVRLOLVW\SLFDOO\FOD\RUDVRLOW\SHWKDWLVSURQHWRODUJHYROXPH FKDQJHVVZHOOLQJDQGVKULQNLQJWKDWDUHGLUHFWO\UHODWHGWRFKDQJHVLQZDWHUFRQWHQW 7KHJHRWHFKQLFDOUHSRUWLQGLFDWHVWKDWWKHVXUILFLDODQGVXEVXUIDFHVRLOVFRQVLVWJHQHUDOO\PHGLXPGHQVH 6LOW\6DQG6DQG\6LOWDQGILQH6DQG600/DQG6360/D\HUVRI6DQG\6LOWWR6LOW0/H[LVWDW GHSWKVJUHDWHUWKDQIHHW7KHXSSHUVXUILFLDOVRLOVKDGYDU\LQJFRQFHQWUDWLRQVRIZRRGEUDQFKHVDQG URRWVIURPWKHROGFLWUXVJURYH 194 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH ,QDULGFOLPDWLFUHJLRQVJUDQXODUVRLOVKDYHDSRWHQWLDOWRFROODSVHXSRQZHWWLQJ&ROODSVHSRWHQWLDOWHVWV SHUIRUPHGLQLQGLFDWHDSRWHQWLDORIDQGSHUFHQWFROODSVHXSRQLQXQGDWLRQDQGDUHFRQVLGHUHG DPRGHUDWHVLWHULVN 7KH3URMHFWZLOOEHFRQVWUXFWHGXVLQJWKHODWHVWHQJLQHHULQJDQGFRQVWUXFWLRQSUDFWLFHVZKLFKLQFOXGH GHYHORSLQJWKHEXLOGLQJIRXQGDWLRQVLQDPDQQHUWKDWLQFOXGHVRYHUH[FDYDWLRQDQGUHFRPSDFWLRQRIWKH ]RQH EHQHDWK WKH EXLOGLQJ SDGV WR PLWLJDWH IRU WKH SRWHQWLDO RI K\GURFRQVROLGDWLRQ FDXVHG E\ VRLO VDWXUDWLRQIURPODQGVFDSHLUULJDWLRQRUEURNHQXWLOLW\OLQHVE\RYHUH[FDYDWLRQDQGUHFRPSDFWLRQRIWKH ]RQHEHQHDWKEXLOGLQJSDGV7KHUHIRUHWKHLPSDFWLVOHVVWKDQVLJQLILFDQW e) Have soils incapable of adequately supporting the use of septic tanks or alternative wastewater disposal systems where sewers are not available for the disposal of wastewater? 1R,PSDFW7KH3URMHFWGRHVQRWLQFOXGHWKHXVHRIVHSWLFV\VWHPV7KXVQRLPSDFWVZRXOGRFFXU 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGZLWKWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQIRUWKLVFULWHULRQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV *(2 3ULRUWRJUDGLQJSODQDSSURYDOVXEPLWIRUUHYLHZDQGDSSURYDOE\WKH&LW\(QJLQHHUD 30OPDQDJHPHQWSODQ *(2 )RUSRUWLRQVRIWKHVLWHQRWLPPHGLDWHO\XQGHUFRQVWUXFWLRQHQVXUHWKHVWDELOL]DWLRQRI VRLOV WKURXJK WKH XVH RI VRLO FHPHQW RU UHYHJHWDWLRQ IUHTXHQW ZDWHULQJ LQFOXGLQJ ZDWHULQJ GXULQJ WKH HYHQLQJ DQG ZHHNHQGV GXULQJ VLJQLILFDQW ZLQG HYHQWV VWUHHW VZHHSLQJ RU ZDVKLQJ GXULQJ FRQVWUXFWLRQ DQG WKH FKHPLFDO VWDELOL]DWLRQ RI XQSDYHG FRQVWUXFWLRQURDGZD\V ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHHIIHFWVDUHDQWLFLSDWHGZLWKWKHLQFOXVLRQRIWKHDERYHPLWLJDWLRQPHDVXUHV 195 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ 9,,*UHHQKRXVH*DV(PLVVLRQV :RXOGWKHSURMHFW D*HQHUDWHJUHHQKRXVHJDVHPLVVLRQVHLWKHUGLUHFWO\ RULQGLUHFWO\WKDWPD\KDYHDVLJQLILFDQWLPSDFWRQWKH HQYLURQPHQW" ; E&RQIOLFWZLWKDQDSSOLFDEOHSODQSROLF\RU UHJXODWLRQDGRSWHGIRUWKHSXUSRVHRIUHGXFLQJWKH HPLVVLRQVRIJUHHQKRXVHJDVHV" ; %DFNJURXQG /XQGLQ 'HYHORSPHQW LV SURSRVLQJ D VTXDUHIRRW PL[HGXVHFRPPHUFLDOFHQWHUSURMHFWRQ DSSUR[LPDWHO\DFUHV,Q0D\WKH&LW\RI/D4XLQWDDSSURYHGDVTXDUHIRRWPL[HGXVH FRPPHUFLDOFHQWHU6SHFLILF3ODQIRUWKHDFUH3URMHFW6LWH7KHDSSURYDORIWKH6SHFLILF3ODQLQFOXGHG DGRSWLRQRID0LWLJDWHG1HJDWLYH'HFODUDWLRQ01'7KH&LW\DOVRDGRSWHGD6WDWHPHQWRI2YHUULGLQJ &RQVLGHUDWLRQVIRUVLJQLILFDQWDQGXQDYRLGDEOHDLUTXDOLW\LPSDFWVLGHQWLILHGLQWKHXSGDWHG*HQHUDO3ODQ (,5RQ)HEUXDU\7KHUHIRUHWKHDQDO\VLVKHUHLQLVEDVHGRQWKHQHWLQFUHDVHRIDSSUR[LPDWHO\ VTXDUHIHHW RI QHZ XVHV QRW SUHYLRXVO\ UHYLHZHG RU DSSURYHG LQ WKH 6SHFLILF 3ODQ DQG VXEVHTXHQW8SGDWHG*HQHUDO3ODQ &(4$DQG*UHHQKRXVH*DVHV $FFRUGLQJWR&(4$*XLGHOLQHV6HFWLRQZKHQPDNLQJDGHWHUPLQDWLRQRIWKHVLJQLILFDQFHRI JUHHQKRXVH JDV HPLVVLRQV WKH ³OHDG DJHQF\ VKDOO KDYH GLVFUHWLRQ WR GHWHUPLQH LQ WKH FRQWH[W RI D SDUWLFXODUSURMHFWZKHWKHUWRXVHDPRGHORUPHWKRGRORJ\WRTXDQWLI\JUHHQKRXVHJDVHPLVVLRQV UHVXOWLQJIURPDSURMHFWDQGZKLFKPRGHORUPHWKRGRORJ\WRXVH´,QDGGLWLRQ&(4$*XLGHOLQHVVHFWLRQ FSURYLGHVWKDW³DOHDGDJHQF\PD\FRQVLGHUWKUHVKROGVRIVLJQLILFDQFHSUHYLRXVO\DGRSWHGRU UHFRPPHQGHGE\RWKHUSXEOLFDJHQFLHVRUUHFRPPHQGHGE\H[SHUWV´RQWKHFRQGLWLRQWKDW³WKHGHFLVLRQ RIWKHOHDGDJHQF\WRDGRSWVXFKWKUHVKROGVLVVXSSRUWHGE\VXEVWDQWLDOHYLGHQFH´ 7KH 3URSRVHG 3URMHFW LV ORFDWHG ZLWKLQ WKH &LW\ RI /D 4XLQWD 7KH &LW\ RI /D 4XLQWD DGRSWHG D *UHHQKRXVH*DV5HGXFWLRQ3ODQ3ODQRQ)HEUXDU\WK7KH3ODQSURYLGHVUHGXFWLRQVWUDWHJLHV DQGUHGXFWLRQPHDVXUHVWKDWFDQUHGXFHJUHHQKRXVHJDVHPLVVLRQVDWWKHLUVRXUFHDQGDWWKHHQGXVHE\ LPSURYLQJ RSHUDWLQJ HIILFLHQF\ LQFUHDVLQJ UHOLDQFH RQ UHQHZDEOH VRXUFH IRU HQHUJ\ SURGXFWLRQ GHYHORSLQJQHZWHFKQRORJLHVDQGWKURXJKFRQVHUYDWLRQ7KHVHUHGXFWLRQPHDVXUHVDUHOLVWHGLQ7DEOH RIWKH3ODQDQGFDQEHLPSOHPHQWHGDVQHHGHGGXULQJWKHGHVLJQSKDVH+RZHYHUWKH&LW\GRHVQRWKDYH WKHLU RZQ WKUHVKROGV RI VLJQLILFDQFH IRU JUHHQKRXVH JDV HPLVVLRQV 7KH &LW\ ILQGV SHUVXDVLYH DQG UHDVRQDEOH WKH DSSURDFK WR GHWHUPLQLQJ VLJQLILFDQFH RI JUHHQKRXVH JDV HPLVVLRQV HVWDEOLVKHG E\ 6&$40' ,PSDFW$QDO\VLV D *HQHUDWHJUHHQKRXVHJDVHPLVVLRQVHLWKHUGLUHFWO\RULQGLUHFWO\WKDWPD\KDYHDVLJQLILFDQWLPSDFW RQWKHHQYLURQPHQW" 196 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH /HVV7KDQ6LJQLILFDQW7KH3URSRVHG3URMHFWLVORFDWHGZLWKLQWKH&RPPXQLW\&RPPHUFLDO&&ODQG XVHGHVLJQDWLRQRIWKH6SHFLILF3ODQ*HQHUDO3ODQ7KHSURSRVHGPL[HGXVHFRPPHUFLDOXVHVDUHDOORZHG ZLWKLQWKH&&ODQGXVHDUHDZKLFKKDYHEHHQUHYLHZHGDQGDSSURYHGZLWKLQWKH*HQHUDO3ODQ XSGDWH7KHSURMHFWZDVSUHYLRXVO\UHYLHZHGDQGDSSURYHGDVWKH)DLUZD\3OD]D6KRSSLQJ&HQWHU3URMHFW 6XEVHTXHQWO\D6WDWHPHQWRI2YHUULGLQJ&RQVLGHUDWLRQVIRUVLJQLILFDQWDQGXQDYRLGDEOHDLU TXDOLW\DQG*UHHQKRXVH*DVLPSDFWVLGHQWLILHGLQWKHXSGDWHG*HQHUDO3ODQ(,5RQ)HEUXDU\ ZDVDGRSWHG$SSURYDORIWKHSURSRVHGUHYLVLRQZRXOGQRWUHTXLUHD]RQHFKDQJHQRUD*HQHUDO3ODQ $PHQGPHQW7KHUHIRUHWKHGHOWDZDVUHYLHZHG (PLVVLRQVZHUHHVWLPDWHGXVLQJWKH&DO((0RGYHUVLRQ$SSHQGL[%7KHDQDO\VLVSUHSDUHGIRU WKH 3URSRVHG 3URMHFW DVVXPHG WKH FRQVWUXFWLRQ RI DQ DGGLWLRQDO VTXDUHIHHW RI PL[HGXVH FRPPHUFLDOXVHVRQWKHDFUH3URMHFW6LWH&RQVWUXFWLRQZDVDQWLFLSDWHGWREHJLQDSSUR[LPDWHO\HDUO\ DQG EH FRPSOHWHG LQ ODWH 2WKHU SDUDPHWHUV ZKLFK ZHUH XVHG WR HVWLPDWH FRQVWUXFWLRQ HPLVVLRQVVXFKDVWKHZRUNHUDQGYHQGRUWULSVDQGWULSOHQJWKVZHUHEDVHGRQWKH&DO((0RGGHIDXOWV7KH 7,$GHWHUPLQHGWKDWWKH3URSRVHG3URMHFWZRXOGJHQHUDWHDSSUR[LPDWHO\GDLO\WULSV7ULSVZHUH EURNHQGRZQE\ODQGXVHW\SHDQGODQGXVHVL]H7KH7,$DOVRLQFOXGHGDSHUFHQWUHGXFWLRQLQWUDIILF WRDFFRXQWIRUSDVVE\FUHGLW$VWKH3URSRVHG3URMHFWLVHYDOXDWHGDVWKH6SHFLILF3ODQGHOWDRI VTXDUHIHHWRIQHZXVHVDSSUR[LPDWHO\SHUFHQWJUHDWHUWKDQZDVDSSURYHGLQWKH6SHFLILF3ODQ GDLO\WULSVDSSUR[LPDWHO\SHUFHQWRIWKHGHYHORSPHQWEDVHGRQPRUHLQWHQVHXVHVZHUHPRGHOHGWR UHSUHVHQWDZRUVWFDVHVFHQDULR$GGLWLRQDOO\WKHVLWH]RQLQJLV&RPPXQLW\&RPPHUFLDOZKLFKDOORZV IRUD0D[LPXP)ORRU$UHD5DWLR>)$5@JURVVIORRUDUHDRIDOOEXLOGLQJVGLYLGHGE\WKHEXLOGLQJVLWH DUHD7KHSURSRVHG3URMHFWUHSUHVHQWVDSSUR[LPDWHO\)$57KHUHIRUHEHFDXVHWKH3URMHFWSURSRVHV WRXVHOHVVWKDQWKHPD[LPXPDOORZHGXQGHUWKH]RQLQJDOHVVWKDQVLJQLILFDQWLPSDFWLVDQWLFLSDWHG 0DQ\JDVHVPDNHXSWKHJURXSRISROOXWDQWVWKDWDUHEHOLHYHGWRFRQWULEXWHWRJOREDOFOLPDWHFKDQJH +RZHYHUWKUHHJDVHVDUHFXUUHQWO\HYDOXDWHGDQGUHSUHVHQWWKHKLJKHVWFRQFHQWUDWLRQRI*+*&DUERQ GLR[LGH&20HWKDQH&+DQG1LWURXVR[LGH126&$40'SURYLGHVJXLGDQFHPHWKRGVDQGRU (PLVVLRQ )DFWRUV WKDW DUH XVHG IRU HYDOXDWLQJ D SURMHFW¶V HPLVVLRQV LQ UHODWLRQ WR WKH WKUHVKROGV $ WKUHVKROGRI07&2(SHU\HDUKDVEHHQDGRSWHGE\6&$40'IRUQRQLQGXVWULDOW\SHSURMHFWVDV SRWHQWLDOO\VLJQLILFDQWRUJOREDOZDUPLQJ'UDIW*XLGDQFH'RFXPHQW±,QWHULP&(4$*UHHQKRXVH*DV *+*6LJQLILFDQFH7KUHVKROG6&$40'2FWREHU7KHPRGHOHGHPLVVLRQVDQWLFLSDWHGIURPWKH 3URSRVHG3URMHFWFRPSDUHGWRWKH6&$40'WKUHVKROGVDUHVKRZQEHORZLQ7DEOHDQG7DEOH 7DEOH *UHHQKRXVH*DV&RQVWUXFWLRQ(PLVVLRQV0HWULF7RQVSHU<HDU 6RXUFH3KDVH &2 &+ 1 6LWH3UHSDUDWLRQ *UDGLQJ %XLOGLQJ&RQVWUXFWLRQ 3DYLQJ $UFKLWHFWXUDO&RDWLQJ 7RWDO07&2H 6&$40'7KUHVKROG 6LJQLILFDQW 12 6RXUFH&DO((0RG$QQXDO(PLVVLRQV 197 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 7DEOH *UHHQKRXVH*DV2SHUDWLRQDO(PLVVLRQV0HWULF7RQVSHU<HDU 6RXUFH3KDVH &2 &+ 1 $UHD (QHUJ\ 0RELOH :DVWH :DWHU 07&2H 6&$40'7KUHVKROG 6LJQLILFDQW 12 6RXUFH&DO((0RG$QQXDO(PLVVLRQV $VVKRZQLQ7DEOHDQG7DEOHWKH3URSRVHG3URMHFW¶VHPLVVLRQVZRXOGQRWH[FHHGWKH6&$40'¶V 07&2H WKUHVKROG RI VLJQLILFDQFH DQG WKHUHIRUH ZRXOG KDYH OHVV WKDQ VLJQLILFDQW LPSDFW IRU JUHHQKRXVHJDVHPLVVLRQVQRPLWLJDWLRQPHDVXUHVDUHUHTXLUHG E &RQIOLFWZLWKDQDSSOLFDEOHSODQSROLF\RUUHJXODWLRQDGRSWHGIRUWKHSXUSRVHRIUHGXFLQJWKH HPLVVLRQVRIJUHHQKRXVHJDVHV" /HVV7KDQ6LJQLILFDQW7KHUHDUHQRH[LVWLQJ*+*SODQVSROLFLHVRUUHJXODWLRQVWKDWKDYHEHHQDGRSWHG E\&$5%RU6&$40'WKDWZRXOGDSSO\WRWKLVW\SHRIHPLVVLRQVVRXUFH+RZHYHUWKHRSHUDWRUVKDOO FRPSO\ZLWK&$5%DQG6&$40'UHJXODWLRQVUHODWHGWRGLHVHOIXHOHGWUXFNVZKLFKPD\LQFOXGHDPRQJ RWKHUVPHHWLQJPRUHVWULQJHQWHPLVVLRQVWDQGDUGVUHWURILWWLQJH[LVWLQJHQJLQHVZLWKSDUWLFXODWH WUDSVXVHRIORZVXOIXUIXHODQGXVHRIDOWHUQDWLYHIXHOVRUHTXLSPHQW ,W LV SRVVLEOH WKDW &$5% PD\ GHYHORS SHUIRUPDQFH VWDQGDUGV IRU3URMHFWUHODWHG DFWLYLWLHV SULRU WR FRQVWUXFWLRQRIWKH3URSRVHG3URMHFW,QWKLVHYHQWWKHVHSHUIRUPDQFHVWDQGDUGVZRXOGEHLPSOHPHQWHG DQGDGKHUHGWRDQGWKHUHZRXOGEHQRFRQIOLFWZLWKDQ\DSSOLFDEOHSODQSROLF\RUUHJXODWLRQ 7KH&LW\RI/D4XLQWDDGRSWHGD*UHHQKRXVH*DV5HGXFWLRQ3ODQ3ODQRQ)HEUXDU\WK7KH 3ODQSURYLGHVUHGXFWLRQVWUDWHJLHVDQGUHGXFWLRQPHDVXUHVWKDWFDQUHGXFHJUHHQKRXVHJDVHPLVVLRQVDW WKHLU VRXUFH DQG DW WKH HQG XVH E\ LPSURYLQJ RSHUDWLQJ HIILFLHQF\ LQFUHDVLQJ UHOLDQFH RQ UHQHZDEOH VRXUFHV IRU HQHUJ\ SURGXFWLRQ GHYHORSLQJ QHZ WHFKQRORJLHV DQG WKURXJK FRQVHUYDWLRQ 'XULQJ WKH GHYHORSPHQWUHYLHZSURFHVVWKH&LW\ZRXOGLPSOHPHQWDVIHDVLEOHQHFHVVDU\GHYHORSPHQWXSJUDGHVWR IXUWKHUUHGXFH*+*IRRWSULQW7KHUHIRUHLPSDFWVZRXOGEHOHVVWKDQVLJQLILFDQWDQGQRPLWLJDWLRQZRXOG EHUHTXLUHG7KH3URSRVHG3URMHFWLVFRQVLVWHQWZLWK&$5%VFRSLQJPHDVXUHVDQGWKHUHIRUHGRHVQRW FRQIOLFWZLWKORFDORUUHJLRQDOJUHHQKRXVHJDVSODQV $GGLWLRQDOO\WKH&LW\RI/D4XLQWDUHTXLUHVDOOQHZGHYHORSPHQWWRFRPSO\ZLWKWKH&DOLIRUQLD7LWOH %XLOGLQJ(QHUJ\(IILFLHQF\6WDQGDUGVZKLFKDUHGHVLJQHGWRHQVXUHQHZDQGH[LVWLQJEXLOGLQJVDFKLHYH HQHUJ\HIILFLHQF\DQGSUHVHUYHRXWGRRUDQGLQGRRUHQYLURQPHQWDOTXDOLW\ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGZLWKWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQIRUWKLVFULWHULRQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV 198 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 1RPLWLJDWLRQPHDVXUHVDUHUHTXLUHG ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHLPSDFWVDUHLGHQWLILHGRUDQWLFLSDWHGDQGQRPLWLJDWLRQPHDVXUHVDUHUHTXLUHG 199 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ 9,,,+D]DUGVDQG+D]DUGRXV0DWHULDOV :RXOGWKHSURMHFW D&UHDWHDVLJQLILFDQWKD]DUGWRWKHSXEOLFRUWKH HQYLURQPHQWWKURXJKWKHURXWLQHWUDQVSRUWXVHRU GLVSRVDORIKD]DUGRXVPDWHULDOV" ; E&UHDWHDVLJQLILFDQWKD]DUGWRWKHSXEOLFRUWKH HQYLURQPHQWWKURXJKUHDVRQDEO\IRUHVHHDEOHXSVHWDQG DFFLGHQWFRQGLWLRQVLQYROYLQJWKHUHOHDVHRIKD]DUGRXV PDWHULDOVLQWRWKHHQYLURQPHQW" ; F(PLWKD]DUGRXVHPLVVLRQVRUKDQGOHKD]DUGRXVRU DFXWHO\KD]DUGRXVPDWHULDOVVXEVWDQFHVRUZDVWH ZLWKLQRQHTXDUWHUPLOHRIDQH[LVWLQJRUSURSRVHG VFKRRO" ; G%HORFDWHGRQDVLWHZKLFKLVLQFOXGHGRQDOLVWRI KD]DUGRXVPDWHULDOVVLWHVFRPSLOHGSXUVXDQWWR *RYHUQPHQW&RGH6HFWLRQDQGDVDUHVXOW ZRXOGLWFUHDWHDVLJQLILFDQWKD]DUGWRWKHSXEOLFRUWKH HQYLURQPHQW" ; H)RUDSURMHFWORFDWHGZLWKLQDQDLUSRUWODQGXVHSODQ RUZKHUHVXFKDSODQKDVQRWEHHQDGRSWHGZLWKLQWZR PLOHVRIDSXEOLFDLUSRUWRUSXEOLFXVHDLUSRUWZRXOG WKHSURMHFWUHVXOWLQDVDIHW\KD]DUGIRUSHRSOHUHVLGLQJ RUZRUNLQJLQWKHSURMHFWDUHD" ; I)RUDSURMHFWZLWKLQWKHYLFLQLW\RIDSULYDWHDLUVWULS ZRXOGWKHSURMHFWUHVXOWLQDVDIHW\KD]DUGIRUSHRSOH UHVLGLQJRUZRUNLQJLQWKHSURMHFWDUHD" ; J,PSDLULPSOHPHQWDWLRQRIRUSK\VLFDOO\LQWHUIHUH ZLWKDQDGRSWHGHPHUJHQF\UHVSRQVHSODQRU HPHUJHQF\HYDFXDWLRQSODQ" ; K([SRVHSHRSOHRUVWUXFWXUHVWRDVLJQLILFDQWULVNRI ORVVLQMXU\RUGHDWKLQYROYLQJZLOGODQGILUHV LQFOXGLQJZKHUHZLOGODQGVDUHDGMDFHQWWRXUEDQL]HG DUHDVRUZKHUHUHVLGHQFHVDUHLQWHUPL[HGZLWK ZLOGODQGV" ; (QYLURQPHQWDO6HWWLQJ 7KH3URMHFWVLWHKDVKLVWRULFDOO\EHHQYDFDQW7KHJHQHUDODUHDVXUURXQGLQJWKH3URMHFWVLWHFRQVLVWVRI UHVLGHQWLDODQGFRPPHUFLDOXVHV ,PSDFW$QDO\VLV D &UHDWHDVLJQLILFDQWKD]DUGWRWKHSXEOLFRUWKHHQYLURQPHQWWKURXJKWKHURXWLQHWUDQVSRUWXVHRU GLVSRVDORIKD]DUGRXVPDWHULDOV" 200 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH /HVV7KDQ6LJQLILFDQW:LWK0LWLJDWLRQ,QFRUSRUDWHG+D]DUGRXVVXEVWDQFHVDQGZDVWHVZRXOGEH XVHGGXULQJFRQVWUXFWLRQRIWKHQHZEXLOGLQJ7KHVHZRXOGLQFOXGHIXHOVIRUPDFKLQHU\DQGYHKLFOHVQHZ DQGXVHGPRWRURLOVDQGVWRUDJHFRQWDLQHUVDQGDSSOLFDWRUVFRQWDLQLQJVXFKPDWHULDOV7KHSRWHQWLDOH[LVWV IRUORFDOL]HGVSLOOVRISHWUROHXPEDVHGSURGXFWVRURWKHUFKHPLFDOVGXULQJFRQVWUXFWLRQ7KHVHVSLOOVFRXOG H[SRVHFRQVWUXFWLRQZRUNHUVDQGWKHSXEOLFWRKD]DUGRXVPDWHULDOVHLWKHUGLUHFWO\DWWKHVLWHRIWKHVSLOO RULQGLUHFWO\E\LQWURGXFLQJWKHVHVXEVWDQFHVLQWRVWRUPZDWHUUXQRII$OOGHYHORSPHQWUHTXLULQJJURXQG GLVWXUEDQFHZRXOGEHVXEMHFWWRUHJLRQDODQGORFDOUHJXODWLRQVLQFOXGLQJWKHQHHGIRUDQ6:333XQGHU WKH 13'(6 *HQHUDO 3HUPLW IRU 6WRUP :DWHU 'LVFKDUJHV $VVRFLDWHGZLWK &RQVWUXFWLRQ $FWLYLW\ &RQVWUXFWLRQ*HQHUDO3HUPLW2UGHU1R':413'(61R&$5,QDGGLWLRQWKH &LW\ UHTXLUHV D JUDGLQJ SHUPLW IRU DOO GHYHORSPHQWV WKDW ZRXOGUHTXLUH JUDGLQJ &RPSOLDQFH ZLWK 6:5&%µV*HQHUDO&RQVWUXFWLRQ$FWLYLW\6WRUPZDWHU3HUPLWUHJXODWLRQVUHTXLULQJD6:333DQGWKH JUDGLQJSHUPLWUHTXLUHGE\WKH&LW\ZRXOGHQVXUHKD]DUGRXVPDWHULDOVJHQHUDWHGGXULQJFRQVWUXFWLRQ ZRXOGQRWFUHDWHDVLJQLILFDQWLPSDFW$GGLWLRQDOO\FRQVWUXFWLRQLVDQWLFLSDWHGEHWHPSRUDU\WKHUHIRUH DQ\SRWHQWLDOLPSDFWVZRXOGKDYHDOLPLWHGDQGWHPSRUDU\WLPHIUDPHWRRFFXU3RWHQWLDOLPSDFWVZRXOGEH OHVV WKDQ VLJQLILFDQW ZLWK LPSOHPHQWDWLRQ RI0LWLJDWLRQ 0HDVXUHV +$= DQG +$= 0LWLJDWLRQ 0HDVXUHVDUHOLVWHGDWWKHHQGRIWKLVVHFWLRQ 7KH VLWH SODQ DOVR SURSRVHV D FRQYHQLHQFH IXHO VWDWLRQ ZKLFK ZLOO UHFHLYH URXWLQH IXHO GHOLYHULHV DV QHHGHG7KHVWDWLRQZRXOGEHUHJXODWHGDQGSHUPLWWHGE\DOOIHGHUDODQGVWDWHUHJXODWLRQV7KHUHIRUHWKH UHJXODWRU\SHUPLWVFRXSOHGZLWKWKHLPSOHPHQWDWLRQRI0LWLJDWLRQ0HDVXUHV+$=DQG+$=ZLOO UHGXFHWKHLPSDFWVWROHVVWKDQVLJQLILFDQW E &UHDWHDVLJQLILFDQWKD]DUGWRWKHSXEOLFRUWKHHQYLURQPHQWWKURXJKUHDVRQDEO\IRUHVHHDEOHXSVHW DQGDFFLGHQWFRQGLWLRQVLQYROYLQJWKHUHOHDVHRIKD]DUGRXVPDWHULDOVLQWRWKHHQYLURQPHQW" /HVV7KDQ6LJQLILFDQW:LWK0LWLJDWLRQ,QFRUSRUDWHG$GGLWLRQDOO\DVGLVFXVVHGLQ5HVSRQVH9,,DD YDULHW\RIKD]DUGRXVVXEVWDQFHVZRXOGEHXVHGDQGVWRUHGGXULQJFRQVWUXFWLRQRIWKHSURSRVHG3URMHFW $FFLGHQWDOVSLOOVOHDNVILUHVRUH[SORVLRQVLQYROYLQJKD]DUGRXVPDWHULDOVUHSUHVHQWDSRWHQWLDOWKUHDWWR KXPDQKHDOWKDQGWKHHQYLURQPHQWLIQRWSURSHUO\DGGUHVVHG$VSURSRVHGLQ0LWLJDWLRQ0HDVXUH+$= D KD]DUGRXV VXEVWDQFH VSLOO SUHYHQWLRQ SODQ VKDOO EH SUHSDUHG DQG LPSOHPHQWHG DQG KD]DUGRXV PDWHULDOVVSLOONLWVVKDOOEHPDLQWDLQHGRQVLWHIRUVPDOOVSLOOV7KHLPSOHPHQWDWLRQRI%03VVXFKDV KDYLQJ VSLOO NLWV DYDLODEOH RQ HTXLSPHQW ZRXOG PLQLPL]H WKH SRWHQWLDO HIIHFW RI VXFK RFFXUUHQFHV 0LWLJDWLRQ 0HDVXUH +$= ZRXOG UHGXFH LPSDFWV WR OHVV WKDQ VLJQLILFDQW ZLWK LPSOHPHQWDWLRQ RI PLWLJDWLRQ0LWLJDWLRQ0HDVXUHVDUHOLVWHGDWWKHHQGRIWKLVVHFWLRQ F (PLWKD]DUGRXVHPLVVLRQVRUKDQGOHKD]DUGRXVRUDFXWHO\KD]DUGRXVPDWHULDOVVXEVWDQFHVRUZDVWH ZLWKLQRQHTXDUWHUPLOHRIDQH[LVWLQJRUSURSRVHGVFKRRO" 1R,PSDFW7KHUHLVQRH[LVWLQJRUSURSRVHGVFKRROZLWKLQRQHTXDUWHUPLOHRIWKH3URMHFWVLWH7KHUH IRUHWKHUHLVQRLPSDFW G %HORFDWHGRQDVLWHZKLFKLVLQFOXGHGRQDOLVWRIKD]DUGRXVPDWHULDOVVLWHVFRPSLOHGSXUVXDQWWR *RYHUQPHQW&RGH6HFWLRQDQGDVDUHVXOWZRXOGLWFUHDWHDVLJQLILFDQWKD]DUGWRWKHSXEOLF RUWKHHQYLURQPHQW" 1R,PSDFW7KHSURSRVHG3URMHFWLVQRWORFDWHGRQDVLWHZKLFKLVLQFOXGHGRQDOLVWRIKD]DUGRXV PDWHULDOVVLWHVDQGDVDUHVXOWZRXOGQRWFUHDWHDVLJQLILFDQWKD]DUGWRWKHSXEOLFRUHQYLURQPHQWDQGWKHUH ZRXOGEHQRLPSDFW 201 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH H )RUDSURMHFWORFDWHGZLWKLQDQDLUSRUWODQGXVHSODQRUZKHUHVXFKDSODQKDVQRWEHHQDGRSWHG ZLWKLQWZRPLOHVRIDSXEOLFDLUSRUWRUSXEOLFXVHDLUSRUWZRXOGWKHSURMHFWUHVXOWLQDVDIHW\KD]DUG IRUSHRSOHUHVLGLQJRUZRUNLQJLQWKHSURMHFWDUHD" 1R,PSDFW7KHUHDUHVHYHUDODLUSRUWVLQWKHYLFLQLW\EXWQRQHDUHORFDWHGZLWKLQWZRPLOHVRIWKH3URMHFW VLWH 7KHVH DLUSRUWV LQFOXGH WKH %HUPXGD 'XQHV $LUSRUW ORFDWHG VRXWK RI ,QWHUVWDWH DQG :HVW RI -HIIHUVRQ6WUHHWLQ%HUPXGD'XQHVDQGWKH-DFTXHOLQH&RFKUDQ5HJLRQDO$LUSRUWDSXEOLFDLUSRUWORFDWHG HDVWRI+DUULVRQ6WUHHWDQGEHWZHHQ$LUSRUW%RXOHYDUGRQWKHQRUWKDQG$YHQXHRQWKHVRXWK7KH %HUPXGD'XQHV$LUSRUWLVDSSUR[LPDWHO\PLOHVQRUWKRIWKH3URMHFWVLWHDQGWKH-DFTXHOLQH&RFKUDQ 5HJLRQDO$LUSRUWLVORFDWHGDSSUR[LPDWHO\PLOHVVRXWKHDVWHUO\RIWKH3URMHFWVLWH7KHUHIRUHWKHUHLVQR LPSDFW I )RUDSURMHFWZLWKLQWKHYLFLQLW\RIDSULYDWHDLUVWULSZRXOGWKHSURMHFWUHVXOWLQDVDIHW\KD]DUGIRU SHRSOHUHVLGLQJRUZRUNLQJLQWKHSURMHFWDUHD" 1R,PSDFW7KHUHDUHQRSULYDWHDLUVWULSVLQYLFLQLW\WKH3URMHFWDUHD7KHUHIRUHWKHUHLVQRLPSDFW J ,PSDLU LPSOHPHQWDWLRQ RI RU SK\VLFDOO\ LQWHUIHUH ZLWK DQ DGRSWHG HPHUJHQF\ UHVSRQVH SODQ RU HPHUJHQF\HYDFXDWLRQSODQ" 1R,PSDFW7KHSURMHFWVLWHLVFXUUHQWO\YDFDQWDQGGRHVQRWLQFOXGHIDFLOLWLHVIRUHPHUJHQF\UHVSRQVH $GGLWLRQDOO\QRSDUWRIWKH3URMHFWGHVLJQZRXOGLPSHGHRUUHGLUHFWHPHUJHQF\UHVSRQVHZLWKLQWKHDUHD 7KHVLWHSURYLGHVIRULQJUHVVDQGHJUHVVWKDWFDQEHXVHGIRUHPHUJHQF\UHVSRQVHWRWKHYDULRXVEXVLQHVVHV SURSRVHG7KHUHIRUHWKHUHLVQRLPSDFW K ([SRVHSHRSOHRUVWUXFWXUHVWRDVLJQLILFDQWULVNRIORVVLQMXU\RUGHDWKLQYROYLQJZLOGODQGILUHV LQFOXGLQJZKHUHZLOGODQGVDUHDGMDFHQWWRXUEDQL]HGDUHDVRUZKHUHUHVLGHQFHVDUHLQWHUPL[HGZLWK ZLOGODQGV" 1R,PSDFW7KH3URMHFWVLWHLVORFDWHGLQDQDUHDWKDWFRQVLVWVRIYDFDQWODQGDQGUHWDLOXVHVLQDGHVHUW VHWWLQJDQGQRWORFDWHGDGMDFHQWWRDQDUHDVXVFHSWLEOHWRZLOGODQGILUHV7KHUHIRUHWKHUHLVQRLPSDFW 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGZLWKWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQIRUWKLVFULWHULRQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV +$=±$KD]DUGRXVVSLOOSUHYHQWLRQSODQVKDOOEHSUHSDUHGE\WKH$SSOLFDQWDQGVXEPLWWHGWRWKH &LW\ IRU DSSURYDO WR PLQLPL]H WKH OLNHOLKRRG RI D VSLOO VKDOO EH SUHSDUHG SULRU WR FRQVWUXFWLRQ7KHSODQVKDOOVWDWHWKHDFWLRQVWKDWZRXOGEHUHTXLUHGLIDVSLOORFFXUVWR SUHYHQWFRQWDPLQDWLRQRIVXUIDFHZDWHUVDQGSURYLGHIRUFOHDQXSRIWKHVSLOO7KHSODQ VKDOOIROORZ)HGHUDOVWDWHDQGORFDOVDIHW\JXLGHOLQHVDQGVWDQGDUGVWRDYRLGLQFUHDVHG H[SRVXUHWRWKHVHSROOXWDQWV +$=±,IDFRQWDPLQDWHGDUHDLVHQFRXQWHUHGGXULQJFRQVWUXFWLRQFRQVWUXFWLRQVKDOOFHDVHLQWKH YLFLQLW\RIWKHFRQWDPLQDWHGDUHD7KHFRQVWUXFWLRQFRQWUDFWRUVKDOOQRWLI\DOODSSURSULDWH DXWKRULWLHVLQFOXGLQJWKH(3$DQGWKH&LW\,IQHFHVVDU\WKHFRQWDPLQDWHGVLWHVKDOOEH UHPHGLDWHGWRPLQLPL]HWKHSRWHQWLDOIRUH[SRVXUHRIWKHSXEOLFDQGWRDOORZWKH3URMHFW WREHVDIHW\FRQVWUXFWHG 202 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ ,;+\GURORJ\DQG:DWHU4XDOLW\ :RXOGWKHSURMHFW D9LRODWHDQ\ZDWHUTXDOLW\VWDQGDUGVRUZDVWH GLVFKDUJHUHTXLUHPHQWV"; E6XEVWDQWLDOO\GHSOHWHJURXQGZDWHUVXSSOLHVRU LQWHUIHUHVXEVWDQWLDOO\ZLWKJURXQGZDWHUUHFKDUJHVXFK WKDWWKHUHZRXOGEHDQHWGHILFLWLQDTXLIHUYROXPHRUD ORZHULQJRIWKHORFDOJURXQGZDWHUWDEOHOHYHOHJWKH SURGXFWLRQUDWHRISUHH[LVWLQJQHDUE\ZHOOVZRXOG GURSWRDOHYHOZKLFKZRXOGQRWVXSSRUWH[LVWLQJODQG XVHVRUSODQQHGXVHVIRUZKLFKSHUPLWVKDYHEHHQ JUDQWHG" ; F6XEVWDQWLDOO\DOWHUWKHH[LVWLQJGUDLQDJHSDWWHUQRI WKHVLWHRUDUHDLQFOXGLQJWKURXJKWKHDOWHUDWLRQRIWKH FRXUVHRIDVWUHDPRUULYHULQDPDQQHUZKLFKZRXOG UHVXOWLQVXEVWDQWLDOHURVLRQRUVLOWDWLRQRQVLWHRU RIIVLWH" ; G6XEVWDQWLDOO\DOWHUWKHH[LVWLQJGUDLQDJHSDWWHUQRI WKHVLWHRUDUHDLQFOXGLQJWKURXJKWKHDOWHUDWLRQRIWKH FRXUVHRIDVWUHDPRUULYHURUVXEVWDQWLDOO\LQFUHDVH WKHUDWHRUDPRXQWRIVXUIDFHUXQRIILQDPDQQHUZKLFK ZRXOGUHVXOWLQIORRGLQJRQVLWHRURIIVLWH" ; H&UHDWHRUFRQWULEXWHUXQRIIZDWHUZKLFKZRXOG H[FHHGWKHFDSDFLW\RIH[LVWLQJRUSODQQHGVWRUPZDWHU GUDLQDJHV\VWHPVRUSURYLGHVXEVWDQWLDODGGLWLRQDO VRXUFHVRISROOXWHGUXQRII" ; I2WKHUZLVHVXEVWDQWLDOO\GHJUDGHZDWHUTXDOLW\"; J3ODFHKRXVLQJZLWKLQD\HDUIORRGKD]DUGDUHD DVPDSSHGRQDIHGHUDO)ORRG+D]DUG%RXQGDU\RU )ORRG,QVXUDQFH5DWH0DSRURWKHUIORRGKD]DUG GHOLQHDWLRQPDS" ; K3ODFHZLWKLQD\HDUIORRGKD]DUGDUHDVWUXFWXUHV ZKLFKZRXOGLPSHGHRUUHGLUHFWIORRGIORZV"; L([SRVHSHRSOHRUVWUXFWXUHVWRDVLJQLILFDQWULVNRI ORVVLQMXU\RUGHDWKLQYROYLQJIORRGLQJLQFOXGLQJ IORRGLQJDVDUHVXOWRIWKHIDLOXUHRIDOHYHHRUGDP" ; M,QXQGDWLRQE\VHLFKHWVXQDPLRUPXGIORZ"; (QYLURQPHQWDO6HWWLQJ $OWKRXJKWKHFOLPDWHLQWKH&RDFKHOOD9DOOH\DQGWKH3ODQQLQJ$UHDDUHJHQHUDOO\WHPSHUDWHVHDVRQDO VWRUPVFDQSURGXFHVLJQLILFDQWDPRXQWVRISUHFLSLWDWLRQZLWKLQVKRUWSHULRGVRIWLPH:LQWHUVWRUPVDUH 203 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH UHVSRQVLEOH IRU PXFK RI WKH DUHD¶V DQQXDO UDLQIDOO DQG XVXDOO\ RFFXU EHWZHHQ 1RYHPEHU DQG $SULO +RZHYHUWKHUHJLRQDQGVXUURXQGLQJPRXQWDLQVPD\DOVRH[SHULHQFHORFDOL]HGWKXQGHUVWRUPVDWRWKHU WLPHVHVSHFLDOO\GXULQJWKHVXPPHUPRQVRRQVHDVRQ5DSLGVQRZPHOWIURPWKHPRXQWDLQVPD\DOVR UHVXOWLQIORRGLQJGRZQVORSH7HUUD1RYD3ODQQLQJ 5HVHDUFK,QF-XO\ $UHDVZLWKLQWKH&LW\RI/D4XLQWDDUHVXEMHFWWRIODVKIORRGLQJDORQJQDWXUDORUPDQPDGHFKDQQHOVDQG VKHHWIORRGLQJDFURVVWKHYDOOH\IORRU$OWKRXJKRIVKRUWGXUDWLRQIODVKIORRGVUHVXOWLQKLJKSHDNZDWHU YROXPHV DQG YHORFLWLHV ZKLFK DUH IUHTXHQWO\ LQWHQVLILHG E\ IHDWXUHV RI WKH ORFDO QDWXUDO DQG EXLOW HQYLURQPHQW7HUUD1RYD3ODQQLQJ 5HVHDUFK,QF-XO\ 7KHUHDUHQRGDPVLQWKH3URMHFWYLFLQLW\DQGWKH:KLWHZDWHU5LYHUVLVORFDWHGQHDUO\PLOHVWRWKHHDVW RIWKH3URMHFWVLWH7KH3URMHFWVLWHQRWFRQVLGHUHGDWULVNIURPLQXQGDWLRQIURPGDPIDLOXUHRUIORRGLQJ KD]DUGIURPOHYHHGDPDJHRUIDLOXUHDORQJWKH:KLWHZDWHU5LYHURUIURPDERYHJURXQGZDWHUVWRUDJH WDQNVDWKLJKHUHOHYDWLRQVZLWKLQDQGDGMDFHQWWR/D4XLQWD7HUUD1RYD3ODQQLQJ 5HVHDUFK,QF-XO\ ,PSDFW$QDO\VLV D 9LRODWHDQ\ZDWHUTXDOLW\VWDQGDUGVRUZDVWHGLVFKDUJHUHTXLUHPHQWV" /HVV7KDQ6LJQLILFDQW$OOGHYHORSPHQWUHTXLULQJJURXQGGLVWXUEDQFHZRXOGEHVXEMHFWWRUHJLRQDODQG ORFDOUHJXODWLRQVLQFOXGLQJWKHQHHGIRUDQ6:333XQGHUWKH13'(6*HQHUDO3HUPLWIRU6WRUP:DWHU 'LVFKDUJHV$VVRFLDWHGZLWK&RQVWUXFWLRQ$FWLYLW\&RQVWUXFWLRQ*HQHUDO3HUPLW2UGHU1R ':413'(61R&$5,QDGGLWLRQWKH&LW\UHTXLUHVDJUDGLQJSHUPLWIRUDOOGHYHORSPHQWVWKDW ZRXOGUHTXLUHJUDGLQJ&RPSOLDQFHZLWK6:5&%µV*HQHUDO&RQVWUXFWLRQ$FWLYLW\6WRUPZDWHU3HUPLW UHJXODWLRQVUHTXLULQJD6:333DQGWKHJUDGLQJSHUPLWUHTXLUHGE\WKH&LW\ZRXOGHQVXUHZDWHUTXDOLW\ VWDQGDUGVDUHQRWH[FHHGHG$GGLWLRQDOO\0LWLJDWLRQ0HDVXUH+<'ZLOOUHTXLUHWKHSUHSDUDWLRQRID :DWHU4XDOLW\0DQDJHPHQW3ODQ:403DQGVXEMHFWWRDSSURYDOE\5:4&% 7KH3URMHFWZLOOFUHDWHDQLPSHUPHDEOHVXUIDFHRYHUPXFKRIWKHHQWLUHVLWHZKHQFRPSOHWH7KLVFDQ LQFUHDVHWKHSRWHQWLDOIRUSROOXWDQWVWRRFFXULQVXUIDFHZDWHUSULPDULO\EHIURPFDUVSDUNHGLQWKHSDUNLQJ ORWOHDNLQJIOXLGV+RZHYHUWKHSURMHFWLQFOXGHVDQXQGHUJURXQGV\VWHPWRFROOHFWDOORIWKHVWRUPZDWHU UXQRIIIURPWKHSURMHFWVLWH7KH:403SUHSDUHGIRUWKHVLWHDVSDUWRI0LWLJDWLRQ0HDVXUH+<' ZLOODOVRDGGUHVVWKHUHTXLUHPHQWVDQGRSHUDWLRQVRIWKHXQGHUJURXQGV\VWHP7KHUHIRUHWKHSURMHFWZLOO KDYHDOHVVWKDQVLJQLILFDQWLPSDFWRQZDWHUTXDOLW\ E 6XEVWDQWLDOO\GHSOHWHJURXQGZDWHUVXSSOLHVRULQWHUIHUHVXEVWDQWLDOO\ZLWKJURXQGZDWHUUHFKDUJHVXFK WKDWWKHUHZRXOGEHDQHWGHILFLWLQDTXLIHUYROXPHRUDORZHULQJRIWKHORFDOJURXQGZDWHUWDEOHOHYHO HJWKHSURGXFWLRQUDWHRISUHH[LVWLQJQHDUE\ZHOOVZRXOGGURSWRDOHYHOZKLFKZRXOGQRWVXSSRUW H[LVWLQJODQGXVHVRUSODQQHGXVHVIRUZKLFKSHUPLWVKDYHEHHQJUDQWHG" /HVV7KDQ6LJQLILFDQW'XULQJFRQVWUXFWLRQWKHSURMHFWZLOOHPSOR\YDULRXVPHDVXUHVIRUGXVWFRQWURO LQFOXGLQJWKHXVHRIZDWHUWKDWLVUHDGLO\DYDLODEOHIURPWKH&RDFKHOOD9DOOH\:DWHU'LVWULFW7KHZDWHU XVHGGXULQJFRQVWUXFWLRQZLOOEHWHPSRUDU\DQGZDWHUZLOOQRWEHWKHVROHPHWKRGXVHGIRUGXVWFRQWURO :DWHUFRQVFLRXVPHDVXUHVZLOOEHXVHGDVSDUWRIWKHILQDOGHVLJQLQFOXGLQJLQVWDOODWLRQRIZDWHUHIILFLHQW IHDWXUHVVXFKDVZDWHUHIILFLHQWWRLOHWVDQGGURXJKWWROHUDQWODQGVFDSLQJ F 6XEVWDQWLDOO\DOWHUWKHH[LVWLQJGUDLQDJHSDWWHUQRIWKHVLWHRUDUHDLQFOXGLQJWKURXJKWKHDOWHUDWLRQ RIWKHFRXUVHRIDVWUHDPRUULYHULQDPDQQHUZKLFKZRXOGUHVXOWLQVXEVWDQWLDOHURVLRQRUVLOWDWLRQ RQVLWHRURIIVLWH" 204 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH /HVV7KDQ6LJQLILFDQW7KH3URMHFWVLWHKDVEHHQSUHYLRXVO\JUDGHGDQGLVRQOHYHOJURXQGFRPSOHWHO\ VXUURXQGHGE\XUEDQGHYHORSPHQWYDFDQWODQGDQGSDYHGVWUHHWV)XUWKHUWKHUHDUHQRVWUHDPVRUULYHUV RQWKH3URMHFWVLWHRULWVDGMDFHQWYLFLQLW\7KHFRQVWUXFWLRQSKDVHRIWKH3URMHFWZRXOGLQYROYHVWDQGDUG EHVWPDQDJHPHQWSUDFWLFHV%03¶VDVVRFLDWHGZLWKFRPPHUFLDOGHYHORSPHQWVXFKDVGUDLQDJHWRFLW\ VHZHUVLQWKHSDUNLQJORWVFXUEVDQGODQGVFDSLQJWRDOORZZDWHUSHUFRODWLRQGXULQJUDLQHYHQWV,PSDFWV ZRXOGEHOHVVWKDQVLJQLILFDQW G 6XEVWDQWLDOO\DOWHUWKHH[LVWLQJGUDLQDJHSDWWHUQRIWKHVLWHRUDUHDLQFOXGLQJWKURXJKWKHDOWHUDWLRQ RIWKHFRXUVHRIDVWUHDPRUULYHURUVXEVWDQWLDOO\LQFUHDVHWKHUDWHRUDPRXQWRIVXUIDFHUXQRIILQD PDQQHUZKLFKZRXOGUHVXOWLQIORRGLQJRQVLWHRURIIVLWH" /HVV7KDQ6LJQLILFDQW5HIHUWR5HVSRQVH,;FDERYH7KH3URMHFWVLWHLVVXUURXQGHGE\UHVLGHQWLDODQG UHWDLO XVHV DQG LV QRW ORFDWHG GLUHFWO\ DGMDFHQW WR DQ\ VWUHDP RU ULYHU $Q XQGHUJURXQG VWRUPZDWHU FROOHFWLRQV\VWHPZLOOEHLQVWDOOHGDVSDUWRIWKHSURMHFWWRFDSWXUHDOORIWKHVWRUPZDWHUUXQRIIIURPWKH VLWH7KHUHIRUHLPSDFWVDUHOHVVWKDQVLJQLILFDQW H &UHDWHRUFRQWULEXWHUXQRIIZDWHUZKLFKZRXOGH[FHHGWKHFDSDFLW\RIH[LVWLQJRUSODQQHGVWRUP ZDWHUGUDLQDJHV\VWHPVRUSURYLGHVXEVWDQWLDODGGLWLRQDOVRXUFHVRISROOXWHGUXQRII" /HVV7KDQ6LJQLILFDQW7KHSURMHFWLQFOXGHVWKHFRQVWUXFWLRQRIDQXQGHUJURXQGVWRUPZDWHUV\VWHPWR KDQGOHDOORIWKHVWRUPZDWHUIURPWKHVLWHDQGOLWWOHWRQRZDWHULVDQWLFLSDWHGWREHFROOHFWHGE\WKH&LW\¶V VWRUPZDWHUGUDLQDJHV\VWHPV7KHUHIRUHLPSDFWVDUHOHVVWKDQVLJQLILFDQW I 2WKHUZLVHVXEVWDQWLDOO\GHJUDGHZDWHUTXDOLW\" /HVV7KDQ6LJQLILFDQW$VSUHYLRXVO\GLVFXVVHGWKHSURSRVHG3URMHFWSURSRVHVWRFRQVWUXFWDSURMHFW WKDWZLOOXWLOL]HDQXQGHUJURXQGVWRUPZDWHUFROOHFWLRQV\VWHP8VHVIRUVRPHRIWKHEXLOGLQJVLQFOXGHD JDVVWDWLRQ7KHJDVVWDWLRQZRXOGEHFRQVWUXFWHGWRWKHODWHVWVWDQGDUGVDQGUHTXLUHGWRFRPSO\ZLWK 6WDWHDQGIHGHUDOUHTXLUHPHQWVIRUWKLVXVH7KHUHIRUHOHVVWKDQVLJQLILFDQWLPSDFWVZRXOGRFFXU J 3ODFHKRXVLQJZLWKLQD\HDUIORRGKD]DUGDUHDDVPDSSHGRQDIHGHUDO)ORRG+D]DUG%RXQGDU\ RU)ORRG,QVXUDQFH5DWH0DSRURWKHUIORRGKD]DUGGHOLQHDWLRQPDS" 1R,PSDFW7KH3URMHFWGRHVQRWSURSRVHWRFRQVWUXFWKRXVLQJ$VDUHVXOWFRQVWUXFWLRQDQGRSHUDWLRQ RIWKH3URMHFWZRXOGQRWSODFHKRXVLQJZLWKLQD\HDUIORRGKD]DUGDUHDDVPDSSHGRQD)HGHUDO)ORRG +D]DUG0DSRU)HGHUDO)ORRG,QVXUDQFH0DS7KHUHIRUHQRLPSDFWVZRXOGRFFXUXQGHUWKLVFULWHULRQDVD UHVXOWRIWKH3URMHFW K 3ODFHZLWKLQD\HDUIORRGKD]DUGDUHDVWUXFWXUHVZKLFKZRXOGLPSHGHRUUHGLUHFWIORRGIORZV" /HVV7KDQ6LJQLILFDQW7KH&LW\¶V*HQHUDO3ODQLGHQWLILHVWKDWWKH3URMHFWVLWHLVZLWKLQ)(0$)ORRG +D]DUG=RQH'ZKLFKLVDQDUHDRIXQGHWHUPLQHGULVN7KHUHIRUHWKHGHYHORSPHQWRIWKHSURSRVHG 3URMHFWZRXOGQRWSODFHVWUXFWXUHVZLWKLQD\HDUIORRGDUHDDQGZRXOGQRWLPSHGHRUUHVXOWLQWKH UHGLUHFWLRQRIIORRGIORZVLQWKH&LW\$OHVVWKDQVLJQLILFDQWLPSDFWZRXOGRFFXU L ([SRVHSHRSOHRUVWUXFWXUHVWRDVLJQLILFDQWULVNRIORVVLQMXU\RUGHDWKLQYROYLQJIORRGLQJLQFOXGLQJ IORRGLQJDVDUHVXOWRIWKHIDLOXUHRIDOHYHHRUGDP" /HVV7KDQ6LJQLILFDQW7KH:KLWHZDWHU5LYHULVORFDWHGQHDUO\PLOHVHDVWRIWKHVLWHDQGWKH3URMHFW VLWHLVQRWORFDWHGLQSUR[LPLW\WRDOHYHHRUGDP7KHUHIRUHWKHUHLVQRLPSDFWIURPIORRGLQJWKDWFRXOG RFFXU DV D UHVXOW RI D GDP IDLOXUH RU OHYHH EUHHFK +RZHYHU WKH &RDFKHOOD 9DOOH\ LV VXEMHFW WR WKXQGHUVWRUPVWKDWFDQFUHDWHIODVKIORRGLQJ7KHQHZEXLOGLQJVZRXOGEHUHTXLUHGWRDGKHUHWRFXUUHQW 205 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH &DOLIRUQLD%XLOGLQJ&RGHUHJXODWLRQVIRUFRPPHUFLDOGHYHORSPHQW$GGLWLRQDOO\WKHSURMHFWLQFOXGHVDQ XQGHUJURXQGV\VWHPWRFROOHFWDOORIWKHVWRUPZDWHUUXQRIIIURPWKHSURMHFWVLWH7KHUHIRUHOHVVWKDQ VLJQLILFDQWLPSDFWVZRXOGRFFXU M ,QXQGDWLRQE\VHLFKHWVXQDPLRUPXGIORZ" 1R,PSDFW7KHUHDUHQRERGLHVRIZDWHULQWKHYLFLQLW\RIWKH3URMHFWVLWHWKDWDUHFDSDEOHRISURGXFLQJ VHLFKHDFWLYLW\7KHUHLVDOVRQRSRWHQWLDOIRUWVXQDPLVLQWKH3URMHFWDUHDDVWKH3DFLILF2FHDQLVPRUH WKDQPLOHVWRWKHVRXWKZHVWRIWKH3URMHFWDUHD$VGLVFXVVHGDERYHWKH&LW\¶V*HQHUDO3ODQKDVQRW LGHQWLILHGWKH3URMHFWVLWHDVEHLQJLQDQDUHDVXVFHSWLEOHWRPXGIORZVDVWKHWRSRJUDSK\RIWKHVLWHLV JHQHUDOO\IODWDQGDVXIILFLHQWGLVWDQFHIURPKLOOVDQGPRXQWDLQVWRHQVXUHWKDWPXGIORZVLQWKLVDUHD ZRXOGQRWRFFXU7KHUHIRUHQRLPSDFWVZRXOGRFFXU 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGZLWKWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQIRUWKLVFULWHULRQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV +<' 3ULRU WR 3URMHFW DSSURYDO WKH 3URMHFW $SSOLFDQW VKDOO SUHSDUH D :DWHU 4XDOLW\ 0DQDJHPHQW3ODQWKDWVKDOODWPLQLPXPLQFOXGHWKHIROORZLQJ x,GHQWLILHVDOOSURMHFWUHODWHGSROOXWDQWVLPSDFWVWRWKHVLWH¶VK\GURORJLFFRQGLWLRQDQG SRWHQWLDOLPSDFWVWRORFDOZDWHUZD\VFDXVHGE\3URMHFWSRVWFRQVWUXFWLRQUXQRII x,GHQWLILHV%03VUHTXLUHGWRUHPRYHSROOXWDQWVIURPWKH3URMHFWV¶SRVWFRQVWUXFWLRQ UXQRIIDQGSUHYHQWGRZQVWUHDPK\GURPRGLILFDWLRQ x,GHQWLILHVSDUWLHVUHVSRQVLEOHIRUORQJWHUPRSHUDWLRQDQGPDLQWHQDQFHDFWLYLWLHVRIDOO %03V x,GHQWLILHV WKH GHVLJQ RSHUDWLRQ DQG PDLQWHQDQFH RI WKH XQGHUJURXQG VWRUPZDWHU FROOHFWLRQV\VWHP ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHHIIHFWVDUHDQWLFLSDWHGZLWKWKHLQFOXVLRQRIWKHDERYHPLWLJDWLRQPHDVXUH 206 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ ;/DQG8VHDQG3ODQQLQJ :RXOGWKHSURMHFW D3K\VLFDOO\GLYLGHDQHVWDEOLVKHGFRPPXQLW\"; E&RQIOLFWZLWKDQ\DSSOLFDEOHODQGXVHSODQSROLF\ RUUHJXODWLRQRIDQDJHQF\ZLWKMXULVGLFWLRQRYHUWKH SURMHFWLQFOXGLQJEXWQRWOLPLWHGWRWKHJHQHUDOSODQ VSHFLILFSODQORFDOFRDVWDOSURJUDPRU]RQLQJ RUGLQDQFHDGRSWHGIRUWKHSXUSRVHRIDYRLGLQJRU PLWLJDWLQJDQHQYLURQPHQWDOHIIHFW" ; F&RQIOLFWZLWKDQ\DSSOLFDEOHKDELWDWFRQVHUYDWLRQ SODQRUQDWXUDOFRPPXQLW\FRQVHUYDWLRQSODQ"; (QYLURQPHQWDO6HWWLQJ 7KHVLWHLVORFDWHGRQDYDFDQWSDUFHODWWKHLQWHUVHFWLRQRI-HIIHUVRQ6WUHHWDQG$YHQXHLQWKH&LW\RI /D4XLQWD3URSRVHGXVHVZLWKLQWKHFRPPHUFLDOFHQWHUGHYHORSPHQWLQFOXGHEDQNVUHVWDXUDQWVJDVROLQH VHUYLFHVWDWLRQDQGJURFHU\VWRUH)LJXUHDQG)LJXUH 7KHVLWHLVERUGHUHGRQWKHQRUWKE\'HUHN$ODQ'ULYHDQGUHVLGHQWLDOGHYHORSPHQWWKDWIURQWV'HUHN $ODQ'ULYHRQWKHZHVWE\DUHWHQWLRQEDVLQZLWKUHVLGHQWLDOGHYHORSPHQWZHVWRIWKHEDVLQRQWKH HDVWE\-HIIHUVRQ6WUHHWDQGFRPPHUFLDOGHYHORSPHQWDQGRQWKHVRXWKE\$YHQXHDQGUHVLGHQWLDO GHYHORSPHQW ,Q0D\WKH&LW\RI/D4XLQWDDSSURYHGWKH)DLUZD\3OD]D6KRSSLQJ&HQWHU6SHFLILF3ODQRI/DQG 8VHDQGDVVRFLDWHGSDUFHOPDSWRDOORZIRUWKHGHYHORSPHQWRIVTXDUHIHHWRIDVXSHUPDUNHW DQFKRUHGVKRSSLQJFHQWHUZLWKDGMDFHQWUHWDLOSDGVRQDFUHVDWWKHFRUQHURI-HIIHUVRQ6WUHHWWK $YHQXH7KHSDUFHOLVGHVLJQDWHGDQG]RQHGIRU&RPPXQLW\&RPPHUFLDO&&XVH7KH6SHFLILF3ODQ DGRSWLRQLQFOXGHGDGRSWLRQRID0LWLJDWHG1HJDWLYH'HFODUDWLRQ,QDQDPHQGPHQWWRWKH6SHFLILF 3ODQZDVDOVRDGRSWHG7RGDWHWKDWSURMHFWKDVQRWEHHQFRQVWUXFWHG 2Q)HEUXDU\WKH&LW\RI/D4XLQWDDGRSWHGWKH(QYLURQPHQWDO,PSDFW5HSRUW(,5IRULWV *HQHUDO3ODQ6&+ZKLFKLQFOXGHGWKHLPSDFWVRIDGGLQJWRFRPPHUFLDOXVHVZLWKLQWKH &LW\LQFOXGLQJWKHDSSURYHG)DLUZD\3OD]D6KRSSLQJ&HQWHU6SHFLILF3ODQ$6WDWHPHQWRI2YHUULGLQJ &RQVLGHUDWLRQVZDVDOVRDGRSWHGZLWKWKH*HQHUDO3ODQ(,5IRUHQYLURQPHQWDOLPSDFWVWKDWFRXOGQRWEH PLWLJDWHGWRDOHYHOEHORZVLJQLILFDQFHIRU$LU4XDOLW\*UHHQKRXVH*DVDQG7UDIILF5HVROXWLRQ &XUUHQWO\WKH/XQGLQ'HYHORSPHQWLVUHTXHVWLQJDXWKRUL]DWLRQIURPWKH&LW\WRFRQVWUXFWVTXDUH IHHWRIDVXSHUPDUNHWDQFKRUHGVKRSSLQJFHQWHUDQGDGMDFHQWUHWDLOSDGVRQWKHDFUHVLWHDWWKHFRUQHU RI-HIIHUVRQ6WUHHWDQGWK$YHQXHZLWKLQWKHVDPH DUHDRIWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQ 3URSRVHGXVHVZLWKLQWKHFRPPHUFLDOFHQWHUGHYHORSPHQWDUHVLPLODUWRWKHSUHYLRXVO\DSSURYHGSODQDQG LQFOXGHEDQNVUHVWDXUDQWVJDVROLQHVHUYLFHVWDWLRQDQGJURFHU\VWRUH 207 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH ,PSDFW$QDO\VLV D 3K\VLFDOO\GLYLGHDQHVWDEOLVKHGFRPPXQLW\" 1R,PSDFW7KH3URMHFWSURSRVHVWRGHYHORSDVKRSSLQJFHQWHURQDFRQWLJXRXVYDFDQWDFUHSDUFHO DVDUHWDLOFHQWHU5HWDLOXVHVH[LVWDFURVV-HIIHUVRQ6WUHHWRQWKHHDVW7KHUHDUHQRVXUURXQGLQJODQGXVHV WKDWZRXOGFXUUHQWO\FRQIOLFWZLWKWKHSURSRVHGXVH7KHUHIRUHWKHUHLVQRLPSDFW E &RQIOLFWZLWKDQ\DSSOLFDEOHODQGXVHSODQSROLF\RUUHJXODWLRQRIDQDJHQF\ZLWKMXULVGLFWLRQRYHU WKHSURMHFWLQFOXGLQJEXWQRWOLPLWHGWRWKHJHQHUDOSODQVSHFLILFSODQORFDOFRDVWDOSURJUDPRU ]RQLQJRUGLQDQFHDGRSWHGIRUWKHSXUSRVHRIDYRLGLQJRUPLWLJDWLQJDQHQYLURQPHQWDOHIIHFW" /HVV7KDQ6LJQLILFDQW7KHVLWHLV]RQHG&RPPXQLW\&RPPHUFLDO&&E\WKH&LW\RI/D4XLQWD7KH VXEMHFWSURSHUW\KDVUHFHLYHGSULRUDSSURYDOVDVDFRPPHUFLDOFHQWHULQDQGLQ7KHSURMHFWLV SURSRVHGWREHGHYHORSHGDVDFRPPHUFLDOFHQWHULQDFFRUGDQFHZLWKWKHPXQLFLSDOFRGHVWDQGDUGVRIWKH &RPPXQLW\&RPPHUFLDO]RQH7KHUHIRUHWKHUHLVDOHVVWKDQVLJQLILFDQWLPSDFW F &RQIOLFWZLWKDQ\DSSOLFDEOHKDELWDWFRQVHUYDWLRQSODQRUQDWXUDOFRPPXQLW\FRQVHUYDWLRQSODQ" /HVV 7KDQ 6LJQLILFDQW 7KH &LW\ RI /D 4XLQWD IDOOV HQWLUHO\ ZLWKLQ WKH &RDFKHOOD 9DOOH\ 0XOWLSOH 6SHFLHV+DELWDW&RQVHUYDWLRQ3ODQ&906+&3DUHD7KHVLWHLVDYDFDQWGLUWSDUFHOWKDWKDVEHHQ SUHYLRXVO\GLVWXUEHG7KHVXEMHFWSDUFHOLVQRWORFDWHGZLWKLQRUDGMDFHQWWRD&RQVHUYDWLRQ$UHD7KH &906+&3UHTXLUHVDKDELWDWDVVHVVPHQWIRUWKHEXUURZLQJRZO%82:,IKDELWDWIRUWKH%82:LV SUHVHQWDIRFXVHGVXUYH\LVUHTXLUHG7KH%LRORJLFDO5HVRXUFH$VVHVVPHQWSUHSDUHGIRUWKHSURMHFW -HULFKR0D\GHWHUPLQHGWKDWWKHUHZDVQRVXLWDEOH%82:KDELWDWQRUZHUHWKHUHVLJQVRI %82:DFWLYLW\1RVXLWDEOH%82:KDELWDWZDVLGHQWLILHGRQVLWHGXULQJWKHEXUURZLQJRZOKDELWDW DVVHVVPHQWVXUYH\7KHUHIRUHQRDGGLWLRQDOSURWRFROOHYHOIRFXVHGVXUYH\VZLOOEHUHTXLUHG 1RRWKHUOLVWHGRUVHQVLWLYHVSHFLHVRUVHQVLWLYHKDELWDWZDVREVHUYHGRQWKHVLWH7KHVXEMHFWSDUFHOGRHV QRWFRQWDLQVXLWDEOHKDELWDWIRUDQ\RIWKHVHQVLWLYHVSHFLHVWKDWKDYHEHHQGRFXPHQWHGLQWKHSURMHFW YLFLQLW\7KH3URMHFWPXVWDOVRFRPSO\ZLWKORFDOFRQVHUYDWLRQUHJXODWLRQVZKLFKUHTXLUHSD\PHQWRID PLWLJDWLRQIHHDWWKHWLPHRIEXLOGLQJSHUPLWLVVXDQFH7KHUHIRUHLPSOHPHQWDWLRQRIWKH3URMHFWZLOOQRW FRQIOLFWZLWKDQ\KDELWDWFRQVHUYDWLRQSODQRUQDWXUDOFRPPXQLW\FRQVHUYDWLRQSODQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGZLWKWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQIRUWKLVFULWHULRQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV 1RPLWLJDWLRQPHDVXUHVDUHUHTXLUHG ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHLPSDFWVDUHLGHQWLILHGRUDQWLFLSDWHGDQGQRPLWLJDWLRQPHDVXUHVDUHUHTXLUHG 208 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ ;,0LQHUDO5HVRXUFHV D5HVXOWLQWKHORVVRIDYDLODELOLW\RIDNQRZQPLQHUDO UHVRXUFHWKDWZRXOGEHRIYDOXHWRWKHUHJLRQDQGWKH UHVLGHQWVRIWKHVWDWH" ; E5HVXOWLQWKHORVVRIDYDLODELOLW\RIDORFDOO\ LPSRUWDQWPLQHUDOUHVRXUFHUHFRYHU\VLWHGHOLQHDWHGRQ DORFDOJHQHUDOSODQVSHFLILFSODQRURWKHUODQGXVH SODQ" ; (QYLURQPHQWDO6HWWLQJ 7KH3URMHFWVLWHLVFXUUHQWO\YDFDQWDQGQRPLQHUDOPLQLQJRFFXUVRQVLWHRULQWKHLPPHGLDWHYLFLQLW\RI WKH3URMHFWVLWH 7KH&LW\RI/D4XLQWD*HQHUDO3ODQ&LW\RI/D4XLQWD)HEUXDU\LGHQWLILHVWKH3URMHFWVLWHDV PDSSHGZLWKLQ0LQHUDO5HVRXUFH=RQH±GHILQHGDVDUHDVZKHUHDGHTXDWHLQIRUPDWLRQLQGLFDWHVWKDWQR VLJQLILFDQWPLQHUDOGHSRVLWVDUHSUHVHQWRUZKHUHLWLVMXGJHGWKDWOLWWOHOLNHOLKRRGIRUWKHLUSUHVHQFHH[LVWV ,PSDFW$QDO\VLV D 5HVXOWLQWKHORVVRIDYDLODELOLW\RIDNQRZQPLQHUDOUHVRXUFHWKDWZRXOGEHRIYDOXHWRWKHUHJLRQDQG WKHUHVLGHQWVRIWKHVWDWH" 1R,PSDFW7KH3URMHFWVLWHLVFXUUHQWO\YDFDQWDQGLV]RQHG&RPPXQLW\&RPPHUFLDO&&E\WKH&LW\ RI/D4XLQWD1RPLQHUDOUHVRXUFHVDUHNQRZQWRRFFXURQVLWHQRULVWKH3URMHFWVLWH]RQHGIRUPLQLQJ XVHV1RLPSDFWZRXOGRFFXU E 5HVXOWLQWKHORVVRIDYDLODELOLW\RIDORFDOO\LPSRUWDQWPLQHUDOUHVRXUFHUHFRYHU\VLWHGHOLQHDWHGRQD ORFDOJHQHUDOSODQVSHFLILFSODQRURWKHUODQGXVHSODQ" 1R,PSDFW5HIHUWR5HVSRQVH;,DDERYH1RLPSDFWVZRXOGRFFXU 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGZLWKWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQIRUWKLVFULWHULRQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV 1RPLWLJDWLRQPHDVXUHVDUHUHTXLUHG ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHLPSDFWVDUHLGHQWLILHGRUDQWLFLSDWHGDQGQRPLWLJDWLRQPHDVXUHVDUHUHTXLUHG 209 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ ;,,1RLVH :RXOGWKHSURMHFWUHVXOWLQ D([SRVXUHRISHUVRQVWRRUJHQHUDWLRQRIQRLVHOHYHOV LQH[FHVVRIVWDQGDUGVHVWDEOLVKHGLQWKHORFDOJHQHUDO SODQRUQRLVHRUGLQDQFHRUDSSOLFDEOHVWDQGDUGVRI RWKHUDJHQFLHV" ; E([SRVXUHRISHUVRQVWRRUJHQHUDWLRQRIH[FHVVLYH JURXQGERUQHYLEUDWLRQRUJURXQGERUQHQRLVHOHYHOV"; F$VXEVWDQWLDOSHUPDQHQWLQFUHDVHLQDPELHQWQRLVH OHYHOVLQWKHSURMHFWYLFLQLW\DERYHOHYHOVH[LVWLQJ ZLWKRXWWKHSURMHFW" ; G$VXEVWDQWLDOWHPSRUDU\RUSHULRGLFLQFUHDVHLQ DPELHQWQRLVHOHYHOVLQWKHSURMHFWYLFLQLW\DERYH OHYHOVH[LVWLQJZLWKRXWWKHSURMHFW" ; H)RUDSURMHFWORFDWHGZLWKLQDQDLUSRUWODQGXVHSODQ RUZKHUHVXFKDSODQKDVQRWEHHQDGRSWHGZLWKLQWZR PLOHVRIDSXEOLFDLUSRUWRUSXEOLFXVHDLUSRUWZRXOG WKHSURMHFWH[SRVHSHRSOHUHVLGLQJRUZRUNLQJLQWKH SURMHFWDUHDWRH[FHVVLYHQRLVHOHYHOV" ; I)RUDSURMHFWZLWKLQWKHYLFLQLW\RIDSULYDWHDLUVWULS ZRXOGWKHSURMHFWH[SRVHSHRSOHUHVLGLQJRUZRUNLQJ LQWKHSURMHFWDUHDWRH[FHVVLYHQRLVHOHYHOV" ; (QYLURQPHQWDO6HWWLQJ 1RLVH±*HQHUDO 6RXQGLVDSK\VLFDOGLVWXUEDQFHLQDPHGLXPVXFKDVDLUWKDWLVFDSDEOHRIEHLQJGHWHFWHGE\WKHKXPDQ HDU 6RXQG ZDYHV LQ DLU DUH FDXVHG E\ YDULDWLRQV LQ SUHVVXUH DERYH DQG EHORZ WKH VWDWLF YDOXH RI DWPRVSKHULFSUHVVXUH6RXQGLVPHDVXUHGLQXQLWVRIGHFLEHOVG%RQDORJDULWKPLFVFDOH7KH³SLWFK´ KLJKRUORZRIWKHVRXQGLVDGHVFULSWLRQRIIUHTXHQF\ZKLFKLVPHDVXUHGLQ+HUW]+]0RVWFRPPRQ HQYLURQPHQWDOVRXQGVDUHDFRPSRVLWHRIIUHTXHQFLHV$QRUPDOKXPDQHDUFDQXVXDOO\GHWHFWVRXQGV ZLWKLQIUHTXHQFLHVIURPWR+]+RZHYHUKXPDQVDUHPRVWVHQVLWLYHWRIUHTXHQFLHVLQWKHUDQJH RIWR+] &HUWDLQIUHTXHQFLHVDUHJLYHQPRUH³ZHLJKW´GXULQJDVVHVVPHQWEHFDXVHKXPDQKHDULQJLVQRWHTXDOO\ VHQVLWLYHWRDOOIUHTXHQFLHVRIVRXQG7KH$ZHLJKWHGGHFLEHOG%$VFDOHFRUUHVSRQGVWRWKHVHQVLWLYLW\ UDQJHIRUKXPDQKHDULQJ1RLVHOHYHOVFDSDEOHRIEHLQJKHDUGE\KXPDQVDUHPHDVXUHGLQG%$$QRLVH OHYHOFKDQJHRIG%$RUOHVVLVEDUHO\SHUFHSWLEOHWRDYHUDJHKXPDQKHDULQJ+RZHYHUDG%$FKDQJH LQQRLVHOHYHOLVFOHDUO\QRWLFHDEOH$G%$FKDQJHLVSHUFHLYHGDVDGRXEOLQJRUKDOYLQJRIQRLVH ORXGQHVVZKLOHDG%$FKDQJHLVFRQVLGHUHGD³GUDPDWLFFKDQJH´LQORXGQHVV 6RXQG IURP D VRXUFH VSUHDGV RXW DV LW WUDYHOV DZD\ IURP WKH VRXUFH DQG WKH VRXQG SUHVVXUH OHYHO GLPLQLVKHVZLWKGLVWDQFH,QGLYLGXDOVRXQGVRXUFHVDUHFRQVLGHUHG³SRLQWVRXUFHV´ZKHQWKHGLVWDQFHIURP 210 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($INITIAL STUDY 3DJH WKHVRXUFHLVODUJHFRPSDUHGWRWKHVL]HRIWKHVRXUFHHJFRQVWUXFWLRQHTXLSPHQWDQGWXUELQHV6RXQG IURPDSRLQWVRXUFHUDGLDWHVKHPLVSKHULFDOO\ZKLFK\LHOGVDG%VRXQGOHYHOUHGXFWLRQIRUHDFKGRXEOLQJ RIWKHGLVWDQFHIURPWKHVRXUFH,IWKHVRXQGVRXUFHLVORQJLQRQHGLPHQVLRQWKHVRXUFHLVFRQVLGHUHGD ³OLQH VRXUFH´ LH URDGZD\V DQG UDLOURDGV 6RXQG IURP D OLQH VRXUFH UDGLDWHV F\OLQGULFDOO\ ZKLFK W\SLFDOO\\LHOGVDG%VRXQGOHYHOUHGXFWLRQIRUHDFKGRXEOLQJRIWKHGLVWDQFHIURPWKHVRXUFH 7KHPHWULFVIRUHYDOXDWLQJWKHFRPPXQLW\QRLVHHQYLURQPHQWDUHEDVHGRQPHDVXUHPHQWVRIWKHQRLVH OHYHOVRYHUDSHULRGRIWLPH7KHVHPHWULFVDUHXVHGLQRUGHUWRFKDUDFWHUL]HDQGHYDOXDWHWKHFXPXODWLYH QRLVHLPSDFWV7KH&RPPXQLW\1RLVH(TXLYDOHQW/HYHO&1(/UHSUHVHQWVDKRXU$ZHLJKWHGVRXQG OHYHODYHUDJHIURPPLGQLJKWWRPLGQLJKWZKHUHVRXQGOHYHOVGXULQJWKHHYHQLQJKRXUVRISPWR SPKDYHDQDGGHGG%ZHLJKWLQJDQGQLJKWWLPHKRXUVRISPWRDPKDYHDQDGGHG G%ZHLJKWLQJ 3RWHQWLDOQRLVHIURPFRQVWUXFWLRQHTXLSPHQWWREHXVHGIRUWKLVSURMHFWDUHLQFOXGHGRQ7DEOH 7DEOH &RQVWUXFWLRQ(TXLSPHQW1RLVH(PLVVLRQ/HYHOV (TXLSPHQW 7\SLFDO1RLVH/HYHOG%$IWIURP6RXUFH %DFNKRH &RPSDFWRU &RQFUHWH0L[HU &RQFUHWH3XPS 'R]HU *UDGHU /RDGHU 6FDULILHU 6FUDSHU 7UXFN )7$0D\ 'DWDWDNHQIURP(3$5HSRUW(3$ 9LEUDWLRQ±*HQHUDO 6RXUFHVRIYLEUDWLRQLQFOXGHGJHRWHFKGULOOULJVH[FDYDWRUVGXPSWUXFNVEDFNKRHVDQGRWKHUJHQHUDO FRQVWUXFWLRQ HTXLSPHQW 7KH )HGHUDO 7UDQVLW $GPLQLVWUDWLRQ )7$ KDV GHYHORSHG YLEUDWLRQ LPSDFW WKUHVKROGV IRU QRLVHVHQVLWLYH EXLOGLQJV UHVLGHQFHV DQG LQVWLWXWLRQDO ODQG XVHV 7KHVH DUH XVXDOO\ PHDVXUHGDV³YLEUDWLRQGHFLEHOV´RU9G%$FFRUGLQJWRWKH)7$JXLGHOLQHVDYLEUDWLRQOHYHORI9G%LV WKH WKUHVKROG RI SHUFHSWLELOLW\ IRU KXPDQV 7KHVH WKUHVKROGV DUH W\SLFDOO\ 9G% DW UHVLGHQFHV DQG EXLOGLQJVZKHUHSHRSOHQRUPDOO\VOHHSHJQHDUE\UHVLGHQFHVDQGGD\FDUHIDFLOLWLHVDQG9G%DW LQVWLWXWLRQDOEXLOGLQJVHJVFKRROVDQGFKXUFKHV7KH)7$JXLGHOLQHVDOVRVWDWHWKDWIRUDVLJQLILFDQW LPSDFWWRRFFXUYLEUDWLRQOHYHOVPXVWH[FHHG9G%GXULQJLQIUHTXHQWHYHQWV)7$0D\ 211 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($INITIAL STUDY 3DJH 7\SLFDOYLEUDWLRQOHYHOVIURPSURMHFWHTXLSPHQWDUHEDVHGRQWKH)7$JXLGHOLQHVSURYLGHGLQ7DEOH 7DEOH 9LEUDWLRQ6RXUFH/HYHOVIRU7\SLFDO&RQVWUXFWLRQ(TXLSPHQW (TXLSPHQW 9LEUDWLRQ/HYHODWIHHW9G% /DUJHEXOOGR]HU &DLVVRQGULOOLQJ /RDGHGWUXFNV -DFNKDPPHU 6PDOOEXOOGR]HU 6RXUFH)7$ 3URMHFW/RFDWLRQ 7KHVLWHLVLPPHGLDWHO\DGMDFHQWWRDVWRUPZDWHUGHWHQWLRQEDVLQDORQJWKHQRUWKHUQDQGZHVWHUQHGJHV ZLWK UHVLGHQFHV DEXWWLQJ WKH GHWHQWLRQ EDVLQ¶V ZHVW DQG QRUWK VLGHV 7KH EDVLQ SURYLGHV IRU DQ DSSUR[LPDWHO\WRIRRWEXIIHUEHWZHHQWKH3URMHFWDQGWKHUHVLGHQFHEDFN\DUG7KUHHUHVLGHQFHV RQWKHVRXWKZHVWDUHDRIWKHSURMHFWVLWHGLUHFWO\DEXWWKHSURMHFWVLWH5HVLGHQFHVH[LVWWRWKHVRXWKRIWKH 3URMHFWVLWHMXVWEH\RQGWK$YHQXH&RPPHUFLDOXVHVH[LVWWRWKHHDVWRIWKHSURMHFWMXVWEH\RQGWKH VLWH¶VERUGHUZLWK-HIIHUVRQ6WUHHW /RFDO1RLVH2UGLQDQFHV 7KHUHVLGHQWLDODUHDVWRWKHQRUWKDQGZHVWDQGVRXWKRIWKH3URMHFWDUH]RQHG/RZ'HQVLW\5HVLGHQWLDO 7KH&LW\RI/D4XLQWD0XQLFLSDO&RGH6HFWLRQ³1RLVHFRQWURO´LGHQWLILHVWKLVODQGXVHDV ³QRLVHVHQVLWLYH´ 7KH&LW\RI/D4XLQWD0XQLFLSDO&RGH6HFWLRQ³'LVWXUEDQFHVE\FRQVWUXFWLRQQRLVHV´OLPLW FRQVWUXFWLRQ QRLVH LPSDFWV SUHGRPLQDQWO\ WKURXJK UHVWULFWLRQ RI WLPHV DQG GD\V ZKHQ ZRUN PD\ EH FDUULHGRXW x &RQVWUXFWLRQLVQRWSHUPLWWHGRQ6XQGD\VRUGHILQHG+ROLGD\V x &RQVWUXFWLRQLVUHVWULFWHGWRDPWRSPRQ6DWXUGD\V x %HWZHHQ2FWREHUVWDQG$SULOWKFRQVWUXFWLRQLVUHVWULFWHGDPWRSP x %HWZHHQ0D\VWDQG6HSWHPEHUWKFRQVWUXFWLRQLVUHVWULFWHGWRDPWRSP 7KH&LW\¶VFRGHDOVRLGHQWLILHVOLPLWVIRURSHUDWLRQDOQRLVHIRUWKHUHVLGHQWLDODQGQRQUHVLGHQWLDOODQG XVHV2SHUDWLRQDOQRLVHVKDOOQRWH[FHHGWKHOHYHOVVHWRXWLQWKH1RLVH6WDQGDUGRUWKHH[LVWLQJDPELHQW QRLVH)RUWKH³QRLVHVHQVLWLYH´SURSHUWLHVWRWKH6RXWK:HVWDQG1RUWKRSHUDWLRQDOQRLVHIURPWKH SURMHFWVKDOOQRWH[FHHG x G%$EHWZHHQDPDQGSP x G%$EHWZHHQSPDQGDP )RUWKH³RWKHUQRQUHVLGHQWLDO´ODQGXVHVWRWKH(DVWRSHUDWLRQDOQRLVHIURPWKHSURMHFWVKDOOQRWH[FHHG x G%$EHWZHHQDPDQGSP 212 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($INITIAL STUDY 3DJH x G%$EHWZHHQSPDQGDP 3URMHFW1RLVH6WXGLHV 1RLVHVWXGLHVIRUWKH3URMHFWZHUHSUHSDUHGLQDVSDUWRIWKH6SHFLILF3ODQ$PHQGPHQW1R DSSURYDODQGLQDQGWRVHUYHDVDQXSGDWH$SSHQGL[( 7KHVWXG\LGHQWLILHGWKDWERWK-HIIHUVRQ6WUHHWDQGWK$YHQXHZHUHLPSDFWHGDQGH[FHHGG%$ &1(/7KHVWXG\LGHQWLILHGWKDWDOOQHZGHYHORSPHQWLVUHTXLUHGWRPLWLJDWHWRWKH&LW\ VVWDQGDUGVIRU QRLVHDVUHTXLUHGLQWKH*HQHUDO3ODQ7DEOH(+:DUQHU(QJLQHHULQJ)HEUXDU\ 7KHQRLVHVWXG\DOVRFRQFOXGHGWKDWDUHDVDORQJ-HIIHUVRQ6WUHHWDQGWK$YHQXHZHUHLPSDFWHGDQG H[FHHGHGWKHG%$FULWHULD$PELHQWQRLVHPHDVXUHGDORQJYDULRXVORFDWLRQVDORQJWKHQRUWKDQGZHVW SHULPHWHU RI WKH VLWH QHDUHVW WR WKH UHVLGHQFHV PHDVXUHG EHWZHHQ DQG G%$ 7KH VWXG\ GHWHUPLQHGWKDWWKHPDLQVRXUFHVRIQRLVHDFURVVWKHVLWHDUHQRLVHIURPURDGWUDIILFRQWK$YHQXHDQG -HIIHUVRQVWUHHWRWKHUQRLVHVRXUFHVLQFOXGHG+9$&V\VWHPVVHUYLQJWKHKRXVHVWRWKHQRUWKZHVWDQG VRXWKRIWKHVLWHDQGIURP+9$&VHUYLQJWKHFRPPHUFLDOEXLOGLQJVWRWKHHDVWDFURVV-HIIHUVRQ6WUHHW 7KHUH ZDV DOVR PLQRU QRLVH IURP GLVWDQW DLUFUDIW DQG ELUGVRQJ $QWRQLR $FRXVWLFV -XQH $SSHQGL[( 1RLVHLVDOVRDQWLFLSDWHGIURPWKHVSHDNHUVRIWKHGULYHWKURXJKHDWLQJHVWDEOLVKPHQWVDVZHOODVYHKLFOH GRRUVFORVLQJLQWKHSDUNLQJORW7KH3URMHFWLVSURSRVHGDSSUR[LPDWHO\IHHWEHWZHHQWKHFORVHVW GHYHORSPHQWEXLOGLQJDQGWKHUHVLGHQFHVWRWKHVRXWK7KHUHVLGHQFHVWRWKHVRXWKDOUHDG\KDYHDFRQFUHWH PDVRQU\ERXQGDU\ZDOO ,PSDFW$QDO\VLV D ([SRVXUHRISHUVRQVWRRUJHQHUDWLRQRIQRLVHOHYHOVLQH[FHVVRIVWDQGDUGVHVWDEOLVKHGLQWKHORFDO JHQHUDOSODQRUQRLVHRUGLQDQFHRUDSSOLFDEOHVWDQGDUGVRIRWKHUDJHQFLHV" /HVV7KDQ6LJQLILFDQW7KHQRLVHVWXG\$SSHQGL['LGHQWLILHGWKDWWKHQRLVHIURPWKHVLWHWKURXJKWKH GD\ZRXOGQRWH[FHHGWKHPHDVXUHGOHYHOVDWWKHHGJHVRIWKHVLWHFORVHVWWRWKHUHVLGHQFHVDQGWKDWWKH QRLVHIURPWKH+9$&XQLWVRQWKHEXLOGLQJVDQGSDUNLQJGRHVQRWH[FHHGWKH&LW\RI/D4XLQWDGD\WLPH QRLVHFULWHULDRIG%$DWDQ\UHVLGHQFH7KHUHIRUHWKHUHLVDOHVVWKDQVLJQLILFDQWLPSDFW E ([SRVXUHRISHUVRQVWRRUJHQHUDWLRQRIH[FHVVLYHJURXQGERUQHYLEUDWLRQRUJURXQGERUQHQRLVH OHYHOV" /HVV7KDQ6LJQLILFDQW7KHQRLVHUHODWHGWRFRQVWUXFWLRQZRXOGLQFOXGHWKRVHJHQHUDWHGIURPWKHXVHRI KHDY\HTXLSPHQWDWWKHVLWHRUYHKLFOHVWUDQVSRUWLQJPDWHULDOV$FWLYLWLHVWKDWFRXOGJHQHUDWHJURXQGERUQH YLEUDWLRQLQFOXGHSLOHGULYLQJDQGGHPROLWLRQKRZHYHUSLOHGULYLQJDQGVLJQLILFDQWGHPROLWLRQLVQRW DQWLFLSDWHGWREHXWLOL]HGGXULQJFRQVWUXFWLRQ 6RPH FRQVWUXFWLRQ DFWLYLWLHV ZRXOG RFFXU ZLWKLQ DSSUR[LPDWHO\ WR IHHW RI UHVLGHQFHV ZLWK UHVLGHQFHVWRWKHVRXWKZHVWEHLQJWKHFORVHVWUHFHSWRUV6FUHHQLQJOHYHOFDOFXODWLRQVEDVHGRQWKH)7$ *XLGHOLQHV 7DEOH LQGLFDWH WKDW YLEUDWLRQ OHYHOV DVVRFLDWHG ZLWK WKHVH DFWLYLWLHV ZRXOG KDYH DWWHQXDWHGWRDOHYHORIDSSUR[LPDWHO\9G%DWWKHQHDUHVWUHVLGHQFHJLYHQWKHLQWHUYHQLQJGLVWDQFH 7KLVDQDO\VLVVKRZVWKDWYLEUDWLRQOHYHOVDWDOOLGHQWLILHGVHQVLWLYHUHFHSWRUVZHUHEHORZWKHWKUHVKROG RI9G% 213 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($INITIAL STUDY 3DJH &RQVWUXFWLRQ DFWLYLWLHV ZRXOG EH WHPSRUDU\ DQG ZRXOG QRW H[SRVH SHUVRQV WR RU JHQHUDWH H[FHVVLYH JURXQGERUQHYLEUDWLRQRUJURXQGERUQHQRLVHOHYHOVGXHWRWKHDGKHUHQFHRIWKH&LW\¶V*HQHUDO3ODQ 7KHUHIRUHJURXQGERUQHYLEUDWLRQLPSDFWVDVVRFLDWHGZLWKSURSRVHGFRQVWUXFWLRQDFWLYLWLHVZLOOEHOHVV WKDQVLJQLILFDQW F $VXEVWDQWLDOSHUPDQHQWLQFUHDVHLQDPELHQWQRLVHOHYHOVLQWKHSURMHFWYLFLQLW\DERYHOHYHOVH[LVWLQJ ZLWKRXWWKHSURMHFW" /HVV7KDQ6LJQLILFDQW:LWK0LWLJDWLRQ,QFRUSRUDWHG7KHQRLVHVWXG\DQGDPHQGPHQW PHDVXUHG DPELHQW QRLVH OHYHOV DORQJ YDULRXV ORFDWLRQV RI WKH 3URMHFW VLWH SHULPHWHU DQG SURMHFWHG WKHSRWHQWLDO IXWXUH QRLVH OHYHOV 7DEOH 7KH VWXGLHV LGHQWLILHG D YDULHW\ RISRWHQWLDORSHUDWLRQV QRLVHVRXUFHVWKDWZLOOFRQWULEXWHWRDSHUPDQHQWLQFUHDVHLQDPELHQWQRLVH x +9$&V\VWHPVVHUYLQJWKHEXLOGLQJV x &RPPHUFLDOORDGLQJDQGXQORDGLQJ x 1RLVHIURPSDUNLQJDQGWKHJDVVWDWLRQ x 1RLVHIURPVSHDNHUVDWWKHGULYHWKURXJKHDWLQJHVWDEOLVKPHQWV x 1RLVHIURPFDUGRRUVFORVLQJDWQLJKW 7RSURMHFWWKHSRWHQWLDOLQFUHDVHLQDPELHQWQRLVHWKHQRLVHVWXG\DVVXPHGWKDWWKH+9$&IRUHDFK QHZEXLOGLQJZRXOGQRWH[FHHGDVRXQGSRZHUOHYHORIG%$HTXLYDOHQWWRG%$DWIHHW,Q WKHDEVHQFHRIDQDWLRQDOVWDQGDUGIRUWKH86WKHSDUNLQJORWPHWKRGRORJ\ZDVEDVHGRQ,62 $QWRQLR$FRXVWLFV-XQH$SSHQGL[( 7DEOH ([LVWLQJDQG3URMHFWHG)XWXUH2SHUDWLRQDO1RLVH /RFDWLRQ0HDVXUHPHQW/RFDWLRQDQG'LVWDQFHIURP 6HQVLWLYH5HFHSWRUV 0HDVXUHG OHYHOG%$ 1HZQRLVHIURP +9$&DQG SDUNLQJG%$ 1HZQRLVH H[FHHGV PHDVXUHG" 6RXWKZHVWHUQVLWHSHULPHWHUFORVHWR$YHQXHEHWZHHQ SURSRVHGSDUNLQJDQGUHVLGHQFHV 1R $GMDFHQWWRERXQGDU\ZDOOVRXWKZHVWHUQVLWHSHULPHWHU DSSUR[LPDWHO\IHHWQRUWKRI/RFDWLRQEHWZHHQ SURSRVHGSDUNLQJDQGUHVLGHQFHV 1R $GMDFHQWWRERXQGDU\ZDOOZHVWHUQVLWHSHULPHWHU DSSUR[LPDWHO\IHHWEHWZHHQSURSRVHGEDFNRI SURSRVHG3DYLOLRQVJURFHU\VWRUHDQGUHVLGHQFHV 1R $GMDFHQWWRERXQGDU\ZDOOZHVWHUQVLWHSHULPHWHU DSSUR[LPDWHO\IHHWEHWZHHQSURSRVHGORDGLQJGRFN IRUSURSRVHG3DYLOLRQVJURFHU\VWRUHDQGUHVLGHQFHV 1R $GMDFHQWWRERXQGDU\ZDOOZHVWHUQVLWHSHULPHWHU DSSUR[LPDWHO\IHHWEHWZHHQSURSRVHGORDGLQJGRFN IRU3DYLOLRQVJURFHU\VWRUHDQGUHVLGHQFHV 1R $GMDFHQWWRERXQGDU\ZDOOZHVWHUQVLWHSHULPHWHU DSSUR[LPDWHO\IHHWEHWZHHQSURSRVHGSDUNLQJDQG UHVLGHQFHV 1R 1RUWKHDVWSHULPHWHUFRUQHUDGMDFHQWWR-HIIHUVRQ6WUHHW QRWQHDUUHVLGHQFHV 1R (DVWVLWHSHULPHWHUDGMDFHQWWR-HIIHUVRQ6WUHHW 1RW(VWLPDWHG 1R 6RXWKHDVWVLWHSHULPHWHUDGMDFHQWWR-HIIHUVRQ6WUHHWDQG 1RW(VWLPDWHG 1R 214 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH $YHQXHQRWQHDUUHVLGHQFHV 7KHQRLVHVWXGLHVSUHSDUHGLQDQGLQGLFDWHGWKDWWKHDPELHQWQRLVHZLOOQRWH[FHHGWKH &LW\¶VVWDQGDUG+RZHYHUEHFDXVHWKHDPELHQWQRLVHLVDOUHDG\FORVHWRWKH&LW\¶VPD[LPXPOHYHOIRUWKH DUHDWKH3URMHFWRSHUDWLRQVZLOOLQFOXGH0LWLJDWLRQ0HDVXUHV12,WKURXJK12,EHLPSOHPHQWHGWR HQVXUHWKDWDPELHQWQRLVHOHYHOVZLOOQRWH[FHHGWKH&LW\¶VPD[LPXPVWDQGDUG0LWLJDWLRQ0HDVXUHVDUH ORFDWHGDWWKHHQGRIWKLVVHFWLRQ $GGLWLRQDOO\WKHQRLVHVWXG\LGHQWLILHGWKDWDGGLWLRQDOVFUHHQLQJZRXOGEHDSSURSULDWHWRDFFRPPRGDWH WKHQRLVHIURPWKHVSHDNHUDWWKHGULYHWKURXJKHDWLQJHVWDEOLVKPHQWDQGWKHUHVLGHQFHVDORQJWKHVRXWK 0LWLJDWLRQ0HDVXUH12,ZLOOEHLPSOHPHQWHGWRUHGXFHQRLVHIURPWKHVSHDNHUVDWWKHGULYHWKURXJK ZKLFKZLOOHQVXUHLPSDFWVDUHOHVVWKDQVLJQLILFDQW0LWLJDWLRQPHDVXUHVDUHORFDWHGDWWKHHQGRIWKLV VHFWLRQ 7KHQRLVHVWXG\UHJDUGLQJYHKLFOHGRRUVFORVLQJDOVRLGHQWLILHGWKDWIRUWKHFORVHVWSDUNLQJVSDFHWR PHWHUIURPWKHZLQGRZVRIWKHFORVHVWKRXVHWKH/$0D[)QRLVHOHYHOLVG%IRUFDUGRRUVODPV7KLVLV WKHZRUVWFDVHVFHQDULRDQGQRLVHIURPWKHPDMRULW\RIWKHSDUNLQJVSDFHVZLOOEHVXEVWDQWLDOO\OHVVWKDQ WKLV7KHUHIRUHWKHUHLVDOHVVWKDQVLJQLILFDQWLPSDFWIURPFDUGRRUVFORVLQJWKHLQWKHSDUNLQJORW G $VXEVWDQWLDOWHPSRUDU\RUSHULRGLFLQFUHDVHLQDPELHQWQRLVHOHYHOVLQWKHSURMHFWYLFLQLW\DERYH OHYHOVH[LVWLQJZLWKRXWWKHSURMHFW" /HVV7KDQ6LJQLILFDQW:LWK0LWLJDWLRQ,QFRUSRUDWHG:KLOHWKHH[DFWFRQVWUXFWLRQPHWKRGDQG HTXLSPHQWKDV\HWWREHGHWHUPLQHGQRLVHIURPFRQVWUXFWLRQLVH[SHFWHGWRRFFDVLRQDOO\UHDFKG%$ DWIHHWIURPWKHORXGHUQRLVHVRXUFHV7KHWLPLQJRIFRQVWUXFWLRQZRUNLVOLPLWHGWRWKH&LW\RI/D 4XLQWD0XQLFLSDO&RGH6HFWLRQ³'LVWXUEDQFHVE\FRQVWUXFWLRQQRLVHV´+RZHYHUWRUHGXFH FRQVWUXFWLRQQRLVHWROHVVWKDQVLJQLILFDQWOHYHOV0LWLJDWLRQ0HDVXUHV12,DQG12,DUHUHTXLUHG 0LWLJDWLRQPHDVXUHVDUHORFDWHGDWWKHHQGRIWKLVVHFWLRQ H )RUDSURMHFWORFDWHGZLWKLQDQDLUSRUWODQGXVHSODQRUZKHUHVXFKDSODQKDVQRWEHHQDGRSWHG ZLWKLQWZRPLOHVRIDSXEOLFDLUSRUWRUSXEOLFXVHDLUSRUWZRXOGWKHSURMHFWH[SRVHSHRSOHUHVLGLQJRU ZRUNLQJLQWKHSURMHFWDUHDWRH[FHVVLYHQRLVHOHYHOV" 1R,PSDFW7KHUHDUHQRDLUSRUWODQGXVHSODQVZLWKLQWKHSURMHFWDUHD7KHUHIRUHWKHUHLVQRLPSDFW I )RUDSURMHFWZLWKLQWKHYLFLQLW\RIDSULYDWHDLUVWULSZRXOGWKHSURMHFWH[SRVHSHRSOHUHVLGLQJRU ZRUNLQJLQWKHSURMHFWDUHDWRH[FHVVLYHQRLVHOHYHOV" 1R,PSDFW7KHUHDUHQRSULYDWHDLUVWULSVLQWKHYLFLQLW\RIWKH3URMHFW7KHUHIRUHQRLPSDFWZRXOG RFFXU 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ x$OOFRQVWUXFWLRQDFWLYLW\VKDOOEHOLPLWHGWRWKHKRXUVRIFRQVWUXFWLRQSHUPLWWHGE\0XQLFLSDO &RGH6HFWLRQ x$OOLQWHUQDOFRPEXVWLRQHTXLSPHQWVKDOOEHILWWHGZLWKSURSHUO\RSHUDWLQJPXIIOHUVDQGDLULQWDNH VLOHQFHUV 215 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH x$OOVWDWLRQDU\HTXLSPHQWVKDOOEHORFDWHGDVIDUDVSUDFWLFDOIURPDGMDFHQWSRWHQWLDOUHVLGHQWLDO XQLWV x$OORQVLWHGHOLYHULHVVKDOOEHOLPLWHGWRDP7RSP x7KHSURSRVHGSHULPHWHUZDOOVKDOOEHIHHWLQKHLJKW 0LWLJDWLRQ0HDVXUHV 12,,WLVUHFRPPHQGHGWKDWWKH3DYLOLRQVGHOLYHU\GRFNLVHQFORVHGZLWKZDOOVDQGDURRIDQG WKDW DQ DFRXVWLFDOO\ DEVRUSWLYH PDWHULDO LV XVHG WR SDUWLDOO\ OLQH WKH LQWHUQDO ZDOOV WR FRQWUROQRLVHEXLOGXS7KLVZLOOOLPLWSRWHQWLDOGLVWXUEDQFHIURPXQORDGLQJ 12,9HKLFOHORDGLQJDQGXQORDGLQJIRUDOOUHWDLOXQLWVVKRXOGEHFDUULHGRXWLQDTXLHWPDQQHU 12, ,WLVUHFRPPHQGHGWKDW+9$&HTXLSPHQWRQURRIVLVVFUHHQHGE\DQRLVHEDUULHUIURPWKH UHVLGHQFHV7KLVEDUULHUVKRXOGDWDPLQLPXPSURYLGHOLQHRIVLJKWVFUHHQLQJ 12, ,WLVUHFRPPHQGHGWKDWQRLV\+9$&HTXLSPHQWDWJUDGHLVHQFORVHGZLWK&08ZDOOVDW OHDVWIHHWKLJKHUWKDQWKHHTXLSPHQW 12, ,WLVUHFRPPHQGHGWKDWQRLVHIURP+9$&HTXLSPHQWLVOLPLWHGWRG%$DWWKHVLWH ERXQGDU\ 12,5HGXFHWKHQRLVHIURPWKHDXGLEOHGHYLFHVIRUWKHGULYHWKURXJKHDWLQJHVWDEOLVKPHQWV XVLQJDQ\DQGRUDOOPHWKRGVDVIROORZV x3RVLWLRQGHYLFHVDZD\IURPWKHVLWHERXQGDU\WRWKHVRXWK x3URYLGHDGGLWLRQDOVFUHHQLQJVXFKDVSRVLWLRQLQJRIWKHUHWDLOEXLOGLQJVRUDQRLVH EDUULHUFORVHWRWKHGHYLFH x5HGXFH WKH QXPEHU RI DXGLEOH GHYLFHV VXFK DV RQH GHYLFH WR VHUYHWZRGULYH WKURXJKV x2ULHQWWKHGHYLFHSHUSHQGLFXODUWRWKHYHKLFOHDQGDWHDUKHLJKWZLWKWKHGHYLFH DLPHGDWWKHOLVWHQHULQWKHYHKLFOH x7KHVRXQGIURPWKHGHYLFHVVKRXOGEHOLPLWHGWRDPD[LPXPRIG%$DWIHHW x7KHUHVKDOOEHQRDQQXQFLDWRUWRQHVZKLVWOHVEHHSVRURWKHUFKDUDFWHULVWLFVRXQGV 12,/D\ RXW WKH VLWH ZRUNLQJ WR NHHS QRLVHSURGXFLQJ DFWLYLWLHV DVIDU DV SRVVLEOH IURP UHVLGHQFHVPLQLPL]HWKHXVHRIEDFNXSDODUPVDQGPLQLPL]HWUXFNDFWLYLW\DQGWUXFN TXHXLQJQHDUWKHUHVLGHQWLDODUHDV 12,3HUIRUPFRQVWUXFWLRQLQDPDQQHUWRPLQLPL]HQRLVHZKHUHSUDFWLFDEOH)RUH[DPSOH x:KHUHSUDFWLFDEOHXVHK\GUDXOLFUDWKHUWKDQSQHXPDWLFLPSDFWWRROV x2SHUDWHHTXLSPHQWWRPLQLPL]HEDQJLQJFODWWHULQJEX]]LQJDQGRWKHUDQQR\LQJ W\SHVRIQRLVHV x7XUQRIILGOLQJHTXLSPHQWDQGYHKLFOHV x$OOLQWHUQDOFRPEXVWLRQHTXLSPHQWVKDOOEHILWWHGZLWKSURSHUO\RSHUDWLQJPXIIOHUV DQGDLULQWDNHVLOHQFHUV 216 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH x$OOVWDWLRQDU\HTXLSPHQWVKDOOEHORFDWHGDVIDUDVSUDFWLFDOIURPDGMDFHQWSRWHQWLDO UHVLGHQWLDOXQLWV x3KDVHLQVWDUWXSDQGVKXWGRZQRIVLWHHTXLSPHQW x&RQGXFWWUXFNORDGLQJXQORDGLQJDQGKDXOLQJRSHUDWLRQVWRNHHSQRLVHWRDPLQLPXP x/LPLWWKHWLPHWKDWVWHHOGHFNLQJRUSODWHVIRUVWUHHWGHFNLQJRUFRYHULQJH[FDYDWHG DUHDVDUHLQXVH x/LPLWWKHXVHRIDQQXQFLDWRUVRUSXEOLFDGGUHVVV\VWHPVH[FHSWIRUHPHUJHQF\ QRWLILFDWLRQV x$OORQVLWHGHOLYHULHVVKDOOEHOLPLWHGWREHWZHHQDPWRSP ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHHIIHFWVDUHDQWLFLSDWHGZLWKWKHLQFOXVLRQRIWKHDERYHPLWLJDWLRQPHDVXUHV 217 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ ;,,,3RSXODWLRQDQG+RXVLQJ :RXOGWKHSURMHFW D,QGXFHVXEVWDQWLDOSRSXODWLRQJURZWKLQDQDUHDHLWKHU GLUHFWO\IRUH[DPSOHE\SURSRVLQJQHZKRPHVDQG EXVLQHVVHVRULQGLUHFWO\IRUH[DPSOHWKURXJKH[WHQVLRQ RIURDGVRURWKHULQIUDVWUXFWXUH" ; E'LVSODFHVXEVWDQWLDOQXPEHUVRIH[LVWLQJKRXVLQJ QHFHVVLWDWLQJWKHFRQVWUXFWLRQRIUHSODFHPHQWKRXVLQJ HOVHZKHUH" ; F'LVSODFHVXEVWDQWLDOQXPEHUVRISHRSOHQHFHVVLWDWLQJ WKHFRQVWUXFWLRQRIUHSODFHPHQWKRXVLQJHOVHZKHUH"; (QYLURQPHQWDO6HWWLQJ 7KH&LW\RI/D4XLQWDLVRQHRIQLQHFLWLHVLQWKH&RDFKHOOD9DOOH\DQGRIIHUVQXPHURXVGHVWLQDWLRQ UHVRUWV7KHSRSXODWLRQZDVDWWKHFHQVXVXSIURPDWWKHFHQVXV ,PSDFW$QDO\VLV D ,QGXFHVXEVWDQWLDOSRSXODWLRQJURZWKLQDQDUHDHLWKHUGLUHFWO\IRUH[DPSOHE\SURSRVLQJQHZ KRPHVDQGEXVLQHVVHVRULQGLUHFWO\IRUH[DPSOHWKURXJKH[WHQVLRQRIURDGVRURWKHU LQIUDVWUXFWXUH" /HVV7KDQ6LJQLILFDQW7KH3URMHFWLQFOXGHVWKHFRQVWUXFWLRQRIDQDSSUR[LPDWHDFUHYDFDQWORWIRU WKHRSHUDWLRQRIDUHWDLOFHQWHUGHVLJQHGWRVHUYHWKHH[LVWLQJSRSXODWLRQ7KHUHIRUHWKH3URMHFWZLOOQRW LQGLUHFWO\LQGXFHDQLQFUHDVHLQSRSXODWLRQWKHLPSDFWZLOOEHOHVVWKDQVLJQLILFDQW E 'LVSODFHVXEVWDQWLDOQXPEHUVRIH[LVWLQJKRXVLQJQHFHVVLWDWLQJWKHFRQVWUXFWLRQRIUHSODFHPHQW KRXVLQJHOVHZKHUH" 1R,PSDFW7KHUHDUHQRH[LVWLQJKRXVHVRQWKH3URMHFWVLWH7KHUHIRUHWKHSURSRVHG3URMHFWZLOOQRW GLVSODFHDQ\KRXVLQJRUUHTXLUHWKHFRQVWUXFWLRQRIUHSODFHPHQWKRXVLQJ F 'LVSODFHVXEVWDQWLDOQXPEHUVRISHRSOHQHFHVVLWDWLQJWKHFRQVWUXFWLRQRIUHSODFHPHQWKRXVLQJ HOVHZKHUH" 1R,PSDFW7KHUHDUHQRKRPHOHVVFDPSVRQWKH3URMHFWVLWHWKHUHIRUHWKHUHLVQRLPSDFW 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGZLWKWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQIRUWKLVFULWHULRQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV 1RPLWLJDWLRQPHDVXUHVDUHUHTXLUHG 218 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHLPSDFWVDUHLGHQWLILHGRUDQWLFLSDWHGDQGQRPLWLJDWLRQPHDVXUHVDUHUHTXLUHG 219 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ ;,93XEOLF6HUYLFHV :RXOGWKHSURMHFWUHVXOWLQVXEVWDQWLDODGYHUVH SK\VLFDOLPSDFWVDVVRFLDWHGZLWKWKHSURYLVLRQRIQHZ RUSK\VLFDOO\DOWHUHGJRYHUQPHQWDOIDFLOLWLHVQHHGIRU QHZRUSK\VLFDOO\DOWHUHGJRYHUQPHQWDOIDFLOLWLHVWKH FRQVWUXFWLRQRIZKLFKFRXOGFDXVHVLJQLILFDQW HQYLURQPHQWDOLPSDFWVLQRUGHUWRPDLQWDLQDFFHSWDEOH VHUYLFHUDWLRVUHVSRQVHWLPHVRURWKHUSHUIRUPDQFH REMHFWLYHVIRUDQ\RIWKHSXEOLFVHUYLFHV D)LUHSURWHFWLRQ"; E3ROLFHSURWHFWLRQ"; F6FKRROV"; G5HFUHDWLRQ3DUNV"; H2WKHUSXEOLFIDFLOLWLHV" ; (QYLURQPHQWDO6HWWLQJ 7KH&LW\FRQWUDFWVZLWKWKH5LYHUVLGH&RXQW\)LUH'HSDUWPHQWIRUILUHSURWHFWLRQVHUYLFHVZLWKDWRWDORI VL[VWDWLRQVORFDWHGWKURXJKRXWWKH&LW\DOOVWDIIHGE\IXOOWLPHSDLGILUHILJKWHUVDQGYROXQWHHUV7HUUD 1RYD-XO\3ROLFHVHUYLFHVDUHFRQWUDFWHGWKURXJKWKH5LYHUVLGH&RXQW\6KHULII¶V'HSDUWPHQW ZKLFKSURYLGHVWZR3ROLFH'HSDUWPHQWRIILFHVLQWKH&LW\DQGDMDLOIDFLOLW\LQ7KHUPDO7HUUD1RYD-XO\ 7KH3URMHFWVLWHLVZLWKLQWKH'HVHUW6DQGV8QLILHG6FKRRO'LVWULFWERXQGDULHV7KH'686'VHUYHV VWXGHQWV ORFDWHG ZHVW RI-HIIHUVRQ 6WUHHW DQG QRUWK RI $YHQXH 7KH +DUU\ 6 7UXPDQ (OHPHQWDU\ 6FKRRODQGWKH/D4XLQWD0LGGOH6FKRRODUHORFDWHGRQ$YHQXHDSSUR[LPDWHO\RQHPLOHZHVWRIWKH 3URMHFWVLWH 7KH &LW\ RI /D 4XLQWD &RPPXQLW\ 6HUYLFHV 'HSDUWPHQW PDLQWDLQV QXPHURXV VPDOO SRFNHW SDUNV QHLJKERUKRRGSDUNVFRPPXQLW\SDUNVDQGWUDLOVWKURXJKRXWLQFRUSRUDWHGSRUWLRQVRIWKH&LW\3RFNHW SDUNVDUHJHQHUDOO\OHVVWKDQRQHDFUHDQGSURYLGHVPDOOSOD\JURXQGVWRWORWVDQGSDVVLYHVHDWLQJDUHDV 7KHVHVPDOOSDUNVWHQGWREHEXLOWZLWKLQQHLJKERUKRRGVDQGVHUYHORFDOUHVLGHQWV2QHRIWKHODUJHVW SDUNVZLWKLQWKH&LW\RI/D4XLQWDLVWKH/DNH&DKXLOOD&RXQW\3DUNRSHUDWHGE\WKH&RXQW\RI5LYHUVLGH /DNH&DKXLOODLVDQDFUHSDUNORFDWHGLQWKHVRXWKZHVWHUQSRUWLRQRILQFRUSRUDWHG/D4XLQWD7KH 'HVHUW5HFUHDWLRQ'LVWULFWRZQVDQGRSHUDWHVWKH/D4XLQWD&RPPXQLW\3DUNLQ/D4XLQWDZKLFKLVD DFUHSDUNWKDWLQFOXGHVDVTXDUHIRRWFRPPXQLW\FHQWHUEDVHEDOOGLDPRQGVEDVNHWEDOOFRXUWVD SOD\JURXQGDQGSLFQLFSDYLOLRQ7HUUD1RYD-XO\ ,PSDFW$QDO\VLV :RXOGWKHSURMHFWUHVXOWLQVXEVWDQWLDODGYHUVHSK\VLFDOLPSDFWVDVVRFLDWHGZLWKWKHSURYLVLRQRIQHZRU SK\VLFDOO\DOWHUHGJRYHUQPHQWDOIDFLOLWLHVQHHGIRUQHZRUSK\VLFDOO\DOWHUHGJRYHUQPHQWDOIDFLOLWLHVWKH FRQVWUXFWLRQRIZKLFKFRXOGFDXVHVLJQLILFDQWHQYLURQPHQWDOLPSDFWVLQRUGHUWRPDLQWDLQDFFHSWDEOH VHUYLFHUDWLRVUHVSRQVHWLPHVRURWKHUSHUIRUPDQFHREMHFWLYHVIRUDQ\RIWKHSXEOLFVHUYLFHV 220 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH D )LUHSURWHFWLRQ" /HVV7KDQ6LJQLILFDQW$VSUHYLRXVO\GLVFXVVHGWKH3URMHFWVLWHLVVHUYHGE\WKH&LW\RI/D4XLQWD)LUH 'HSDUWPHQW7KHQHDUHVWILUHVWDWLRQWRWKH3URMHFWVLWHLVORFDWHGDSSUR[LPDWHO\PLOHVVRXWKZHVWRIWKH VLWHDW$YHQXH 7KHSURSRVHGSURMHFWZLOOEHGHYHORSHGLQFRPSOLDQFHZLWKDSSOLFDEOHSURYLVLRQVRIWKH&LW\¶V0XQLFLSDO &RGHVDQGDOODSSOLFDEOHSURYLVLRQVRIWKHDGRSWHGDQGDSSOLFDEOH%XLOGLQJ&RQVWUXFWLRQDQG)LUH&RGHV $GGLWLRQDOO\WKHILUHGHSDUWPHQWZLOOUHYLHZDOOSODQVVXEPLWWHGWRWKH&LW\DQGWKHDSSOLFDQWLVUHTXLUHG WRFRPSO\ZLWKDOOGHYHORSPHQWUHTXLUHPHQWVUHFRPPHQGHGE\WKH)LUH'HSDUWPHQW$GGLWLRQDOO\WKH DSSOLFDQWLVUHTXLUHGWRSD\LPSDFWIHHVWRDVVLVWWKHILUHGHSDUWPHQWLQRIIVHWWLQJSRWHQWLDOLPSDFWV*LYHQ WKH3URMHFW¶VFRPSOLDQFHZLWKGHYHORSPHQWUHTXLUHPHQWVLPSDFWVWRILUHVHUYLFHVDUHDQWLFLSDWHGWREH PLQLPDO7KHUHIRUHWKHLPSDFWLVOHVVWKDQVLJQLILFDQW E 3ROLFH3URWHFWLRQ" /HVV7KDQ6LJQLILFDQW$VSUHYLRXVO\GLVFXVVHGWKH3URMHFWVLWHLVVHUYHGE\WKH&LW\RI/D4XLQWD¶V SROLFHVHUYLFHV7KHDVVLJQHGSROLFHVWDWLRQIRUWKH3URMHFWVLWHLVORFDWHGDW$LUSRUW%OYG 7KHUPDODSSUR[LPDWHO\PLOHVWRWKHVRXWKHDVW+RZHYHU/D4XLQWDSROLFHDQG5LYHUVLGH&RXQW\ 6KHULII¶VURXWLQHO\SDWUROWKH3URMHFWYLFLQLW\JLYHQWKHXUEDQQDWXUHRIWKHDUHD5HVSRQVHWLPHVWRWKH 3URMHFWVLWHZLOOYDU\GHSHQGLQJRQWKHQDWXUHRIWKHFDOO 7KH3URMHFWSURYLGHVIRUVWDWHRIDUWVHFXULW\SURYLVLRQVLQDUHDVVXFKDVRXWGRRUOLJKWLQJDQGDGHTXDWH LQJUHVVDQGHJUHVVIRUHPHUJHQF\YHKLFOHV7KHUHIRUHWKHLPSDFWLVOHVVWKDQVLJQLILFDQW F 6FKRROV" 1R,PSDFW7KH 3URMHFW LV FRPPHUFLDO LQQDWXUHDQG GRHV QRW SURSRVH XVHV WKDW ZRXOG GLUHFWO\RU LQGLUHFWO\LQGXFHSRSXODWLRQJURZWKDQGWKXVZRXOGQRWJHQHUDWHGHPDQGIRUDGGLWLRQDOVFKRROV1R LPSDFWZRXOGRFFXU G 5HFUHDWLRQ3DUNV" 1R ,PSDFW 7KH 3URMHFW GRHV QRW SURSRVH XVHV WKDW ZRXOG GLUHFWO\ RU LQGLUHFWO\ LQGXFH SRSXODWLRQ JURZWKDQGWKXVZRXOGQRWJHQHUDWHGHPDQGIRUDGGLWLRQDOSDUNV7KHUHIRUHWKHUHLVQRLPSDFW H 2WKHU6HUYLFHV" 1R,PSDFW7KH3URMHFWGRHVQRWSURSRVHXVHVWKDWZRXOGGLUHFWO\RULQGLUHFWO\LQGXFHSRSXODWLRQ JURZWKDQGWKXVZRXOGQRWJHQHUDWHGHPDQGIRURWKHUSXEOLFIDFLOLWLHV$GGLWLRQDOO\WKHDSSOLFDQWLV UHTXLUHGWRSD\DQLPSDFWIHHWKDWZLOODVVLVWWKH&LW\LQIXQGLQJPDLQWHQDQFHRIFLW\LQIUDVWUXFWXUH 7KHUHIRUHWKHUHLVQRLPSDFWWRWKLVFULWHULRQ 0LWLJDWLRQ0HDVXUHV 1RPLWLJDWLRQPHDVXUHVDUHUHTXLUHG ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHLPSDFWVDUHLGHQWLILHGRUDQWLFLSDWHGDQGQRPLWLJDWLRQPHDVXUHVDUHUHTXLUHG 221 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ ;95HFUHDWLRQ D:RXOGWKHSURMHFWLQFUHDVHWKHXVHRIH[LVWLQJ QHLJKERUKRRGDQGUHJLRQDOSDUNVRURWKHUUHFUHDWLRQDO IDFLOLWLHVVXFKWKDWVXEVWDQWLDOSK\VLFDOGHWHULRUDWLRQRI WKHIDFLOLW\ZRXOGRFFXURUEHDFFHOHUDWHG" ; E'RHVWKHSURMHFWLQFOXGHUHFUHDWLRQDOIDFLOLWLHVRU UHTXLUHWKHFRQVWUXFWLRQRUH[SDQVLRQRIUHFUHDWLRQDO IDFLOLWLHVZKLFKPLJKWKDYHDQDGYHUVHSK\VLFDOHIIHFW RQWKHHQYLURQPHQW" ; (QYLURQPHQWDO6HWWLQJ 7KH3URMHFWLVWRFRQVWUXFWDQDSSUR[LPDWHDFUHYDFDQWORWIRUDUHWDLOFHQWHU7KH3URMHFWVLWHLVQRW FXUUHQWO\ XWLOL]HG IRU UHFUHDWLRQ SXUSRVHV QRU ZLOO WKH XVH LQGXFH JURZWK WKDW ZRXOG UHTXLUH WKH FRQVWUXFWLRQRIDGGLWLRQDOUHFUHDWLRQDOIDFLOLWLHV ,PSDFW$QDO\VLV D :RXOGWKHSURMHFWLQFUHDVHWKHXVHRIH[LVWLQJQHLJKERUKRRGDQGUHJLRQDOSDUNVRURWKHUUHFUHDWLRQDO IDFLOLWLHVVXFKWKDWVXEVWDQWLDOSK\VLFDOGHWHULRUDWLRQRIWKHIDFLOLW\ZRXOGRFFXURUEHDFFHOHUDWHG" 1R,PSDFW7KH3URMHFWGRHVQRWLQFOXGHXVHVWKDWZRXOGGLUHFWO\RULQGLUHFWO\LQGXFHSRSXODWLRQJURZWK WKHUHIRUHDQLQFUHDVHLQWKHXVHRIH[LVWLQJUHFUHDWLRQDOIDFLOLWLHVLQWKH&LW\LVQRWDQWLFLSDWHG7KHUHIRUH WKHUHLVQRLPSDFW E 'RHVWKHSURMHFWLQFOXGHUHFUHDWLRQDOIDFLOLWLHVRUUHTXLUHWKHFRQVWUXFWLRQRUH[SDQVLRQRI UHFUHDWLRQDOIDFLOLWLHVZKLFKPLJKWKDYHDQDGYHUVHSK\VLFDOHIIHFWRQWKHHQYLURQPHQW" 1R ,PSDFW7KH 3URMHFW VLWH LV QRW FXUUHQWO\ XVHG IRU UHFUHDWLRQDO SXUSRVHV DQG GRHV QRW SURSRVH GHYHORSPHQWWKDWZRXOGLQFUHDVHH[LVWLQJUHFUHDWLRQDOXVHV7KHUHIRUHWKHUHLVQRLPSDFW 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGZLWKWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQIRUWKLVFULWHULRQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV 1RPLWLJDWLRQPHDVXUHVDUHUHTXLUHG ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHLPSDFWVDUHLGHQWLILHGRUDQWLFLSDWHGDQGQRPLWLJDWLRQPHDVXUHVDUHUHTXLUHG 222 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ ;9,7UDQVSRUWDWLRQ7UDIILF :RXOGWKHSURMHFW D&RQIOLFWZLWKDQDSSOLFDEOHSODQRUGLQDQFHRU SROLF\HVWDEOLVKLQJPHDVXUHVRIHIIHFWLYHQHVVIRUWKH SHUIRUPDQFHRIWKHFLUFXODWLRQV\VWHPWDNLQJLQWR DFFRXQWDOOPRGHVRIWUDQVSRUWDWLRQLQFOXGLQJPDVV WUDQVLWDQGQRQPRWRUL]HGWUDYHODQGUHOHYDQW FRPSRQHQWVRIWKHFLUFXODWLRQV\VWHPLQFOXGLQJEXW QRWOLPLWHGWRLQWHUVHFWLRQVVWUHHWVKLJKZD\VDQG IUHHZD\VSHGHVWULDQDQGELF\FOHSDWKVDQGPDVV WUDQVLW" ; E&RQIOLFWZLWKDQDSSOLFDEOHFRQJHVWLRQPDQDJHPHQW SURJUDPLQFOXGLQJEXWQRWOLPLWHGWROHYHORIVHUYLFH VWDQGDUGVDQGWUDYHOGHPDQGPHDVXUHVRURWKHU VWDQGDUGVHVWDEOLVKHGE\WKHFRXQW\FRQJHVWLRQ PDQDJHPHQWDJHQF\IRUGHVLJQDWHGURDGVRU KLJKZD\V" ; F5HVXOWLQDFKDQJHLQDLUWUDIILFSDWWHUQVLQFOXGLQJ HLWKHUDQLQFUHDVHLQWUDIILFOHYHOVRUDFKDQJHLQ ORFDWLRQWKDWUHVXOWVLQVXEVWDQWLDOVDIHW\ULVNV" ; G6XEVWDQWLDOO\LQFUHDVHKD]DUGVGXHWRDGHVLJQ IHDWXUHHJVKDUSFXUYHVRUGDQJHURXVLQWHUVHFWLRQV RULQFRPSDWLEOHXVHVHJIDUPHTXLSPHQW" ; H5HVXOWLQLQDGHTXDWHHPHUJHQF\DFFHVV"; I&RQIOLFWZLWKDGRSWHGSROLFLHVSODQVRUSURJUDPV UHJDUGLQJSXEOLFWUDQVLWELF\FOHRUSHGHVWULDQ IDFLOLWLHVRURWKHUZLVHGHFUHDVHWKHSHUIRUPDQFHRU VDIHW\RIVXFKIDFLOLWLHV" ; (QYLURQPHQWDO6HWWLQJ 7KHSURSRVHG3URMHFWLVORFDWHGLQWKH&LW\RI/D4XLQWDERUGHUHGRQWKHQRUWKE\'HUHN$ODQ'ULYHD SULYDWH VWUHHW RZQHG E\ WKH 5HQDLVVDQFH +RPHRZQHUV $VVRFLDWLRQ DQG UHVLGHQWLDO GHYHORSPHQW WKDW IURQWV'HUHN$ODQ'ULYHRQWKHZHVWE\DUHWHQWLRQEDVLQIROORZHGE\UHVLGHQWLDOGHYHORSPHQWRQWKH HDVWE\-HIIHUVRQ6WUHHWDQGFRPPHUFLDOGHYHORSPHQWDQGRQWKHVRXWKE\$YHQXHDQGUHVLGHQWLDO GHYHORSPHQW5HJLRQDODFFHVVWRWKHVLWHFDQEHDFFRPPRGDWHGYLD,QWHUVWDWHDQG+Z\ $ WUDIILF VWXG\ ZDV SHUIRUPHG LQ -XO\ WR HYDOXDWH WKH WUDIILF LQJUHVV DQG HJUHVV SURSRVHG IRU -HIIHUVRQ6WUHHW$OEHUW*URYHUDQG$VVRFLDWHV-XO\$SSHQGL[)$FFHVVIRUWKHGHYHORSPHQW SURMHFWLVSURSRVHGYLDIRXUGULYHZD\VWKUHHOLPLWHGDFFHVVQROHIWWXUQVRXWGULYHZD\VDQGRQHIXOO DFFHVVXQVLJQDOL]HGGULYHZD\RQ$YHQXHDSSUR[LPDWHO\IHHWIURPWKH-HIIHUVRQ6WUHHWVLJQDOL]HG LQWHUVHFWLRQ ,WVKRXOGEHQRWHGWKDWWKHRQHGULYHZD\LQWRWKHVKRSSLQJFHQWHUIURP'HUHN$ODQ'ULYHDVSUHYLRXVO\ LGHQWLILHGRQWKHSUHYLRXVO\DSSURYHG)DLUZD\3OD]D6SHFLILF3ODQKDVEHHQUHPRYHGZLWKWKLVFXUUHQW 223 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH SURSRVHG3URMHFW7KHSUHYLRXVO\DSSURYHG)DLUZD\3OD]D6SHFLILF3ODQKDGLQFOXGHGDGULYHZD\IURP 'HUHN$ODQ'ULYHWRWKHVKRSSLQJFHQWHUDVDFRQYHQLHQFHWRWKHUHVLGHQWVLQWKHUHVLGHQWLDOGHYHORSPHQW WRWKHQRUWKDQGZHVW+RZHYHUGXHWRUHVLGHQWFRQFHUQVUHJDUGLQJXQZDQWHGWUDIILFLQWKHQHLJKERUKRRG DIWHUWKHUHVLGHQWLDOGHYHORSPHQWZDVFRQVWUXFWHGWKHGULYHZD\DFFHVVIURP'HUHN$ODQ'ULYHKDVEHHQ HOLPLQDWHGIURPWKH³3DYLOLRQ3DOPV´SURMHFWDVDPHQGHG $WWKHSURMHFWORFDWLRQ-HIIHUVRQ6WUHHWLVDVL[ODQHWZRZD\DUWHULDOURDGZD\ZLWKDUDLVHGPHGLDQDQG VHUYHVDVRQHRIWKHPDLQWKRURXJKIDUHVLQWKHDUHD$YHQXHLVDWZRZD\URDGZD\ZLWKRQHZHVWERXQG ODQHDQGWZRHDVWERXQGODQHV$WWKHLQWHUVHFWLRQHDFKDSSURDFKKDVRQHGHGLFDWHGOHIWWXUQODQHDQGRQH GHGLFDWHGULJKWWXUQODQHH[FHSWWKHVRXWKERXQGDSSURDFKZKLFKKDVWZROHIWWXUQODQHV 7KH&LW\RI/D4XLQWDKDVSXEOLVKHG(QJLQHHULQJ%XOOHWLQ$SSHQGL[*ZKLFKDSSOLHVWRVLWH DFFHVVDQGJLYHVFULWHULDDQGPHWKRGRORJLHVIRUFRPSOHWLQJWUDIILFVWXGLHV5HJDUGLQJVLWHDFFHVVLWVWDWHV WKHIROORZLQJ SITE ACCESS$X[LOLDU\ODQHVVKDOOEHLQVWDOOHGRQDOOSULPDU\DUWHULDOVHFRQGDU\DUWHULDODQGKLJKHU RUGHUVWUHHWFODVVLILFDWLRQVDFFRUGLQJWRWKHIROORZLQJFULWHULD$OHIWWXUQGHFHOHUDWLRQODQHZLWKWDSHUDQG VWRUDJH OHQJWK LV UHTXLUHG IRUDQ\ GULYHZD\ ZLWK D SURMHFWHG SHDN KRXU OHIW LQJUHVV WXUQLQJ YROXPH HVWLPDWHGWREHYHKLFOHVSHUKRXUYSKRUJUHDWHU7KHWDSHUOHQJWKVKDOOEHLQFOXGHGDVSDUWRIWKH UHTXLUHG GHFHOHUDWLRQ ODQH OHQJWK $ ULJKWWXUQ GHFHOHUDWLRQ ODQH LV UHTXLUHG IRU DQ\ GULYHZD\ ZLWK D SURMHFWHGSHDNKRXUULJKWLQJUHVVWXUQLQJYROXPHHVWLPDWHGWREHYSKRUJUHDWHU7KHWDSHUOHQJWKVKDOO EHLQFOXGHGDVSDUWRIWKHUHTXLUHGGHFHOHUDWLRQODQHOHQJWK3RFNHWVWRUDJHOHQJWKUHTXLUHPHQWVVKDOOEH EDVHGRQLQGLYLGXDOSURMHFWFKDUDFWHULVWLFV$ULJKWWXUQGHFHOHUDWLRQODQHVKRXOGEHFRQVLGHUHGIRUORZHU WXUQLQJYROXPHVRQKLJKYROXPHVWUHHWVHJ:DVKLQJWRQ$YHQXH+LJKZD\$OHIWWXUQGHFHOHUDWLRQ ODQHVKRXOGEHFRQVLGHUHGIRUORFDWLRQVZKHUHOHIWWXUQLQJYHKLFOHVZRXOGEHUHTXLUHGWRTXHXHLQDKLJK VSHHG ! PSK WKURXJK ODQH ,QVWDOODWLRQ UHFRPPHQGDWLRQV IRUGHFHOHUDWLRQ ODQHV DQG UHODWHG LQWHUVHFWLRQ WXUQLQJ PRYHPHQW GLVWULEXWLRQV VKRZQ LQ WKH ILQDOWUDIILF VWXG\ UHSRUW ZLOO EH VXEMHFW WR DSSURYDOE\WKH&LW\(QJLQHHU 7KH3URMHFWLQFOXGHVWKHIROORZLQJWUDIILFFRQWUROIHDWXUHV x2QHDGGLWLRQDOZHVWERXQGWKURXJKODQHRQ$YHQXHDORQJWKHSURMHFWIURQWDJHFRQWLQXLQJ HDVWRIWKHVLJQDOL]HGLQWHUVHFWLRQ x([WHQGWKHHDVWERXQGGHGLFDWHGVWRUDJHODQHRQ$YHQXHDWWKHVLJQDOL]HGLQWHUVHFWLRQWR WKHSURSRVHGIXOODFFHVVGULYHZD\WKHHDVWHUQPRVWGULYHZD\RQ$YHQXHDQDGGLWLRQDO IHHWIRUDWRWDOVWRUDJHRIIHHW x,QVWDOODULJKWWXUQRYHUODSRSHUDWLRQIRUWKHVRXWKERXQGULJKWWXUQPRYHPHQWVLJQDOSKDVH 7KHVHSURSRVHGLPSURYHPHQWVDUHLQWHJUDWHGLQWRWKHSURMHFWGHVLJQWRLPSURYHRSHUDWLRQDOFDSDFLW\E\ SURYLGLQJ LQFUHDVHG ODQH DQG VWRUDJH FDSDFLW\ IRU WKH ZHVWERXQG WKURXJK DQG HDVWERXQG OHIWWXUQ PRYHPHQWVDVZHOODV PRUHJUHHQWLPHIRUWKHVRXWKERXQGULJKWWXUQPRYHPHQW$OEHUW*URYHUDQG $VVRFLDWHV-XO\$SSHQGL[)7KHIROORZLQJWDEOHVLGHQWLI\WKHUHVXOWVRIWKHWUDIILFVWXG\ SUHSDUHGIRUWKHSURMHFW 224 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 7DEOH ([LVWLQJ&RQGLWLRQV±$YHQXHDW-HIIHUVRQ6WUHHW 6FHQDULR(DVWERXQG/HIW 'HVLJQ4XHXH ,QWHUVHFWLRQ/HYHORI6HUYLFH /26 ,QWHUVHFWLRQ&DSDFLW\ 8WLOL]DWLRQ,&8 Analysis Period 1.5 y Qavg Delay (sec/veh) LOS Volume/Capacity Ratio $03HDN+RXUIW ' 0'3HDN+RXUIW ' 303HDN+RXUIW ' /HQJWKRIDYDLODEOHVWRUDJHLQ(%/WXUQSRFNHWDSSUR[LPDWHO\IW 7DEOH 2SHQLQJ'D\±:LWK3URMHFW±$YHQXHDW-HIIHUVRQ6WUHHW 6FHQDULR(DVWERXQG/HIW 'HVLJQ4XHXH ,QWHUVHFWLRQ/HYHORI6HUYLFH /26 ,QWHUVHFWLRQ&DSDFLW\ 8WLOL]DWLRQ,&8 Analysis Period 1.5 y Qavg Delay (sec/veh) LOS Volume/Capacity Ratio $03HDN+RXUIW ' 0'3HDN+RXUIW ' 303HDN+RXUIW ' /HQJWKRIDYDLODEOHVWRUDJHLQ(%/WXUQSRFNHWDSSUR[LPDWHO\IW 7DEOH )XWXUH%XLOGRXW<HDU±:LWK3URMHFW±$YHQXHDW-HIIHUVRQ6WUHHW 6FHQDULR(DVWERXQG/HIW 'HVLJQ4XHXH ,QWHUVHFWLRQ/HYHORI6HUYLFH /26 ,QWHUVHFWLRQ&DSDFLW\ 8WLOL]DWLRQ,&8 Analysis Period 1.5 y Qavg Delay (sec/veh) LOS Volume/Capacity Ratio $03HDN+RXUIW ' 0'3HDN+RXUIW ' 303HDN+RXUIW ' /HQJWKRIDYDLODEOHVWRUDJHLQ(%/WXUQSRFNHWDSSUR[LPDWHO\IW ,PSDFW$QDO\VLV D &RQIOLFWZLWKDQDSSOLFDEOHSODQRUGLQDQFHRUSROLF\HVWDEOLVKLQJPHDVXUHVRIHIIHFWLYHQHVVIRUWKH SHUIRUPDQFHRIWKHFLUFXODWLRQV\VWHPWDNLQJLQWRDFFRXQWDOOPRGHVRIWUDQVSRUWDWLRQLQFOXGLQJPDVV WUDQVLWDQGQRQPRWRUL]HGWUDYHODQGUHOHYDQWFRPSRQHQWVRIWKHFLUFXODWLRQV\VWHPLQFOXGLQJEXWQRW OLPLWHGWRLQWHUVHFWLRQVVWUHHWVKLJKZD\VDQGIUHHZD\VSHGHVWULDQDQGELF\FOHSDWKVDQGPDVV WUDQVLW" /HVV7KDQ6LJQLILFDQW3HUWKH&LW\RI/D4XLQWD*HQHUDO3ODQWKHSDUFHOLV]RQHGIRUFRPPHUFLDOXVH WKHUHIRUHWKHGHYHORSPHQWSURMHFWLVDOUHDG\DFFRXQWHGIRULQWKH&LW\¶VWUDIILFJURZWKIRUHFDVWLQJ/HVV WKDQVLJQLILFDQWLPSDFWVZRXOGRFFXU$GGLWLRQDOO\WKHVLWH]RQLQJLV&RPPXQLW\&RPPHUFLDOZKLFK 225 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH DOORZVIRUD0D[LPXP)ORRU$UHD5DWLR>)$5@JURVVIORRUDUHDRIDOOEXLOGLQJVGLYLGHGE\WKH EXLOGLQJVLWHDUHD7KHSURSRVHG3URMHFWUHSUHVHQWVDSSUR[LPDWHO\)$57KHUHIRUHEHFDXVHWKH 3URMHFW SURSRVHV OHVV WKDQ WKH PD[LPXP DOORZHG XQGHU WKH ]RQLQJ D OHVV WKDQ VLJQLILFDQW LPSDFW LV DQWLFLSDWHG E &RQIOLFWZLWKDQDSSOLFDEOHFRQJHVWLRQPDQDJHPHQWSURJUDPLQFOXGLQJEXWQRWOLPLWHGWROHYHORI VHUYLFHVWDQGDUGVDQGWUDYHOGHPDQGPHDVXUHVRURWKHUVWDQGDUGVHVWDEOLVKHGE\WKHFRXQW\ FRQJHVWLRQPDQDJHPHQWDJHQF\IRUGHVLJQDWHGURDGVRUKLJKZD\V" /HVV 7KDQ 6LJQLILFDQW :LWK 0LWLJDWLRQ ,QFRUSRUDWHG7KHIORZRIYHKLFOHWUDIILFLVIUHTXHQWO\ GHVFULEHGXVLQJWKHOHYHORIVHUYLFH/26VFDOHZKLFKLVDPHDVXUHPHQWRIRSHUDWLRQDOFKDUDFWHULVWLFVRI WUDIILFIORZRQDURDGZD\RUDWWKHLQWHUVHFWLRQRIURDGZD\VEDVHGRQWUDIILFYROXPHVDQGIDFLOLW\W\SH 7UDIILFRSHUDWLRQVDUHDVVHVVHGXVLQJOHYHOVUDQJLQJIURP³$´WR³)´ZLWK³$´UHSUHVHQWLQJWKHKLJKHVW EHVWOHYHORIVHUYLFHLQWHUPVRIWUDYHOVSHHGGHOD\PDQHXYHUDELOLW\GULYHUFRPIRUWDQGFRQYHQLHQFH ,QJHQHUDOWKHIROORZLQJGHVFULSWLRQVDSSO\WRWKHTXDOLWDWLYHOHYHOVGHVFULEHGDERYH³$´IUHHIORZ³%´ UHDVRQDEO\IUHHIORZ³&´VWDEOHIORZ³'´DSSURDFKLQJXQVWDEOHIORZ³(´XQVWDEOHIORZDQG³)´± IRUFHGRUEUHDNGRZQIORZ 7KHWUDIILFVWXG\LGHQWLILHGWKDWDSSUR[LPDWHO\QHWQHZYHKLFOHWULSVZLOOEHJHQHUDWHGE\WKH SURMHFWDVVXPLQJDFRQVHUYDWLYHSHUFHQWSDVVE\WULSUDWH,WLVHVWLPDWHGWKDWDSSUR[LPDWHO\QHW QHZWULSVZLOORFFXULQWKH$0SHDNKRXUDQGDSSUR[LPDWHO\QHWQHZWULSVZLOORFFXULQWKH30 SHDNKRXU$OEHUW*URYHUDQG$VVRFLDWHV-XO\$SSHQGL[) 7KH&LW\RI/D4XLQWDFRQGXFWHGD/HIWWXUQ4XHXH6WXG\LQ'HFHPEHUZKLFKVWXGLHGWKHTXHXLQJ DWWKHGHGLFDWHGHDVWERXQGOHIWWXUQVWRUDJHODQHRQ$YHQXHDWWKHLQWHUVHFWLRQZLWK-HIIHUVRQ6WUHHW 7KHVWXG\ZDVFRPSULVHGRIVLJQDOF\FOHVRYHUWZRGD\V7KHORQJHVWTXHXHH[SHULHQFHGGXULQJWKH HQWLUHVWXG\SHULRGZDVFDUVDQGWKDWRFFXUUHGRQHWLPHRYHUWKHWZRGD\V,QDFFRUGDQFHZLWKWKH&LW\ RI/D4XLQWD¶V(QJLQHHULQJ%XOOHWLQ(%OHIWWXUQSRFNHWVGRQRWQHHGWREHGHVLJQHGWRWKH ORQJHVWSRVVLEOHYHKLFOHTXHXHOHQJWKEXWWRWKHWKSHUFHQWLOHTXHXH,QDFFRUGDQFHZLWK(%WKH WKSHUFHQWLOHTXHXHOHQJWKZDVFRPSXWHGXVLQJWKH+LJKZD\&DSDFLW\0DQXDO+&0PHWKRGRORJ\WR EHYHKLFOHVDQGIHHWLQOHQJWK &XUUHQWO\WKHGHGLFDWHGHDVWERXQGOHIWWXUQVWRUDJHODQHRQ$YHQXHDWWKHLQWHUVHFWLRQRI-HIIHUVRQ 6WUHHWLVDSSUR[LPDWHO\IHHWORQJ3HUWKHWUDIILFVWXG\WKHZRUVWFDVHTXHXHOHQJWKRIWKH HDVWERXQGOHIWWXUQODQHDW$YHQXHDQG-HIIHUVRQ6WUHHWDW3URMHFWRSHQLQJGD\ZLOOEHDSSUR[LPDWHO\ IHHWORQJ:LWKWKHSURMHFWDQGDUHDEXLOGRXWE\WKH\HDUWKHWUDIILFVWXG\LQGLFDWHGWKDWLQWKH ZRUVWFDVHVFHQDULRWKHHDVWERXQGODQHTXHXHOHQJWKQHHGHGZRXOGEHDSSUR[LPDWHO\IW7KH3URMHFW SURSRVHVWRH[WHQGWKHHDVWERXQGOHIWVWRUDJHODQHWRDSSUR[LPDWHO\IHHWZKLFKLVJUHDWHUWKDQWKH UHTXLUHPHQWVRI(%DQGJUHDWHUWKDQWKHUHTXLUHPHQWVRIWKH+&00HWKRGRORJ\7KHSURSRVHG 3URMHFWLPSURYHPHQWVOLVWHGEHORZZLOODFFRPPRGDWHWKHSURMHFWHGWUDIILFORDGLQJDWWKHLQWHUVHFWLRQ $GGLWLRQDOO\ WKH &LW\ RI /D 4XLQWD SURYLGHV DXWRPDWHG WUDIILFOLJKW WLPLQJ DW WKH LQWHUVHFWLRQ 7KH DXWRPDWHG WLPLQJ DOORZV IRU GHPDQGUHVSRQVHVHUYLFHFRQYHQLHQFH WLPLQJ WR WKH LQWHUVHFWLRQ WR DFFRPPRGDWHEHWWHUWUDIILFIORZDWSHDNWLPHVDVQHFHVVDU\ 7KH-XO\WUDIILFVWXG\LQGLFDWHGWKDWZLWKRXWWKHSURMHFWWKHLQWHUVHFWLRQRI-HIIHUVRQ6WUHHWDQG $YHQXHZLOORSHUDWHDW/26'DVVXPLQJDSHUFHQWDPELHQWJURZWKUDWHLQWKHDUHD$OEHUW*URYHU DQG$VVRFLDWHV-XO\$SSHQGL[)7DEOH$VVXPLQJWKHDPELHQWDUHDJURZWKSOXVWKHQHZ H[SHFWHGSURMHFWWULSVDVZHOODVWKHDGGLWLRQDOZHVWERXQGWKURXJKODQHFDSDFLW\DQGLPSOHPHQWDWLRQRI 0LWLJDWLRQ0HDVXUH75$)DQGSURMHFWLPSURYHPHQWVOLVWHGDERYHWKHLQWHUVHFWLRQRI-HIIHUVRQ6WUHHW DQG$YHQXHLVH[SHFWHGWRRSHUDWHDWLWVFXUUHQW/26'ZKLFKLVDQDFFHSWDEOHOHYHORIVHUYLFHSHUWKH 226 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH *HQHUDO3ODQDQG(%DQGWKHSURSRVHGIXOODFFHVVGULYHZD\RQ$YHQXHZLOORSHUDWHDW/26$ DWRSHQLQJGD\FRQGLWLRQV 7KHUHIRUHWKHLPSDFWRIWKLVFULWHULRQLVDQWLFLSDWHGWREHOHVVWKDQVLJQLILFDQWZLWKPLWLJDWLRQ F 5HVXOWLQDFKDQJHLQDLUWUDIILFSDWWHUQVLQFOXGLQJHLWKHUDQLQFUHDVHLQWUDIILFOHYHOVRUDFKDQJHLQ ORFDWLRQWKDWUHVXOWVLQVXEVWDQWLDOVDIHW\ULVNV" 1R,PSDFW7KHEXLOGLQJVDUHSURSRVHGWREHRQHVWRU\DQGDSSUR[LPDWHO\IHHWIURPIORRUWRURRI OLQH7KLVLVFRQVLVWHQWZLWKWKHKHLJKWRIWKHEXLOGLQJVLQWKHVXUURXQGLQJDUHD$GGLWLRQDOO\WKHUHDUHQR GHVLJQHOHPHQWVRIWKH3URMHFWWKDWZRXOGUHVXOWLQDSRWHQWLDOFKDQJHLQDLUWUDIILFSDWWHUQV1RLPSDFWV ZRXOGRFFXU G 6XEVWDQWLDOO\LQFUHDVHKD]DUGVGXHWRDGHVLJQIHDWXUHHJVKDUSFXUYHVRUGDQJHURXVLQWHUVHFWLRQV RULQFRPSDWLEOHXVHVHJIDUPHTXLSPHQW" /HVV7KDQ6LJQLILFDQW7KH3URMHFWLQFOXGHVWKHIROORZLQJWUDIILFFRQWUROIHDWXUHV x2QHDGGLWLRQDOZHVWERXQGWKURXJKODQHRQ$YHQXHDORQJWKHSURMHFWIURQWDJHFRQWLQXLQJ HDVWRIWKHVLJQDOL]HGLQWHUVHFWLRQ x([WHQGWKHHDVWERXQGGHGLFDWHGVWRUDJHODQHRQ$YHQXHDWWKHVLJQDOL]HGLQWHUVHFWLRQWR WKHSURSRVHGIXOODFFHVVGULYHZD\WKHHDVWHUQPRVWGULYHZD\RQ$YHQXHWRDQDGGLWLRQDO IHHWIRUDWRWDOVWRUDJHRIIHHW x,QVWDOODULJKWWXUQRYHUODSRSHUDWLRQIRUWKHVRXWKERXQGULJKWWXUQPRYHPHQWVLJQDOSKDVH 7KH3URMHFWZLOODOORZIRUWZRGULYHZD\VRQWR$YHQXHVSDFHGDSSUR[LPDWHO\DWIHHWDQGIHHW UHVSHFWLYHO\IURPWKHLQWHUVHFWLRQRI-HIIHUVRQ6WUHHWDQG$YHQXH%RWKGULYHZD\VDUHVSDFHGIURP WKH LQWHUVHFWLRQ LQ D PDQQHU WKDW SURYLGHV JRRG VLJKW GLVWDQFHDQG DPSOH WXUQLQJ GLVWDQFH IURP WKH LQWHUVHFWLRQ x7KH HDVWHUQ GULYHZD\ RQ $YHQXH DSSUR[LPDWHO\ IHHW ZHVWRI WKH -HIIHUVRQ 6WUHHW LQWHUVHFWLRQZLOODOORZIRUIXOOPRYHPHQWRIERWKOHIWDQGULJKWWXUQVRQWR$YHQXHWKHUHE\ SURYLGLQJXVHUVDFFHVVWRSRLQWVHDVWRIWKH3URMHFW6KDUHGOHIWWXUQDQGULJKWWXUQPDUNLQJVDUH VSHFLILFDOO\RXWOLQHGLQ&KDSWHURIWKH&DOLIRUQLD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV &$087&'DQGVXFKPRYHPHQWVDUHJHQHUDOO\DOORZHGDWPDQ\FRUQHUJDVVWDWLRQVWKURXJKRXW 6RXWKHUQ&DOLIRUQLD x7KHZHVWHUQGULYHZD\RQ$YHQXHDSSUR[LPDWHO\IHHWZHVWWKHLQWHUVHFWLRQRI-HIIHUVRQ 6WUHHWZLOOEHUHVWULFWHGWRULJKWWXUQVRQO\ $VVWDWHGDERYHWKHGULYHZD\IURP'HUHN$ODQ'ULYHZDVHOLPLQDWHGGXHWRFRQFHUQVIURPVXUURXQGLQJ UHVLGHQWV7KHWUDIILFFRQVXOWDQWIRUWKHSURMHFWKDVVWDWHGWKDWLWZRXOGEHXQOLNHO\IRUPRWRULVWVGULYLQJ DORQJ-HIIHUVRQ6WUHHWWRWKHVKRSSLQJFHQWHUZRXOGXVHWKLVGULYHZD\7KLVHOLPLQDWLRQZRXOGKDYHOLWWOH WR QR LPSDFW RQ VLWH FLUFXODWLRQ RU RQVWUHHW FLUFXODWLRQDFFHVV VLQFH LW ZDV RULJLQDOO\ GHVLJQHG WR DFFRPPRGDWHUHVLGHQWVOLYLQJLQWKHDGMDFHQWUHVLGHQWLDOQHLJKERUKRRG7KHUHZRXOGEHQRQHJDWLYH LPSDFW IRU UHVLGHQWV XVLQJ WKH VKRSSLQJ FHQWHU DQG QR QHJDWLYHLPSDFW IRU UHVLGHQWV DFFHVVLQJ WKHLU QHLJKERUKRRGVLQFHWKH\ZRXOGVWLOOKDYHDFFHVVWRWKHFHQWHUIURP-HIIHUVRQ'ULYHDQG$YHQXH 7KHUHIRUHWKHLPSDFWLVOHVVWKDQVLJQLILFDQW 227 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH H 5HVXOWLQLQDGHTXDWHHPHUJHQF\DFFHVV" 1R,PSDFW$V SUHYLRXVO\ GLVFXVVHG WKH 3URMHFW ZRXOG EH GHYHORSHG ZLWKLQYDFDQW ODQG DQG FRQVWUXFWLRQLVVKRUWWHUP7KXVLPSOHPHQWDWLRQRIWKH3URMHFWZRXOGQRWLPSHGHRULQKLELWHPHUJHQF\ DFFHVV1RLPSDFWVZRXOGRFFXU I &RQIOLFWZLWKDGRSWHGSROLFLHVSODQVRUSURJUDPVUHJDUGLQJSXEOLFWUDQVLWELF\FOHRUSHGHVWULDQ IDFLOLWLHVRURWKHUZLVHGHFUHDVHWKHSHUIRUPDQFHRUVDIHW\RIVXFKIDFLOLWLHV" /HVV7KDQ6LJQLILFDQW7KH3URMHFWZRXOGEHGHYHORSHGZLWKLQYDFDQWODQGDQGGRHVQRWSURSRVHORQJ WHUPFRQVWUXFWLRQLPSDFWVWRWKHVXUURXQGLQJVWUHHWV\VWHP7KH6XQ/LQHWUDQVLWDJHQF\SURYLGHVEXV VHUYLFHLQWKHUHJLRQ6XQ/LQHFXUUHQWO\SURYLGHVQRVHUYLFHZLWKLQSUR[LPLW\WRWKHSURMHFWVLWHDQGWKH FORVHVWEXVVWRSLVORFDWHGDSSUR[LPDWHO\PLOHVIURPWKHSURMHFWDW:DVKLQJWRQDQG$YHQXH 6XQ/LQHKDVQRSODQVWRLQVWDOODEXVVWRSDWWKHSURMHFWORFDWLRQ6XQ/LQH7UDQVLW2FWREHU7KH 3URMHFW LQFOXGHV QRQPHDQGHULQJ VLGHZDONV DORQJ WKH SHULPHWHUDQG LQWHULRU VLGHZDONV RIIHU $'$ FRPSOLDQWDFFHVVWRWKHSHULPHWHUVLGHZDONV7KHUHIRUHWKH3URMHFWFDQDFFRPPRGDWHWUDQVLWSHGHVWULDQ DQGELF\FOHIDFLOLWLHVLQWKHIXWXUH 7KXVLPSOHPHQWDWLRQRIWKH3URMHFWZRXOGQRWFRQIOLFWZLWKSXEOLFWUDQVLWDQGDOWHUQDWLYHWUDQVSRUWDWLRQ IDFLOLWLHV1RLPSDFWVZRXOGRFFXU 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ x7KHSURSRVHGVLWHSODQVKDOOEHUHGHVLJQHGWRSURYLGHDWOHDVWIHHWRIVWDFNLQJDWDOODFFHVV SRLQWVRUGHGLFDWHGULJKWWXUQLQWRWKHGULYHZD\VVKDOOEHSURYLGHG,IRQHRIWKHVHVWDQGDUGV FDQQRWEHPHWWKHDSSOLFDEOHDFFHVVSRLQWVKDOOEHHOLPLQDWHG 1RWH6LQFHWKHDSSURYDORIWKHRULJLQDO6SHFLILF3ODQWKHVLWHSODQKDVEHHQUHYLVHGWRSURYLGH DWOHDVWIHHWRIVWDFNLQJZLWKLQWKHGHYHORSPHQWDWDOODFFHVVSRLQWVWKURXJKDFRPELQDWLRQRI LQWHUQDOVWDFNLQJDQGRUGHGLFDWHGULJKWWXUQVLQWRWKHGULYHZD\V7KHUHIRUHWKLVPLWLJDWLRQ PHDVXUHLVQRORQJHUDSSOLFDEOHWRWKHFXUUHQWO\3URSRVHGSURMHFW 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV 75$)3ULRUWRUHFRUGDWLRQRIWKH)LQDO7HQWDWLYH3DUFHO0DSWKH$SSOLFDQWVKDOOHQWHULQWRDQ DJUHHPHQWZLWKWKH&LW\RI/D4XLQWDDQGSRVWVHFXULW\WRGHVLJQDQGFRQVWUXFWDWWKH LQWHUVHFWLRQRI$YHQXHDQG-HIIHUVRQ6WUHHWWZRHDVWERXQGOHIWWXUQODQHVRQ$YHQXH WRQRUWKERXQG-HIIHUVRQ6WUHHWLIUHTXLUHGE\WKH3ODQQLQJ&RPPLVVLRQ ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHHIIHFWVDUHDQWLFLSDWHGZLWKWKHLQFOXVLRQRIWKHDERYHPLWLJDWLRQPHDVXUH 228 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ ;9,,7ULEDO&XOWXUDO5HVRXUFHV :RXOGWKHSURMHFWFDXVHDVXEVWDQWLDODGYHUVHFKDQJHLQ WKHVLJQLILFDQFHRIDWULEDOFXOWXUDOUHVRXUFHGHILQHGLQ 3XEOLF 5HVRXUFHV &RGH VHFWLRQ DV HLWKHU D VLWH IHDWXUH SODFH FXOWXUDO ODQGVFDSH WKDW LV JHRJUDSKLFDOO\ GHILQHGLQWHUPVRIWKHVL]HDQGVFRSHRIWKHODQGVFDSH VDFUHGSODFHRUREMHFWZLWKFXOWXUDOYDOXHWRD&DOLIRUQLD 1DWLYH$PHULFDQWULEHDQGWKDWLV D/LVWHGRUHOLJLEOHIRUOLVWLQJLQWKH&DOLIRUQLD5HJLVWHU RI+LVWRULFDO5HVRXUFHVRULQDORFDOUHJLVWHURIKLVWRULFDO UHVRXUFHV DV GHILQHG LQ 3XEOLF 5HVRXUFHV &RGH VHFWLRQ NRU ; E $ UHVRXUFH GHWHUPLQHG E\ WKH OHDG DJHQF\ LQ LWV GLVFUHWLRQ DQG VXSSRUWHG E\ VXEVWDQWLDO HYLGHQFH WR EH VLJQLILFDQWSXUVXDQWWRFULWHULDVHWIRUWKLQVXEGLYLVLRQF RI3XEOLF5HVRXUFHV&RGH6HFWLRQ,QDSSO\LQJWKH FULWHULDVHWIRUWKLQVXEGLYLVLRQFRI3XEOLF5HVRXUFHV &RGH6HFWLRQWKHOHDGDJHQF\VKDOOFRQVLGHUWKH VLJQLILFDQFH RI WKH UHVRXUFH WR D &DOLIRUQLD 1DWLYH $PHULFDQWULEH ; (QYLURQPHQWDO6HWWLQJ &507HFKSUHSDUHGWZRVWXGLHVIRUWKH3URMHFWVLWH7KHILUVWFRQVLVWHGRI3KDVH,DQG3KDVH,,FXOWXUDO DVVHVVPHQW FRQGXFWHG LQ DQG IRU DSSUR[LPDWH DFUHVRI XQGHYHORSHG ODQG DV SDUW RI 7HQWDWLYH 3DUFHO 0DS 1R DQG 7HQWDWLYH 7UDFW 0DS 1R ZKLFK LQFOXGHG D UHVLGHQWLDO GHYHORSPHQWDQGWKHFXUUHQWFRPPHUFLDO3URMHFWVLWH7KHVWXG\ZDVSDUWRIWKHHQYLURQPHQWDOLPSDFW UHYLHZSURFHVVIRUWKHSURSRVHGVXEGLYLVLRQDQGGHYHORSPHQWRIWKHSURSHUW\DVUHTXLUHGE\WKH&LW\RI /D4XLQWD/HDG$JHQF\IRUWKHSURMHFWLQFRPSOLDQFHZLWKWKH&DOLIRUQLD(QYLURQPHQWDO4XDOLW\$FW &(4$35&HWVHT 7KHVHFRQGVWXG\ZDVFRQGXFWHGLQ-XQHDQGFRQVLVWHGRIDKLVWRULFDODUFKDHRORJLFDOUHVRXUFHV UHFRUGVVHDUFKKLVWRULFDOEDFNJURXQGUHYLHZDQGDQDUFKDHRORJLFDOILHOGLQVSHFWLRQRIWKHDSSUR[LPDWHO\ DFUH3URMHFWVLWH 7KH &50 UHVHDUFK FRQFOXGHG WKDW QR ³KLVWRULF SURSHUWLHV´ ³KLVWRULFDO UHVRXUFHV´ RU ³WULEDO FXOWXUDO UHVRXUFHV´DUHSUHVHQWZLWKLQRUDGMDFHQWWRWKH3URMHFWDUHD+RZHYHU&50LGHQWLILHGWKDWWKHUHKDYH EHHQSUHYLRXVGLVFRYHULHVLQWKH3URMHFWYLFLQLW\DQRYHUDOOKLJKVHQVLWLYLW\WRDUFKDHRORJLFDOUHVRXUFHVRQ WKH3URMHFWVLWHDQGWKHSRWHQWLDOWRHQFRXQWHUVXEVXUIDFHSUHKLVWRULFFXOWXUDOUHPDLQVZLWKLQWKHSURMHFW ERXQGDULHV7KHUHIRUH&507(&+UHFRPPHQGHGWKDWDOOJUDGLQJJUXEELQJWUHQFKLQJH[FDYDWLRQVDQG RWKHU HDUWKPRYLQJ DFWLYLWLHV LQ WKH SURMHFW DUHD EH PRQLWRUHGE\ D TXDOLILHG DUFKDHRORJLVW 7KLV LQIRUPDWLRQDQGPLWLJDWLRQKDVEHHQLGHQWLILHGLQ6HFWLRQ9RIWKLVGRFXPHQW :KLOHWKH3KDVH,,FXOWXUDOUHVRXUFHVLQYHVWLJDWLRQLQGLFDWHGWKDWWKHUHZHUHPLQLPDOVXEVXUIDFHDUWLIDFWV UHFRYHUHGIURPWKH3KDVH,,VXUYH\WKHSURMHFWDUHDLVLQDQDUHDWKDWKDVKLJKSUHKLVWRULFVHQVLWLYLW\ $GGLWLRQDOO\WKHSURMHFWLVDGMDFHQWWRWKH&KHPHKXHYL7UDGLWLRQDO8VH$UHD)RUWKHVHUHDVRQVWKH 229 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH SURMHFW DUHD KDV WKH SRVVLELOLW\ RI LQDGYHUWHQW GLVFRYHULHV ZKLFK PD\ KDYH VLJQLILFDQW LPSDFWV RQ SRWHQWLDOFXOWXUDOUHVRXUFHVWKDWFRQFHUQWKH7ULEH 7KHUHLVDQLQFUHDVHGSRVVLELOLW\RIHQFRXQWHULQJFXOWXUDOUHVRXUFHVGXULQJWKHFRQVWUXFWLRQSURFHVVHVWKDW PD\WDNHSODFHEHFDXVHRIFXOWXUDOUHVRXUFHVUHFRUGHGZLWKLQWKHSURMHFW VERXQGDULHVDQGLWLVLQWKH YLFLQLW\RIDQDUHDZLWKKLJKDUFKDHRORJLFDOVHQVLWLYLW\$YRLGDQFHLIIHDVLEOHZRXOGQHJDWHDGYHUVH HIIHFWVRQWKHSURMHFW&507(&+UHFRPPHQGHGWKDWDTXDOLILHGDUFKDHRORJLVWPRQLWRUDOOJUDGLQJ JUXEELQJWUHQFKLQJH[FDYDWLRQVDQGRWKHUHDUWKPRYLQJDFWLYLWLHVLQWKHSURMHFWDUHD ,PSDFW$QDO\VLV D/LVWHGRUHOLJLEOHIRUOLVWLQJLQWKH&DOLIRUQLD5HJLVWHURI+LVWRULFDO5HVRXUFHVRULQDORFDOUHJLVWHURI KLVWRULFDOUHVRXUFHVDVGHILQHGLQ3XEOLF5HVRXUFHV&RGHVHFWLRQN 1R,PSDFW7KHUHDUHQRUHVRXUFHVWKDWKDYHEHHQLGHQWLILHGDVHOLJLEOHIRUOLVWLQJWRWKH&DOLIRUQLD 5HJLVWHURI+LVWRULF3ODFHV7KHUHIRUHWKHUHLVQRLPSDFW E$UHVRXUFHGHWHUPLQHGE\WKHOHDGDJHQF\LQLWVGLVFUHWLRQDQGVXSSRUWHGE\VXEVWDQWLDOHYLGHQFHWR EHVLJQLILFDQWSXUVXDQWWRFULWHULDVHWIRUWKLQVXEGLYLVLRQFRI3XEOLF5HVRXUFHV&RGH6HFWLRQ,Q DSSO\LQJ WKH FULWHULD VHW IRUWK LQ VXEGLYLVLRQ F RI 3XEOLF 5HVRXUFHV &RGH 6HFWLRQ WKH OHDG DJHQF\VKDOOFRQVLGHUWKHVLJQLILFDQFHRIWKHUHVRXUFHWRD&DOLIRUQLD1DWLYH$PHULFDQWULEH /HVVWKDQ6LJQLILFDQWZLWK0LWLJDWLRQ,QFRUSRUDWHG7KHUHDUHQRUHVRXUFHVVXSSRUWHGE\VXEVWDQWLDO HYLGHQFHWREHVLJQLILFDQWSXUVXDQWWRFULWHULDVHWIRUWKLQVXEGLYLVLRQFRI3XEOLF5HVRXUFHV&RGH 6HFWLRQ7KHUHIRUHWKHUHLVQRLPSDFW+RZHYHUWKHUHKDYHEHHQSDVWGLVFRYHULHVLQWKHYLFLQLW\ WKHUHIRUH RYHUDOO DUFKDHRORJLFDO VHQVLWLYLW\ RI WKH SURMHFW ORFDWLRQ UHPDLQV KLJK DQG WKH SRWHQWLDO RI HQFRXQWHULQJ VXEVXUIDFH SUHKLVWRULF FXOWXUDO UHPDLQV ZLWKLQ WKH SURMHFW ERXQGDULHV LV D SRWHQWLDO ,PSOHPHQWDWLRQRI7&5ZLOOUHGXFHWKHSRWHQWLDOLPSDFWVWRSRWHQWLDOXQGHWHUPLQHGGLVFRYHULHVWROHVV WKDQVLJQLILFDQW 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGZLWKWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQIRUWKLVFULWHULRQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV 75&1DWLYH$PHULFDQ0RQLWRUVIURPWKH7ZHQW\1LQH3DOPV%DQGRI0LVVLRQ,QGLDQVRU $JXD &DOLHQWH %DQG RI &DKXLOOD ,QGLDQV VKRXOG EH SUHVHQW GXULQJ WKH LQLWLDO JUDGLQJJURXQGGLVWXUELQJDFWLYLWLHV ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHHIIHFWVDUHDQWLFLSDWHGZLWKWKHLQFOXVLRQRIWKHDERYHPLWLJDWLRQPHDVXUH 230 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ ;9,,,8WLOLWLHVDQG6HUYLFH6\VWHPV :RXOGWKHSURMHFW D([FHHGZDVWHZDWHUWUHDWPHQWUHTXLUHPHQWVRIWKH DSSOLFDEOH5HJLRQDO:DWHU4XDOLW\&RQWURO%RDUG"; E5HTXLUHRUUHVXOWLQWKHFRQVWUXFWLRQRIQHZZDWHU RUZDVWHZDWHUWUHDWPHQWIDFLOLWLHVRUH[SDQVLRQRI H[LVWLQJIDFLOLWLHVWKHFRQVWUXFWLRQRIZKLFKFRXOG FDXVHVLJQLILFDQWHQYLURQPHQWDOHIIHFWV" ; F5HTXLUHRUUHVXOWLQWKHFRQVWUXFWLRQRIQHZ VWRUPZDWHUGUDLQDJHIDFLOLWLHVRUH[SDQVLRQRIH[LVWLQJ IDFLOLWLHVWKHFRQVWUXFWLRQRIZKLFKFRXOGFDXVH VLJQLILFDQWHQYLURQPHQWDOHIIHFWV" ; G+DYHVXIILFLHQWZDWHUVXSSOLHVDYDLODEOHWRVHUYHWKH SURMHFWIURPH[LVWLQJHQWLWOHPHQWVDQGUHVRXUFHVRU DUHQHZRUH[SDQGHGHQWLWOHPHQWVQHHGHG" ; H5HVXOWLQDGHWHUPLQDWLRQE\WKHZDVWHZDWHU WUHDWPHQWSURYLGHUZKLFKVHUYHVRUPD\VHUYHWKH SURMHFWWKDWLWKDVDGHTXDWHFDSDFLW\WRVHUYHWKH SURMHFW VSURMHFWHGGHPDQGLQDGGLWLRQWRWKHSURYLGHU V H[LVWLQJFRPPLWPHQWV" ; I%HVHUYHGE\DODQGILOOVZLWKVXIILFLHQWSHUPLWWHG FDSDFLW\WRDFFRPPRGDWHWKHSURMHFW VVROLGZDVWH GLVSRVDOQHHGV" ; J&RPSO\ZLWKIHGHUDOVWDWHDQGORFDOVWDWXWHVDQG UHJXODWLRQVUHODWHGWRVROLGZDVWH"; (QYLURQPHQWDO6HWWLQJ /XQGLQ'HYHORSPHQWDSULYDWHHQWLW\LVUHTXHVWLQJDXWKRUL]DWLRQIURPWKH&LW\RI/D4XLQWDWRFRQVWUXFW DVTXDUHIRRWPL[HGXVHFRPPHUFLDOFHQWHUGHYHORSPHQWSURMHFWRQDDFUHYDFDQWSDUFHODWWKH LQWHUVHFWLRQ RI -HIIHUVRQ 6WUHHW DQG $YHQXH LQ WKH &LW\ RI /D 4XLQWD 3URSRVHG XVHV ZLWKLQ WKH FRPPHUFLDOFHQWHUGHYHORSPHQWLQFOXGHEDQNVUHVWDXUDQWVJDVROLQHVHUYLFHVWDWLRQDQGJURFHU\VWRUH )LJXUH)LJXUH 7KH$VVHVVRU3DUFHO1XPEHUVIRUWKLV3URMHFWDUH$31V DQG3HUWKH&LW\RI/D4XLQWD*HQHUDO3ODQWKH3URMHFWVLWHLV]RQHG&RPPXQLW\ &RPPHUFLDO&&IRUFRPPHUFLDOXVH 'RPHVWLFZDWHULVSURYLGHGE\WKH&RDFKHOOD9DOOH\:DWHU'LVWULFW&9:',WVVRXUFHRIZDWHULV JURXQGZDWHUDQGLPSRUWZDWHU :DVWHZDWHUVHUYLFHVLVDOVRSURYLGHGE\WKH&9:'7KH3URMHFWVLWHZLOOEHVHUYHGE\WKH0LG9DOOH\ :DWHU 5HFODPDWLRQ 3ODQW 7KH &9:' UHSRUWV WKDW LW DQQXDOO\ WUHDWV QHDUO\ ELOOLRQ JDOORQV RI 231 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH ZDVWHZDWHU IURP WKURXJKRXW WKH &RDFKHOOD 9DOOH\ 7KH &9:' DOVRKDV WKH FDSDFLW\ WR LQFUHDVH LWV ZDVWHZDWHUWUHDWPHQWDVWKH&RDFKHOOD9DOOH\¶VSRSXODWLRQJURZV 6ROLGZDVWHLQWKH&LW\LVVHUYHGE\%XUUWHF:DVWH5HF\FOLQJ6HUYLFHVZKLFKWUDQVSRUWVWKHZDVWHWRWKH (GRP+LOO7UDQVIHU6WDWLRQORFDWHGLQWKH&LW\RI&DWKHGUDO&LW\)URPWKHWUDQVIHUVWDWLRQWKHZDVWHLV WUDQVSRUWHGWRRQHRIWKUHHUHJLRQDOODQGILOOV/DPE&DQ\RQ%DGODQGVRU(O6REUDQWHHDFKRIZKLFKKDV UHPDLQLQJORQJWHUPFDSDFLW\%XUUWHFDOVRSURYLGHVVROLGZDVWHDQGJUHHQZDVWHUHF\FOLQJVHUYLFHV ,PSDFW$QDO\VLV D ([FHHGZDVWHZDWHUWUHDWPHQWUHTXLUHPHQWVRIWKHDSSOLFDEOH5HJLRQDO:DWHU4XDOLW\&RQWURO%RDUG /HVV 7KDQ 6LJQLILFDQW 2QFH FRPSOHWH WKH SURMHFW ZLOO EH VHUYHG E\ WKH &9:'¶V H[LVWLQJ VHZHU V\VWHP6WRUPZDWHUZLOOEHWUHDWHGWKURXJKDQXQGHUJURXQGV\VWHPWRFROOHFWDOORIWKHVWRUPZDWHUUXQRII IURPWKHSURMHFWVLWH7KHUHIRUHWKH3URMHFWZLOOQRWH[FHHGZDVWHZDWHUWUHDWPHQWUHTXLUHPHQWVDQGZLOO KDYHDOHVVWKDQVLJQLILFDQWLPSDFW E 5HTXLUHRUUHVXOWLQWKHFRQVWUXFWLRQRIQHZZDWHURUZDVWHZDWHUWUHDWPHQWIDFLOLWLHVRUH[SDQVLRQRI H[LVWLQJIDFLOLWLHVWKHFRQVWUXFWLRQRIZKLFKFRXOGFDXVHVLJQLILFDQWHQYLURQPHQWDOHIIHFWV" /HVV7KDQ6LJQLILFDQW7KH&9:'UHYLHZHGWKH3URMHFWDQGLGHQWLILHGWKDWLWFRXOGVHUYHWKH3URMHFW ZLWKWKHH[LVWLQJZDWHUDQGZDVWHZDWHUWUHDWPHQWIDFLOLWLHV&9:'2FWREHU7KH&9:' LGHQWLILHG WKDW XWLOLWLHV DUH DYDLODEOH LQ WKH SXEOLF ULJKWV RI ZD\ WKH RQO\ ZDWHU DQG ZDVWHZDWHU LPSURYHPHQWVUHTXLUHGIRUWKH3URMHFWDUHRQVLWHSLSHOLQHVDQGXQLWFRQQHFWLRQVWRWKHLQIUDVWUXFWXUH V\VWHPVZKLFKDUHVXEMHFWWRFRQQHFWLRQIHHV7KHUHIRUHWKHSURSRVHG3URMHFWZRXOGQRWUHTXLUHRUUHVXOW LQWKHFRQVWUXFWLRQRUH[SDQVLRQRIQHZZDWHURUZDVWHZDWHUWUHDWPHQWIDFLOLWLHVRIIVLWHDQGWKH3URMHFW ZRXOGKDYHQRVLJQLILFDQWLPSDFWV F 5HTXLUHRUUHVXOWLQWKHFRQVWUXFWLRQRIQHZVWRUPZDWHUGUDLQDJHIDFLOLWLHVRUH[SDQVLRQRIH[LVWLQJ IDFLOLWLHVWKHFRQVWUXFWLRQRIZKLFKFRXOGFDXVHVLJQLILFDQWHQYLURQPHQWDOHIIHFWV" /HVV7KDQ6LJQLILFDQW7KHSURMHFWZLOOQRWUHTXLUHOHYHOVRIZDWHUXVDJHWKDWZRXOGLPSDFWVWRUPZDWHU GUDLQDJHV\VWHPVRQRUDURXQGWKH3URMHFWVLWH$VGLVFXVVHGLQ6HFWLRQ,;+\GURORJ\DQG:DWHU4XDOLW\ LPSHUYLRXVUXQRIIFUHDWHGIURPWKHSURMHFWZLOOGUDLQLQWRDQXQGHUJURXQGV\VWHP7KHUHIRUHXVHRIWKH SURSRVHGRQVLWHXQGHUJURXQGV\VWHPZLOOQRWUHTXLUHLQQHZRUH[SDQGHGVWRUPGUDLQSXEOLFLQIUDVWUXFWXUH WKDWZRXOGFDXVHVLJQLILFDQWHQYLURQPHQWDOHIIHFWV G +DYHVXIILFLHQWZDWHUVXSSOLHVDYDLODEOHWRVHUYHWKHSURMHFWIURPH[LVWLQJHQWLWOHPHQWVDQGUHVRXUFHV RUDUHQHZRUH[SDQGHGHQWLWOHPHQWVQHHGHG" /HVV7KDQ6LJQLILFDQW7KHSURSRVHG3URMHFWLVFRQVLVWHQWZLWKWKH&LW\¶V*HQHUDO3ODQDQG]RQLQJ7KH &9:'UHYLHZHGWKH3URMHFWDQGLGHQWLILHGWKDWLWFRXOGVHUYHWKH3URMHFWZLWKWKHH[LVWLQJZDWHUDQG HQWLWOHPHQWV&9:'2FWREHU7KH&9:'LGHQWLILHGWKDWWKH3URMHFWOLHVZLWKLQWKHVWXG\DUHD RIWKH:DWHU0DQDJHPHQW3ODQ8SGDWH7KH&9:'LGHQWLILHGWKDWWKHJURXQGZDWHUEDVLQLQWKH &RDFKHOOD9DOOH\LVLQDVWDWHRIRYHUGUDIWDQGHDFKQHZGHYHORSPHQWFRQWULEXWHVLQFUHPHQWDOO\WRWKH RYHUGUDIW&9:'LGHQWLILHGWKDWLWV:DWHU0DQDJHPHQW3ODQLVLQSODFHWRUHGXFHRYHUGUDIWDQGLGHQWLILHV VSHFLILFDFWLRQVIRUUHGXFLQJRYHUGUDIW7KH&9:'LGHQWLILHGWKDWWKH3URMHFWPXVWFRPSO\ZLWKHOHPHQWV DQGDFWLRQVGHVFULEHGLQWKHSODQ 7KHSURSRVHG3URMHFWZRXOGQRWUHTXLUHQHZRUH[SDQGHGZDWHUHQWLWOHPHQWVDQGWKH3URMHFWZRXOGKDYH QRUHODWHGVLJQLILFDQWLPSDFWV 232 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH H 5HVXOWLQDGHWHUPLQDWLRQE\WKHZDVWHZDWHUWUHDWPHQWSURYLGHUZKLFKVHUYHVRUPD\VHUYHWKHSURMHFW WKDWLWKDVDGHTXDWHFDSDFLW\WRVHUYHWKHSURMHFW VSURMHFWHGGHPDQGLQDGGLWLRQWRWKHSURYLGHU V H[LVWLQJFRPPLWPHQWV" /HVV7KDQ6LJQLILFDQW5HIHUWREDERYH I %HVHUYHGE\DODQGILOOVZLWKVXIILFLHQWSHUPLWWHGFDSDFLW\WRDFFRPPRGDWHWKHSURMHFW VVROLGZDVWH GLVSRVDOQHHGV" /HVV7KDQ6LJQLILFDQW%XUUWHF:DVWHSURYLGHVWUDVKFROOHFWLRQIRUWKH&LW\RI/D4XLQWDDQGZLOOKDXO WKH ZDVWH WR D WUDQVIHU VWDWLRQ IRU SURSHU GLVSRVDO DW RQH RI WKUHH UHJLRQDO ODQGILOOV /DPE &DQ\RQ %DGODQGVRU(O6REUDQWH$OOWKUHHODQGILOOVKDYHFDSDFLW\UHPDLQLQJIRUWKHORQJWHUP&LW\RI/D4XLQWD )HEUXDU\ &RQVWUXFWLRQ:DVWH7KHVLWHLVXQGHYHORSHGVRQRGHPROLWLRQZDVWHLVDQWLFLSDWHG6PDOOYROXPHVRI FRQVWUXFWLRQ ZDVWH DUH DQWLFLSDWHG GXULQJ FRQVWUXFWLRQ LQFOXGLQJ SDOOHWV VWUDSSLQJ SDFNDJLQJ H[FHVV ZRRGDQGPHWDO'XHWRWKHVPDOOYROXPHRIFRQVWUXFWLRQUHODWHGZDVWHWKDWPD\EHJHQHUDWHGGXULQJ FRQVWUXFWLRQDQGWKHPLOOLRQVRIFXELF\DUGVRIUHPDLQLQJFDSDFLW\DWWKHWKUHHUHJLRQDOODQGILOOVWKDW ZRXOGVHUYHWKH3URMHFWOHVVWKDQVLJQLILFDQWLPSDFWVZRXOGRFFXUXQGHUWKLVFULWHULRQDVDUHVXOWRIIXWXUH FRQVWUXFWLRQDFWLYLWLHV 2SHUDWLRQV:DVWH7KHZDVWHJHQHUDWHGE\WKLVSURSRVHG3URMHFWLVDQWLFLSDWHGWREHVLPLODUWRUHWDLO FHQWHUVZLWKVLPLODUXVHV$QQXDOZDVWHJHQHUDWLRQLVDQWLFLSDWHGDVIROORZV x*URFHU\VIFXELF\DUGV x6KRSVDQGEDQNVVIFXELF\DUGV x)DVW)RRGDQGUHVWDXUDQWVVIFXELF\DUGV 7KHWKUHHUHJLRQDOODQGILOOVKDYHORQJWHUPFDSDFLW\WKHUHIRUHLPSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW J &RPSO\ZLWKIHGHUDOVWDWHDQGORFDOVWDWXWHVDQGUHJXODWLRQVUHODWHGWRVROLGZDVWH" 1R,PSDFW$OOVROLGZDVWHJHQHUDWHGE\WKH3URMHFWGXULQJERWKFRQVWUXFWLRQDQGRSHUDWLRQZRXOGEH KDQGOHGLQDFFRUGDQFHZLWKDOODSSOLFDEOH)HGHUDO6WDWHDQGORFDOVWDWXWHVDQGUHJXODWLRQV7KH&LW\LV FXUUHQWO\UHTXLUHGWRLPSOHPHQWQHZDQGPDLQWDLQRQJRLQJZDVWHDQGUHF\FOLQJSURJUDPVDQGUHF\FOHDW OHDVWSHUFHQWRILWVVROLGZDVWHVWUHDPDQGLVPHHWLQJWKDWJRDO&LW\RI/D4XLQWD)HEUXDU\ 7KHUHIRUHQRLPSDFWVZRXOGRFFXUXQGHUWKLVFULWHULRQDVDUHVXOWRIIXWXUH3URMHFWDFWLYLWLHV 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW5HVROXWLRQ 1RPLWLJDWLRQPHDVXUHVZHUHLGHQWLILHGZLWKWKHSUHYLRXVO\DSSURYHG6SHFLILF3ODQIRUWKLVFULWHULRQ 0LWLJDWLRQ0HDVXUHV)DLUZD\3OD]D$PHQGPHQW($3DYLOLRQ3DOPV 1RPLWLJDWLRQPHDVXUHVDUHUHTXLUHG ,PSDFW&RQFOXVLRQV 1RVLJQLILFDQWDGYHUVHLPSDFWVDUHLGHQWLILHGRUDQWLFLSDWHGDQGQRPLWLJDWLRQPHDVXUHVDUHUHTXLUHG 233 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 3RWHQWLDOO\ 6LJQLILFDQW,PSDFW /HVV7KDQ 6LJQLILFDQWZLWK 0LWLJDWLRQ ,QFRUSRUDWHG /HVV7KDQ 6LJQLILFDQW,PSDFW 1R,PSDFWRU 'RHV1RW$SSO\ ;9,,,0DQGDWRU\)LQGLQJVRI6LJQLILFDQFH D'RHVWKHSURMHFWKDYHWKHSRWHQWLDOWRGHJUDGHWKH TXDOLW\RIWKHHQYLURQPHQWVXEVWDQWLDOO\UHGXFHWKH KDELWDWRIDILVKRUZLOGOLIHVSHFLHVFDXVHDILVKRU ZLOGOLIHSRSXODWLRQWRGURSEHORZVHOIVXVWDLQLQJ OHYHOVWKUHDWHQWRHOLPLQDWHDSODQWRUDQLPDO FRPPXQLW\UHGXFHWKHQXPEHURUUHVWULFWWKHUDQJHRI DUDUHRUHQGDQJHUHGSODQWRUDQLPDORUHOLPLQDWH LPSRUWDQWH[DPSOHVRIWKHPDMRUSHULRGVRI&DOLIRUQLD KLVWRU\RUSUHKLVWRU\" ; E'RHVWKHSURMHFWKDYHWKHSRWHQWLDOWRDFKLHYHVKRUW WHUPHQYLURQPHQWDOJRDOVWRWKHGLVDGYDQWDJHRIORQJ WHUPHQYLURQPHQWDOJRDOV" ; F'RHVWKHSURMHFWKDYHLPSDFWVWKDWDUHLQGLYLGXDOO\ OLPLWHGEXWFXPXODWLYHO\FRQVLGHUDEOH" &XPXODWLYHO\FRQVLGHUDEOHPHDQVWKDWWKH LQFUHPHQWDOHIIHFWVRIDSURMHFWDUHFRQVLGHUDEOHZKHQ YLHZHGLQFRQQHFWLRQZLWKWKHHIIHFWVRISDVWSURMHFWV WKHHIIHFWVRIRWKHUFXUUHQWSURMHFWVDQGWKHHIIHFWVRI SUREDEOHIXWXUHSURMHFWV" ; G'RHVWKHSURMHFWKDYHHQYLURQPHQWDOHIIHFWVZKLFK ZLOOFDXVHVXEVWDQWLDODGYHUVHHIIHFWVRQKXPDQ EHLQJVHLWKHUGLUHFWO\RULQGLUHFWO\" ; ,PSDFW$QDO\VLV D 'RHVWKHSURMHFWKDYHWKHSRWHQWLDOWRGHJUDGHWKHTXDOLW\RIWKHHQYLURQPHQWVXEVWDQWLDOO\UHGXFHWKH KDELWDWRIDILVKRUZLOGOLIHVSHFLHVFDXVHDILVKRUZLOGOLIHSRSXODWLRQWRGURSEHORZVHOIVXVWDLQLQJ OHYHOVWKUHDWHQWRHOLPLQDWHDSODQWRUDQLPDOFRPPXQLW\UHGXFHWKHQXPEHURUUHVWULFWWKHUDQJHRI D UDUH RU HQGDQJHUHG SODQW RU DQLPDO RU HOLPLQDWH LPSRUWDQW H[DPSOHV RI WKH PDMRU SHULRGV RI &DOLIRUQLDKLVWRU\RUSUHKLVWRU\" /HVV 7KDQ 6LJQLILFDQW ,PSDFW ZLWK 0LWLJDWLRQ ,QFRUSRUDWHG$OO LPSDFWV WR WKH HQYLURQPHQW LQFOXGLQJLPSDFWVWRKDELWDWIRUILVKDQGZLOGOLIHVSHFLHVILVKDQGZLOGOLIHSRSXODWLRQVSODQWDQGDQLPDO FRPPXQLWLHVUDUHDQGHQGDQJHUHGSODQWVDQGDQLPDOVDQGKLVWRULFDODQGSUHǦKLVWRULFDOUHVRXUFHVZHUH HYDOXDWHGDVSDUWRIWKLV,601' 3RWHQWLDOLPSDFWVDVVRFLDWHGZLWKQHVWLQJELUGVZHUHLGHQWLILHGKRZHYHULPSOHPHQWDWLRQRI0LWLJDWLRQ 0HDVXUH%,2UHGXFHVWKHSRWHQWLDOLPSDFWVWRWKDQVLJQLILFDQW6HFWLRQ,9%LRORJLFDO5HVRXUFHV DGGUHVVHVWKHSRWHQWLDOLPSDFWVDQG PLWLJDWLRQPHDVXUHVLQGHWDLO$VWKHUHDUHQRRWKHUSRWHQWLDOO\ VLJQLILFDQWLPSDFWVDQGQRIXUWKHUPLWLJDWLRQLVUHTXLUHGLQDQ\RWKHUDUHDWKHDGRSWLRQRIWKHPLWLJDWLRQ PHDVXUHVDVVRFLDWHGZLWKELRORJLFDOLPSDFWVZLOOHQVXUHWKDWWKH3URMHFWDVDZKROHZRXOGKDYHOHVVWKDQ VLJQLILFDQWFXPXODWLYHLPSDFWVRQWKHHQYLURQPHQWLQDQGDURXQGWKH3URMHFWDUHD 234 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH $GGLWLRQDOO\DVSUHYLRXVO\GLVFXVVHGDFXOWXUDOUHVRXUFHVUHFRUGVVHDUFKIRUWKH3URMHFWZDVFRQGXFWHG WRLGHQWLI\FXOWXUDOUHVRXUFHVZLWKLQRQHPLOHRIWKHSURMHFWVLWH&50-XQH7KHUHVHDUFKGLG QRW LGHQWLI\ DQ\ FXOWXUDO UHVRXUFHV ZLWKLQ 3URMHFW VLWH VSHFLILFDOO\ EXW LGHQWLILHG WKDW0LWLJDWLRQ 0HDVXUHV&8/&8/DQG&8/ZHUHUHTXLUHGGXULQJJUDGLQJDFWLYLWLHVGXHWRDKLJKFXOWXUDO UHVRXUFHVVHQVLWLYLW\ E 'RHVWKHSURMHFWKDYHWKHSRWHQWLDOWRDFKLHYHVKRUWWHUPHQYLURQPHQWDOJRDOVWRWKHGLVDGYDQWDJHRI ORQJWHUPHQYLURQPHQWDOJRDOV" /HVV7KDQ6LJQLILFDQW,PSDFW7KHSURMHFWREMHFWLYHLVWRFRQVWUXFWDUHWDLOFHQWHUWKDWLVFRQVLVWHQWZLWK WKH&LW\¶V*HQHUDO3ODQDQG=RQLQJ7KHSUHFHGLQJHYDOXDWLRQRISURMHFWLPSDFWVFRQFOXGHGWKDWLWFDQEH LPSOHPHQWHG ZLWKRXW FDXVLQJ DQ\ VLJQLILFDQW DGYHUVH LPSDFWV RQDQ\ HQYLURQPHQWDO UHVRXUFH LVVXHV 7KHUHIRUHPHHWLQJVKRUWWHUPJRDOVZLOOQRWEHWRWKHGLVDGYDQWDJHRIORQJWHUPHQYLURQPHQWDOJRDOV F 'RHV WKH SURMHFW KDYH LPSDFWV WKDW DUH LQGLYLGXDOO\ OLPLWHG EXW FXPXODWLYHO\ FRQVLGHUDEOH" &XPXODWLYHO\FRQVLGHUDEOHPHDQVWKDWWKHLQFUHPHQWDOHIIHFWVRIDSURMHFWDUHFRQVLGHUDEOH ZKHQYLHZHGLQFRQQHFWLRQZLWKWKHHIIHFWVRISDVWSURMHFWVWKHHIIHFWVRIRWKHUFXUUHQWSURMHFWV DQGWKHHIIHFWVRISUREDEOHIXWXUHSURMHFWV" /HVV7KDQ6LJQLILFDQW,PSDFWZLWK0LWLJDWLRQ,QFRUSRUDWHG$VGLVFXVVHGWKURXJKRXWWKLV,601' LPSOHPHQWDWLRQRIWKHSURSRVHG3URMHFWKDVWKHSRWHQWLDOWRUHVXOWLQHIIHFWVWRWKHHQYLURQPHQWWKDWDUH LQGLYLGXDOO\OLPLWHGEXWFXPXODWLYHO\FRQVLGHUDEOHSULPDULO\LQWKHFDWHJRULHVRI$LU4XDOLW\*UHHQKRXVH *DV DQG 7UDIILF 7KH &LW\¶V *HQHUDO3ODQ DQDO\VLV WKLV VLWH DVVXPHG WKH VLWH ZDV ]RQHG &RPPXQLW\ &RPPHUFLDO ZLWK D )$5 RI ZKLFK LV JUHDWHU WKDQ WKH SURSRVHG 6LQFH WKH *HQHUDO 3ODQ (QYLURQPHQWDO,PSDFW5HSRUWZDVD&LW\ZLGHDQDO\VLVDQGIRXQGVLJQLILFDQWLPSDFWVWKH&LW\DGRSWHGD 6WDWHPHQWRI2YHUULGLQJ&RQVLGHUDWLRQVLQWKHFDWHJRULHVRI$LU4XDOLW\*UHHQKRXVH*DVDQG7UDIILF )RU WKLV SURMHFW LQ DOO LQVWDQFHV ZKHUH WKH DQDO\VLV LGHQWLILHG WKDW WKH 3URMHFW KDV WKH SRWHQWLDO WR FRQWULEXWHWRDFXPXODWLYHO\FRQVLGHUDEOHLPSDFWWRWKHHQYLURQPHQW PLWLJDWLRQPHDVXUHVKDYHEHHQ LPSRVHGWRUHGXFHSRWHQWLDOHIIHFWVWROHVVWKDQVLJQLILFDQWOHYHOV$VVXFKZLWKLQFRUSRUDWLRQRIWKH PLWLJDWLRQPHDVXUHVLPSRVHGWKURXJKRXWWKLV,601'WKH3URMHFWZRXOGQRWFRQWULEXWHWRHQYLURQPHQWDO HIIHFWV WKDW DUH LQGLYLGXDOO\ OLPLWHG EXW FXPXODWLYHO\ FRQVLGHUDEOH DQG LPSDFWV ZRXOG EH OHVV WKDQ VLJQLILFDQW G 'RHV WKH SURMHFW KDYH HQYLURQPHQWDO HIIHFWV ZKLFK ZLOO FDXVH VXEVWDQWLDO DGYHUVH HIIHFWV RQ KXPDQEHLQJVHLWKHUGLUHFWO\RULQGLUHFWO\" /HVV 7KDQ 6LJQLILFDQW ,PSDFW ZLWK 0LWLJDWLRQ ,QFRUSRUDWHG 7KH 3URMHFW¶V SRWHQWLDO WR UHVXOW LQ HQYLURQPHQWDOHIIHFWVWKDWFRXOGDGYHUVHO\DIIHFWKXPDQEHLQJVHLWKHUGLUHFWO\RULQGLUHFWO\KDVEHHQ GLVFXVVHGWKURXJKRXWWKLV,601'DQGDUHSULPDULO\LQWKHFDWHJRULHVRI$HVWKHWLFV*HRORJ\DQG6RLOV +D]DUGVDQG+D]DUGRXV0DWHULDOV+\GURORJ\DQG:DWHU4XDOLW\1RLVHDQG7UDIILF,QLQVWDQFHVZKHUH WKHDQDO\VLVLGHQWLILHGWKDWWKH3URMHFWKDVSRWHQWLDOWRUHVXOWLQGLUHFWRULQGLUHFWDGYHUVHHIIHFWVWRKXPDQ EHLQJVPLWLJDWLRQPHDVXUHVKDYHEHHQDSSOLHGWRUHGXFHWKHLPSDFWWROHVVWKDQVLJQLILFDQWOHYHOV:LWK UHTXLUHGLPSOHPHQWDWLRQRIPLWLJDWLRQPHDVXUHVLGHQWLILHGLQWKLV,601'FRQVWUXFWLRQDQGRSHUDWLRQRI WKHSURSRVHG3URMHFWZRXOGQRWLQYROYHDQ\DFWLYLWLHVWKDWZRXOGUHVXOWLQHQYLURQPHQWDOHIIHFWVZKLFK ZRXOGFDXVHVXEVWDQWLDODGYHUVHHIIHFWVRQKXPDQEHLQJVHLWKHUGLUHFWO\RULQGLUHFWO\ 235 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH Section5ǦSummaryofMitigation Measures I. Aesthetics $(63URYLGHVKLHOGLQJIRUWKHGXDOKHDGSROHLQWKHVRXWKZHVWFRUQHUDVSHUWKHOLJKWLQJGHVLJQ HQJLQHHULQJUHFRPPHQGDWLRQV III. Air Quality $,5&RQWUDFWRULVWRLPSOHPHQWDWDPLQLPXPDGD\SDLQWLQJVFKHGXOH IV. Biological Resources %,2 $Q\ JUXEELQJ EUXVKLQJ RU WUHH UHPRYDO VKRXOG EH FRQGXFWHG RXWVLGH RI WKH 6WDWH LGHQWLILHG QHVWLQJ VHDVRQ IRU PLJUDWRU\ ELUGV ZKLFK LV W\SLFDOO\ 0DUFK WKURXJK 6HSWHPEHU,IZRUNFDQQRWEHFRQGXFWHGRXWVLGHRIQHVWLQJVHDVRQDPLJUDWRU\QHVWLQJ ELUG VXUYH\ZLWKLQ DQG DGMDFHQW WR WKH SURMHFW VLWH VKDOO EH FRQGXFWHGE\ D TXDOLILHG ELRORJLVWZLWKLQWKUHHGD\VSULRUWRLQLWLDWLQJWKHFRQVWUXFWLRQDFWLYLWLHV,IDFWLYHQHVWV DUHIRXQGGXULQJWKHSUHFRQVWUXFWLRQQHVWLQJELUGVXUYH\VD1HVWLQJ%LUG3ODQ1%3 ZLOOEHSUHSDUHGDQGLPSOHPHQWHG$WDPLQLPXPWKH1%3ZLOOLQFOXGHJXLGHOLQHVIRU DGGUHVVLQJDFWLYHQHVWVHVWDEOLVKLQJEXIIHUVPRQLWRULQJDQGUHSRUWLQJ7KH1%3ZLOO LQFOXGHDFRS\RIPDSVVKRZLQJWKHORFDWLRQRIDOOQHVWVDQGDQDSSURSULDWHEXIIHU]RQH DURXQGHDFKQHVWVXIILFLHQWWRSURWHFWWKHQHVWIURPGLUHFWDQGLQGLUHFWLPSDFW7KHVL]H DQGORFDWLRQRIDOOEXIIHU]RQHVLIUHTXLUHGVKDOOEHGHWHUPLQHGE\WKHELRORJLVWDQG VKDOOEHEDVHGRQWKHQHVWLQJVSHFLHVLWVVHQVLWLYLW\WRGLVWXUEDQFHDQGH[SHFWHGW\SHVRI GLVWXUEDQFH7KHQHVWVDQGEXIIHU]RQHVVKDOOEHILHOGFKHFNHGZHHNO\E\DTXDOLILHG ELRORJLFDO PRQLWRU 7KH DSSURYHG EXIIHU ]RQH VKDOO EH PDUNHG LQ WKH ILHOG ZLWK FRQVWUXFWLRQIHQFLQJZLWKLQZKLFKQRYHJHWDWLRQFOHDULQJRUJURXQGGLVWXUEDQFHVKDOO FRPPHQFHXQWLOWKHTXDOLILHGELRORJLVWKDVGHWHUPLQHGWKH\RXQJELUGVKDYHVXFFHVVIXOO\ IOHGJHGDQGDPRQLWRULQJUHSRUWKDVEHHQVXEPLWWHGUHYLHZHGDQGDSSURYHGE\WKH&LW\RI /D4XLQWD V. Cultural Resources &8/*UDGLQJDFWLYLWLHVVKDOOEHRYHUVHHQE\DTXDOLILHGDUFKHRORJLFDOPRQLWRU,QWKHHYHQW XQDQWLFLSDWHGDUFKDHRORJLFDOUHVRXUFHVDUHGLVFRYHUHG x7KHDUFKDHRORJLFDOPRQLWRUVKDOOQRWLI\WKHSURMHFWIRUHPDQ x7KH$UFKDHRORJLFDOPRQLWRUKDVWKHDXWKRULW\WRWHPSRUDULO\KDOWZRUNLQWKHDUHDRI DUFKDHRORJLFDOGLVFRYHULHVXQWLOWKHUHVRXUFHKDVEHHQHYDOXDWHG x$OOZRUNLQWKHYLFLQLW\RIWKHILQGVKDOOKDOW x:RUNLQWKHDUHDRIWKHGLVFRYHU\VKDOOQRWUHVXPHXQWLOZULWWHQQRWLILFDWLRQLV UHFHLYHGIURPWKH3URMHFWDUFKDHRORJLVW 236 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH &8/*UDGLQJ DFWLYLWLHV VKDOO EH RYHUVHHQ E\ D TXDOLILHG SDOHRQWRORJLFDO PRQLWRU 3DOHRQWRORJLFDOPRQLWRUVVKRXOGEHHTXLSSHGWRVDOYDJHIRVVLOVDVWKH\DUHXQHDUWKHGWR DYRLGFRQVWUXFWLRQGHOD\VDQGWRUHPRYHVDPSOHVRIVHGLPHQWVWKDWDUHOLNHO\WRFRQWDLQ WKHUHPDLQVRIVPDOOIRVVLOLQYHUWHEUDWHVDQGYHUWHEUDWHV0RQLWRUVZLOOEHHPSRZHUHGWR WHPSRUDULO\KDOWRUGLYHUWHTXLSPHQWWRDOORZUHPRYDORIDEXQGDQWRUODUJHVSHFLPHQV 0RQLWRULQJZLOOEHUHGXFHGLIWKHSRWHQWLDOO\IRVVLOLIHURXVXQLWVDVGHVFULEHGE\WKH6DQ %HUQDUGLQR&RXQW\ 0XVHXP 'LYLVLRQ RI (DUWK 6FLHQFHV 0D\ UHSRUW DUH QRW SUHVHQW RU LI SUHVHQW DUH GHWHUPLQHG XSRQ H[SRVXUH DQG H[DPLQDWLRQ E\ TXDOLILHG SDOHRQWRORJLFDOSHUVRQQHOWRKDYHORZSRWHQWLDOWRFRQWDLQIRVVLOUHVRXUFHV &8/ ,IKXPDQUHPDLQVDUHHQFRXQWHUHGGXULQJWKHXQGHUWDNLQJ6WDWH+HDOWKDQG6DIHW\&RGH 6HFWLRQVWDWHVWKDWQRIXUWKHUGLVWXUEDQFHVKDOORFFXUXQWLOWKH&RXQW\&RURQHUKDV PDGH D GHWHUPLQDWLRQ RI RULJLQ DQG GLVSRVLWLRQ SXUVXDQW WR 3XEOLF 5HVRXUFHV &RGH 6HFWLRQ7KHORFDODXWKRULWLHVPXVWEHQRWLILHGRIWKHILQGLPPHGLDWHO\,IWKH UHPDLQVDUHGHWHUPLQHGWREHSUHKLVWRULFWKH&RURQHUZLOOQRWLI\WKH1DWLYH$PHULFDQ +HULWDJH &RPPLVVLRQ 1$+& ZKLFK ZLOO GHWHUPLQH DQG QRWLI\ D 0RVW /LNHO\ 'HVFHQGDQW 0/' :LWK WKH SHUPLVVLRQ RI WKH ODQGRZQHU RU KLVKHU DXWKRUL]HG UHSUHVHQWDWLYHWKH0/'PD\LQVSHFWWKHVLWHRIWKHGLVFRYHU\7KH0/'VKDOOFRPSOHWH WKHLQVSHFWLRQZLWKLQKRXUVRIQRWLILFDWLRQE\WKH1$+& VI. Geology and Soils *(2 3ULRUWRJUDGLQJSODQDSSURYDOVXEPLWIRUUHYLHZDQGDSSURYDOE\WKH&LW\(QJLQHHUD 30OPDQDJHPHQWSODQ *(2 )RUSRUWLRQVRIWKHVLWHQRWLPPHGLDWHO\XQGHUFRQVWUXFWLRQHQVXUHWKHVWDELOL]DWLRQRI VRLOV WKURXJK WKH XVH RI VRLO FHPHQW RU UHYHJHWDWLRQ IUHTXHQW ZDWHULQJ LQFOXGLQJ ZDWHULQJ GXULQJ WKH HYHQLQJ DQG ZHHNHQGV GXULQJ VLJQLILFDQW ZLQG HYHQWV VWUHHW VZHHSLQJ RU ZDVKLQJ GXULQJ FRQVWUXFWLRQ DQG WKH FKHPLFDO VWDELOL]DWLRQ RI XQSDYHG FRQVWUXFWLRQURDGZD\V VII. Hazards and Hazardous Materials +$=±$KD]DUGRXVVSLOOSUHYHQWLRQSODQVKDOOEHSUHSDUHGE\WKH$SSOLFDQWDQGVXEPLWWHGWRWKH &LW\ IRU DSSURYDO WR PLQLPL]H WKH OLNHOLKRRG RI D VSLOO VKDOO EH SUHSDUHG SULRU WR FRQVWUXFWLRQ7KHSODQVKDOOVWDWHWKHDFWLRQVWKDWZRXOGEHUHTXLUHGLIDVSLOORFFXUVWR SUHYHQWFRQWDPLQDWLRQRIVXUIDFHZDWHUVDQGSURYLGHIRUFOHDQXSRIWKHVSLOO7KHSODQ VKDOOIROORZ)HGHUDOVWDWHDQGORFDOVDIHW\JXLGHOLQHVDQGVWDQGDUGVWRDYRLGLQFUHDVHG H[SRVXUHWRWKHVHSROOXWDQWV +$=±,IDFRQWDPLQDWHGDUHDLVHQFRXQWHUHGGXULQJFRQVWUXFWLRQFRQVWUXFWLRQVKDOOFHDVHLQWKH YLFLQLW\RIWKHFRQWDPLQDWHGDUHD7KHFRQVWUXFWLRQFRQWUDFWRUVKDOOQRWLI\DOODSSURSULDWH DXWKRULWLHVLQFOXGLQJWKH(3$DQGWKH&LW\,IQHFHVVDU\WKHFRQWDPLQDWHGVLWHVKDOOEH UHPHGLDWHGWRPLQLPL]HWKHSRWHQWLDOIRUH[SRVXUHRIWKHSXEOLFDQGWRDOORZWKH3URMHFW WREHVDIHW\FRQVWUXFWHG IX. Hydrology and Water Quality +<' 3ULRU WR 3URMHFW DSSURYDO WKH 3URMHFW $SSOLFDQW VKDOO SUHSDUH D :DWHU 4XDOLW\ 0DQDJHPHQW3ODQWKDWVKDOODWPLQLPXPLQFOXGHWKHIROORZLQJ 237 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH x,GHQWLILHVDOOSURMHFWUHODWHGSROOXWDQWVLPSDFWVWRWKHVLWH¶VK\GURORJLFFRQGLWLRQDQG SRWHQWLDOLPSDFWVWRORFDOZDWHUZD\VFDXVHGE\3URMHFWSRVWFRQVWUXFWLRQUXQRII x,GHQWLILHV%03VUHTXLUHGWRUHPRYHSROOXWDQWVIURPWKH3URMHFWV¶SRVWFRQVWUXFWLRQ UXQRIIDQGSUHYHQWGRZQVWUHDPK\GURPRGLILFDWLRQ x,GHQWLILHVSDUWLHVUHVSRQVLEOHIRUORQJWHUPRSHUDWLRQDQGPDLQWHQDQFHDFWLYLWLHVRIDOO %03V x,GHQWLILHV WKH GHVLJQ RSHUDWLRQ DQG PDLQWHQDQFH RI WKH XQGHUJURXQG VWRUPZDWHU FROOHFWLRQV\VWHP XII. Noise 12,,WLVUHFRPPHQGHGWKDWWKH3DYLOLRQVGHOLYHU\GRFNLVHQFORVHGZLWKZDOOVDQGDURRIDQG WKDW DQ DFRXVWLFDOO\ DEVRUSWLYH PDWHULDO LV XVHG WR SDUWLDOO\ OLQH WKH LQWHUQDO ZDOOV WR FRQWUROQRLVHEXLOGXS7KLVZLOOOLPLWSRWHQWLDOGLVWXUEDQFHIURPXQORDGLQJ 12,9HKLFOHORDGLQJDQGXQORDGLQJIRUDOOUHWDLOXQLWVVKRXOGEHFDUULHGRXWLQDTXLHWPDQQHU 12, ,WLVUHFRPPHQGHGWKDW+9$&HTXLSPHQWRQURRIVLVVFUHHQHGE\DQRLVHEDUULHUIURPWKH UHVLGHQFHV7KLVEDUULHUVKRXOGDWDPLQLPXPSURYLGHOLQHRIVLJKWVFUHHQLQJ 12, ,WLVUHFRPPHQGHGWKDWQRLV\+9$&HTXLSPHQWDWJUDGHLVHQFORVHGZLWK&08ZDOOVDW OHDVWIHHWKLJKHUWKDQWKHHTXLSPHQW 12, ,WLVUHFRPPHQGHGWKDWQRLVHIURP+9$&HTXLSPHQWLVOLPLWHGWRG%$DWWKHVLWH ERXQGDU\ 12,5HGXFHWKHQRLVHIURPWKHDXGLEOHGHYLFHVIRUWKHGULYHWKURXJKHDWLQJHVWDEOLVKPHQWV XVLQJDQ\DQGRUDOOPHWKRGVDVIROORZV x3RVLWLRQGHYLFHVDZD\IURPWKHVLWHERXQGDU\WRWKHVRXWK x3URYLGHDGGLWLRQDOVFUHHQLQJVXFKDVSRVLWLRQLQJRIWKHUHWDLOEXLOGLQJVRUDQRLVH EDUULHUDVFORVHWRWKHGHYLFH x5HGXFH WKH QXPEHU RI DXGLEOH GHYLFHV VXFK DV RQH GHYLFH WR VHUYH WZR GULYHWKURXJKV x2ULHQWWKHGHYLFHSHUSHQGLFXODUWRWKHYHKLFOHDQGDWHDUKHLJKWZLWKWKHGHYLFH DLPHGDWWKHOLVWHQHULQWKHYHKLFOH x7KHVRXQGIURPWKHGHYLFHVVKRXOGEHOLPLWHGWRDPD[LPXPRIG%$DWIHHW x7KHUHVKDOOEHQRDQQXQFLDWRUWRQHVZKLVWOHVEHHSVRURWKHUFKDUDFWHULVWLFVRXQGV 12,/D\ RXW WKH VLWH ZRUNLQJ WR NHHS QRLVHSURGXFLQJ DFWLYLWLHV DVIDU DV SRVVLEOH IURP UHVLGHQFHVPLQLPL]HWKHXVHRIEDFNXSDODUPVDQGPLQLPL]HWUXFNDFWLYLW\DQGWUXFN TXHXLQJQHDUWKHUHVLGHQWLDODUHDV 12,3HUIRUPFRQVWUXFWLRQLQDPDQQHUWRPLQLPL]HQRLVHZKHUHSUDFWLFDEOH)RUH[DPSOH x:KHUHSUDFWLFDEOHXVHK\GUDXOLFUDWKHUWKDQSQHXPDWLFLPSDFWWRROV x2SHUDWHHTXLSPHQWWRPLQLPL]HEDQJLQJFODWWHULQJEX]]LQJDQGRWKHUDQQR\LQJ W\SHVRIQRLVHV x7XUQRIILGOLQJHTXLSPHQWDQGYHKLFOHV x$OOLQWHUQDOFRPEXVWLRQHTXLSPHQWVKDOOEHILWWHGZLWKSURSHUO\RSHUDWLQJPXIIOHUV DQGDLULQWDNHVLOHQFHUV 238 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH x$OOVWDWLRQDU\HTXLSPHQWVKDOOEHORFDWHGDVIDUDVSUDFWLFDOIURPDGMDFHQWSRWHQWLDO UHVLGHQWLDOXQLWV x3KDVHLQVWDUWXSDQGVKXWGRZQRIVLWHHTXLSPHQW x&RQGXFWWUXFNORDGLQJXQORDGLQJDQGKDXOLQJRSHUDWLRQVWRNHHSQRLVHWRDPLQLPXP x/LPLWWKHWLPHWKDWVWHHOGHFNLQJRUSODWHVIRUVWUHHWGHFNLQJRUFRYHULQJH[FDYDWHG DUHDVDUHLQXVH x/LPLWWKHXVHRIDQQXQFLDWRUVRUSXEOLFDGGUHVVV\VWHPVH[FHSWIRUHPHUJHQF\ QRWLILFDWLRQV x$OORQVLWHGHOLYHULHVVKDOOEHOLPLWHGWRDP7RSP XVI. Traffic 75$)3ULRUWRUHFRUGDWLRQRIWKH)LQDO7HQWDWLYH3DUFHO0DSWKH$SSOLFDQWVKDOOHQWHULQWR DQDJUHHPHQWZLWKWKH&LW\RI/D4XLQWDDQGSRVWVHFXULW\WRGHVLJQDQGFRQVWUXFWDW WKHLQWHUVHFWLRQRI$YHQXHDQG-HIIHUVRQ6WUHHWWZRHDVWERXQGOHIWWXUQODQHVRQ $YHQXHWRQRUWKERXQG-HIIHUVRQ6WUHHWLIUHTXLUHGE\WKH3ODQQLQJ&RPPLVVLRQ XVII. Tribal Cultural Resources 75& 1DWLYH$PHULFDQ0RQLWRUVIURPWKH7ZHQW\1LQH3DOPV%DQGRI0LVVLRQ,QGLDQV RU $JXD &DOLHQWH %DQG RI &DKXLOOD ,QGLDQV VKRXOG EH SUHVHQW GXULQJ WKH LQLWLDO JUDGLQJJURXQGGLVWXUELQJDFWLYLWLHV 239 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 6HFWLRQ5HIHUHQFHV $OEHUW*URYHUDQG$VVRFLDWHV-XO\)RFXVHG7UDIILF6WXG\WR'HWHUPLQHWKH)HDVLELOLW\RID )XOO$FFHVV8QVLJQDOL]HG'ULYHZD\RQ$YHQXH:HVWRI-HIIHUVRQ6WUHHWLQWKH&LW\RI/D 4XLQWD $QWRQLR$FRXVWLFV-XQH/XQGLQ'HYHORSPHQW&RP3URSRVHG5HWDLO'HYHORSPHQW/D4XLQWD 1RLVH6WXG\ $QWRQLR$FRXVWLFV6HSWHPEHU5HWDLO'HYHORSPHQWDW$YH -HIIHUVRQ6W2XWGRRU5HWDLO $XGLEOH'HYLFHV &DOLIRUQLD'HSDUWPHQWRI&RQVHUYDWLRQ)DUPODQG0DSSLQJDQG0RQLWRULQJ3URJUDP&DOLIRUQLD ,PSRUWDQW)DUPODQG)LQGHUKWWSPDSVFRQVHUYDWLRQFDJRYFLIIFLIIKWPODFFHVVHG &LW\RI/D4XLQWD)HEUXDU\/D4XLQWD*HQHUDO3ODQ &RDFKHOOD9DOOH\:DWHU'LVWULFW&9:'2FWREHU3DYLOLRQ3DOPV6KRSSLQJ&HQWHU730 6'3($0831RUWKZHVW&RPHURI -HIIHUVRQ6WUHHWDQG$YHQXH$31 V &507HFK-XQH/HWWHU5HSRUW5H8SGDWHWR+LVWRULFDO$UFKDHRORJLFDO5HVRXUFHV6WXGLHV 3DUFHO7305)RUPHUO\730&LW\RI/D4XLQWD5LYHUVLGH&RXQW\&DOLIRUQLD &507(&+3URMHFW1R )HGHUDO7UDQVLW$GPLQLVWUDWLRQ)7$&RQVWUXFWLRQ(TXLSPHQW1RLVH/HYHOV )HGHUDO7UDQVLW$GPLQLVWUDWLRQ7UDQVLW1RLVHDQG9LEUDWLRQ,PSDFW$VVHVVPHQW5HSRUW1XPEHU )7$9$ ,QQRYDWLYH'HVLJQ(QJLQHHUV$XJXVW3DYLOLRQV/D4XLQWD6LWH/LJKWLQJ1:&$YHQXH -HIIHUVRQ6W/D4XLQWD&$ -HULFKR6\VWHPV,QF-HULFKR0D\*HQHUDO%LRORJLFDO5HVRXUFHV$VVHVVPHQW$QG&RDFKHOOD 9DOOH\06+&3&RQVLVWHQF\5HYLHZ)RUDDFUH3DUFHO$31V &LW\RI/D4XLQWD5LYHUVLGH&RXQW\&DOLIRUQLD /DQGPDUN*HR(QJLQHHUVDQG*HRORJLVWV$XJXVW*HRWHFKQLFDO5HSRUW)DLUZD\3OD]D1: &RUQHURI$YHQXHDQG-HIIHUVRQ6WUHHW/D4XLQWD&DOLIRUQLD/&,5HSRUW1R/3 6DQ%HUQDUGLQR&RXQW\0XVHXP'LYLVLRQRI(DUWK6FLHQFHV6%&00D\3DOHRQWRORJ\ /LWHUDWXUH5HFRUGV5HYLHZ3DUFHORI3DUFHO0DS5 6RXWKODQG*HRWHFKQLFDO1RYHPEHU*HRWHFKQLFDO,QYHVWLJDWLRQ/XFN\¶V6KRSSLQJ&HQWHU1: &RUQHURI$YHDQG-HIIHUVRQ6WUHHW/D4XLQWD&DOLIRUQLD 6WDWHRI&DOLIRUQLD'HSDUWPHQWRI7R[LF6XEVWDQFHV&RQWURO:HEVLWHZZZGWVFFDJRY 6XQ/LQH7UDQVLW$JHQF\2FWREHU/HWWHUWR&KHUL)ORUHV3URMHFW3ODQQHU&LW\RI/D4XLQWD5( 3DYLOOLRQ3DOPV6KRSSLQJ&HQWHU 240 &LW\RI/D4XLQWD )DLUZD\3OD]D6SHFLILF3ODQ$PHQGPHQW1R ³3DYLOLRQ3DOPV´6KRSSLQJ&HQWHU($ INITIAL STUDY 3DJH 7HUUD1RYD3ODQQLQJ 5HVHDUFK,QF-XO\'UDIW(QYLURQPHQWDO,PSDFW5HSRUW6&+ IRUWKH&LW\RI/D4XLQWD*HQHUDO3ODQ :DUQHU(QJLQHHULQJ)HEUXDU\)DLUZD\3OD]D6KRSSLQJ&HQWHU6SHFLILF3ODQ$PHQGPHQW 3ODQQLQJ&RPPLVVLRQ5HVROXWLRQ2ULJLQDOO\$SSURYHGE\WKH&LW\RI/D4XLQWD&LW\ &RXQFLO5HVROXWLRQ$GRSWHG0D\2ULJLQDO6SHFLILF3ODQ1R1HZ&DVH $PHQGHG$GRSWHGE\&LW\&RXQFLORQ6HSWHPEHU 241 [this page left intentionally blank] 242 Final Mitigated Negative Declaration for the Fairway Plaza Specific Plan Amendment No. 2 “Pavilion Palms” Shopping Center La Quinta, CA EA2017-0006 Lead Agency: City of La Quinta 78-495 Calle Tampico La Quinta, CA 92253 243 Introduction This Final Mitigated Negative Declaration (MND) for the Pavilion Palms Shopping Center project has been prepared to report to the decision-making authority of the City of La Quinta of the comments received on the Mitigated Negative Declaration during the public review process. The public review period for the project took place between March 23, 2018 and April 23, 2018. This Final MND includes a list of persons, organizations and public agencies who commented on the Draft MND, the comment letters and responses, a section of errata explaining revisions to the Draft MND which were made in response to comments, and the Mitigation Monitoring and Reporting Program. Comments and Responses The City of La Quinta received a total of 12 comment letters from various agencies and residents living in the project vicinity. The following list provides the name of the commenter, his/her affiliation, and the date the letter was sent. The comment letters and responses follow in order of this list. Letter Number Author/Affiliation Date A Katie Croft, Agua Caliente Band of Cahuilla Indians April 2, 2018 B Gerald Cantarini, La Quinta Renaissance HOA April 3, 2018 C Anthony Madrigal, Jr., Twenty-Nine Palms Band of Mission Indians April 2, 2018 D Rosie Lua, City of Indio April 10, 2018 E Lijin Sun, J.D., South Coast Air Quality Management District April 17, 2018 F Pat Kelly, Resident of Palmilla April 18, 2018 G Kent Bailey, Resident of Palmilla April 20, 2018 H Ken Hulbert, Palmilla HOA April 21, 2018 I Leila Namvar, Resident of La Quinta Renaissance April 22, 2018 J Robert and Marilyn Lang, Residents of Palmilla April 23, 2018 K Steve Cenicola, Resident of La Quinta Renaissance April 23, 2018 L Anita Petke, Sunline Transit Agency April 20, 2018 244 'HDU0V&KHUL)ORUHV 7KH$JXD&DOLHQWH%DQGRI&DKXLOOD,QGLDQV$&%&,DSSUHFLDWHV\RXUHIIRUWVWRLQFOXGHWKH 7ULEDO+LVWRULF3UHVHUYDWLRQ2IILFH7+32LQWKH3DYLOLRQ3DOPV6KRSSLQJ&HQWHUSURMHFW:H KDYHUHYLHZHGWKHGRFXPHQWVDQGKDYHWKHIROORZLQJFRPPHQWV >9,$(0$,/72FOIORUHV#ODTXLQWDRUJ@ &LW\RI/D4XLQWD 0V&KHUL)ORUHV &DOOH7DPSLFR /D4XLQWD&$ $SULO Re: Pavilion Palms Shopping Center Initial Study/Mitigated Negative Declaration $JDLQWKH$JXD&DOLHQWHDSSUHFLDWHV\RXULQWHUHVWLQRXUFXOWXUDOKHULWDJH,I\RXKDYHTXHVWLRQV RUUHTXLUHDGGLWLRQDOLQIRUPDWLRQSOHDVHFDOOPHDW<RXPD\DOVRHPDLOPHDW $&%&,7+32#DJXDFDOLHQWHQHW &RUGLDOO\ .DWLH&URIW &XOWXUDO5HVRXUFHV0DQDJHU 7ULEDO+LVWRULF3UHVHUYDWLRQ2IILFH $*8$&$/,(17(%$1' 2)&$+8,//$,1',$16 7KHSUHVHQFHRIDQDSSURYHG$JXD&DOLHQWH1DWLYH$PHULFDQ&XOWXUDO5HVRXUFH 0RQLWRUVGXULQJDQ\JURXQGGLVWXUELQJDFWLYLWLHVLQFOXGLQJDUFKDHRORJLFDOWHVWLQJ DQGVXUYH\V6KRXOGEXULHGFXOWXUDOGHSRVLWVEHHQFRXQWHUHGWKH0RQLWRUPD\ UHTXHVWWKDWGHVWUXFWLYHFRQVWUXFWLRQKDOWDQGWKH0RQLWRUVKDOOQRWLI\D4XDOLILHG $UFKDHRORJLVW6HFUHWDU\RIWKH,QWHULRU¶V6WDQGDUGVDQG*XLGHOLQHVWRLQYHVWLJDWH DQGLIQHFHVVDU\SUHSDUHDPLWLJDWLRQSODQIRUVXEPLVVLRQWRWKH6WDWH+LVWRULF 3UHVHUYDWLRQ2IILFHUDQGWKH$JXD&DOLHQWH7ULEDO+LVWRULF3UHVHUYDWLRQ2IILFH .RWHYHZLWYLOODJHD7ULEDO&XOWXUDO5HVRXUFHLVORFDWHGLQWKHSURMHFWDUHD 7KHUHLVDPLWLJDWLRQPHDVXUHIRUDQDUFKDHRORJLFDOPRQLWRUEXWWKHUHVKRXOGDOVR EHDPLWLJDWLRQPHDVXUHIRUD1DWLYH$PHULFDQ0RQLWRUGXULQJJURXQGGLVWXUELQJ DFWLYLWLHV 245 A-1 LETTER A A-2 April 23, 2017 Katie Croft, Cultural Resource Manager Tribal Historic Preservation Office Agua Caliente Band of Cahuilla Indians 5401 Dinah Shore Drive Palm Springs, CA 92264 SUBJECT: RESPONSE TO COMMENTS ON EA 2017-0006 PAVILION PALMS SHOPPING CENTER MITIGATED NEGATIVE DECLARATION Dear Katie: Thank you for your comments on the Mitigated Negative Declaration for the proposed Pavilion Palms Shopping Center. The comment letter has been marked and is attached. Responses are as follows: Comment A-1: The presence of an approved Agua Caliente Native American Cultural Resource Monitor(s) during any ground disturbing activities (including archaeological testing and surveys). Should buried cultural deposits be encountered, the Monitor may request that destructive construction halt and the Monitor shall notify a Qualified Archaeologist (Secretary of the Interior’s Standards and Guidelines) to investigate and, if necessary, prepare a mitigation plan for submission to the State Historic Preservation Officer and the Agua Caliente Tribal Historic Preservation Office. Kotevewit village, a Tribal Cultural Resource, is located in the project area. Response A-1: Comments are noted. Mitigation Measures CUL-1, CUL-3 and TCR-1 are included to minimize impacts to cultural and tribal resources. CUL-1—Grading activities shall be overseen by a qualified archeological monitor. In the event unanticipated archaeological resources are discovered: x The Archaeological monitor shall notify the project foreman x The Archaeological monitor has the authority to temporarily halt work in the area of archaeological discoveries until the resource has been evaluated x All work in the vicinity of the find shall halt x Work in the area of the discovery shall not resume until written notification is received from the Project archaeologist CUL-3—If human remains are encountered during the undertaking, State Health and Safety Code Section 7050.5 states that no further disturbance shall occur until the County Coroner has made a determination of origin and disposition pursuant to Public Resources Code Section 5097.98. The local authorities must be notified of the find immediately. If the remains are determined to be prehistoric, the Coroner will notify the Native American Heritage Commission (NAHC), which will determine and notify a Most Likely Descendant (MLD). With the permission 246 of the landowner or his/her authorized representative, the MLD may inspect the site of the discovery. The MLD shall complete the inspection within 48 hours of notification by the NAHC. TCR-1—Native American Monitor(s) from the Twenty-Nine Palms Band of Mission Indians or Agua Caliente Band of Cahuilla Indians should be present during the initial grading/ground disturbing activities. Comment A-2: There is a mitigation measure for an archaeological monitor, but there should also be a mitigation measure for a Native American Monitor during ground disturbing activities. Response A-2: As mentioned in Response A-1 above, the Mitigated Negative Declaration does include in Section XVII, Tribal Cultural Resources, a mitigation measure (TCR-1) which requires a Native American Monitor during ground-moving activities. Thank you for your participation in the public review process. Cheri L. Flores, Senior Planner City of La Quinta 247 248 LETTER B 4smo½KÁÅ !ÅS]Å/Å»`²`Å&ů``ÅV`Å¢`»`Å'ÅmK¢Å¢¥L¤t£ Å 5ÅK]]t¥tÅ¥o``Åt¢Å¢`»``Å\\`Å¥oL¤Å¯`Å¢`]ÅytÅXŽsÅf`ÅSÅKl`Åo²¢ÅmSmÅ oTm²¥Å I`ÅV`ÅRÅL¾W`ÅaÅ¥o`Å\|`ÅT]ÅmTmÅK\¥t»t¥ÃÅyÅ6]tŽrt\oÅoK£ÅK`K]ÁÅL¤©`¥`]Å ¥Åu°K¥`Å®`Å3K£¥`Å;KÅA²u¥KÅ`¢t^`¥tKÅW`K£ Å Do¶]Å`»KÅaů`ÅmK¢Å¢¥L¤tÅS]ÅÅXÅ¥Å[`ÅSÅ¥tŽ`޲]Åf`Å¥o`Åk½tmÅ ¢M)Å /C`¢¥\¥Åªo`Å¢tÄ`ÅT]Åo²¢ÅaÅ¥o`Å`¤tÅaÅ¥o`ÅtÅY- 0C`\K¥`ů`ÅmK¢Å¢¥L§yťťo`Å`K£¥Åaů`Å`\¥Å¢t¥`Å\¢`Å¥Å8`f`¢ ½{¦oÅKÅT]¢\K`Å[`. 1C`²y`ůK¥Å¯`ÅmK¢Å¢¥L§zÅ[`Å`ÅK`¢¥o`¥t\KÁÅK`Rymťů` `»s`¥ #?¢`]Å`lÅS`ÅÅ/Å»`²`Å&Å`WÅ9`g`¢* Jpw`Å¥o`Å]`»``ÅoM£Å¢`]Å~K£±´\¥µ`Å\oMm`¢Å¥o`¢`Å\oTm`¢Å]Å¥Åf`ÅKÅ¢²¥tťŠ¥o`ÅoKÄW]¢Å\`K¥`]Å[ÁÅ¥pw¢Å`lÅT`+Å /Fo`Å`lÅK`Å\K¥tÅt¢Å¦Å\¢`ťťo`Å/»`²`Å E>9`f`¢Å¥Kcdx\ tmq§ÅT]Åw¥`¢`\¥t- 0Fo`Å¢KÅ]`¢Å¥ÅO`²L§`ÁÅK]]`¢¢Å¥o`Å`M¢¦½`¢¥Å«Kh\Åj½ Fo`Å¢²[t¥©`]Å¥Kh\Å¢¥²]ÁŽK£Å\`¥`]Å}Å:³ÂÅbÅ$"(ÅN]Å]t]Å¥ ¥Q`Åt¥Å\£t]`K¥tŦo`Åo`L¼ÁÅj²\¥²K¥tÅS]Å¥Kh\Å\²§¢Å]²m ¦o`Å=»`[`Å¥o²moÅ/sÅ`t]Å It¥o²¥Å²`¢¥tÅ¥o`Å`lÅ¥¹ÅS` ZÅ¢`]ŽtÅ\`K¥`ÅKÅ¢`»``Å¥P\ÅoKÄK] %Fo`Åo`K»tÁűK»``]Å`K¢¥[²]Å/Å»`²`Å&Å¢¥``¥Å\`L¢Å¥o`ÅmK§`½KÁťťo`Å1t¥Á aÅ<KÅB¸¥K Å Fo`ÅK`WT\`ÅaÅ¥o`Å©o`K¢¥Å\`Å¢o²]Å`²y`ÅKÅ`ÅK`KtmÅS]Å t»t¥tmÅK`KS\`Å ½t¦oÅ¢¥`ÅT]¢\KtmÅ[`¢ ÅT]Å¢¢t[ÁÅKÅ¢¦L§²`Å Fo``ÅM`ÅTÁÅ¥o`Å\\`¡Å¥oK¥Å¢o²]Å[`Å\t]``]Å[ÁÅ¥o`Å1t¬ÁÅ1²\v,Å¥ywmÅaÅis¢o`]Å [²t]²¥Åaů`Å`\¥Åt`ÅRÅ¢`_Å[¶t]ymÅO¢Åt¢`Å\±Å]·}mÅ\£±µ\¥tÅT]Å ²Å\`¥tÅT]Åo`tmo¥ÅaÅ¥o`Å`Àt¢¥}mŽKÅ /]]t¥tKÁů`Å<KÅB²}¥KÅC`Kt¢¢S\`Å0V]ÅT]Å`¢t]`¥¢ÅoK»`Å\\`Å»`Å¥o`Å]`»``¢Å K[tt¥ÁÅÅ¿{yn`¢¢Å¥Å\`K¥`Å`Å]`¢tnÅ\Å¢\o``¢ ÅKt¥`S\`ÅS]Å\`¥tÅ ¨t`y`Å Hw¢Å\\` ŽK¢ÅKnwi`]ÅKl`Å¥o`Åy¢`\¥tÅaÅ¥¿Å¢ytWÅ`©t`¢Å\¢±µ\¥`]Å [²¥Å¥Åi¢o`]Å[ÁŦo`Å¢`]Å]`»``ÅÅS¯`Å\¢±µ\¥tÅ¢t¥`Å Got¢Å\\`ŽK¢ÅK ¢Å \º\K¥`]Å[Áů`Å7]tÅ@UmÅ1w¢¢tŽoÅoK]ÅTŲeL¼K[`Å`À`t`\`Žw¥oÅ <²]yÅ2`»``¥ÅÅ[¥oÅ`\¥¢Å 249 B-1 250 April 23, 2017 Gerald Cantarini, President La Quinta Renaissance Homeowners Association 79783 Joey Court La Quinta, CA 92253 SUBJECT: RESPONSE TO COMMENTS ON EA 2017-0006 PAVILION PALMS SHOPPING CENTER MITIGATED NEGATIVE DECLARATION Dear Mr. Cantarini: Thank you for your comments on the Mitigated Negative Declaration for the proposed Pavilion Palms Shopping Center. The comment letter has been marked and is attached. Responses are as follows: Comment B-1: Proposed left turn lane on Avenue 50 near Jefferson: While the developer has proposed infrastructure changes, these changes do not offer a solution to the hazards created by this left turn lane: A. The left turn lane location is too close to the Avenue 50/Jefferson traffic light and intersection; B. The proposal does not adequately address the east/west traffic flow. The submitted traffic study was completed in July of 2017 and did not take into consideration the heavy fluctuation and traffic counts during the November through April period. Without question, the left tum lane as proposed, will create a severe traffic hazard. Response B-1: The traffic section of the Mitigated Negative Declaration analyzed potential hazards due to design features. The eastern driveway on Avenue 50 will allow right and left turns. Shared left-turn and right-turn markings are specifically outlined in Chapter 3 of the California Manual on Uniform Traffic Control Devices (CAMUTCD) and such movements are generally allowed at many corner gas stations throughout Southern California. In addition, Mitigation Measure TRAF-1 will be implemented in order to minimize impacts to the Avenue 50 and Jefferson Street intersection due to projected area growth. Mitigation Measure TRAF-1: Prior to recordation of the Final Tentative Parcel Map, the Applicant shall enter into an agreement with the City of La Quinta and post security to design and construct at the intersection of Avenue 50 and Jefferson Street two eastbound left turn lanes on Avenue 50 to northbound Jefferson Street if required by the Planning Commission. Thank you for your participation in the public review process. Cheri L. Flores, Senior Planner City of La Quinta 251 252 LETTER C C-1 April 23, 2017 Anthony Madrigal Twenty-Nine Palms Band of Mission Indians 46-200 Harrison Place Coachella, CA 92236 SUBJECT: RESPONSE TO COMMENTS ON EA 2017-0006 PAVILION PALMS SHOPPING CENTER MITIGATED NEGATIVE DECLARATION Dear Mr. Madrigal: Thank you for your comments on the Mitigated Negative Declaration for the proposed Pavilion Palms Shopping Center. The comment letter has been marked and is attached. Responses are as follows: Comment C-1: This letter is in regards to consultation in compliance with AB 52 (California Public Resources Code§ 21080.3.1) for the Pavilion Palms Shopping Center. As stated in our letter, sent October 24, 2017, the Tribal Historic Preservation Office is aware of numerous cultural resources within 1-mile of the project area and three cultural resources within the project boundary. For these reasons, the report recommended archaeological monitoring during earth-moving activates. There is an increased possibility of encountering cultural resources during the construction processes that may take place because of cultural resources recorded within the project's boundaries, and it is in the vicinity of an area with high archaeological sensitivity. Avoidance, if feasible, would negate adverse effects on the project. The THPO continues to request that approved Native American Monitor(s) from the Twenty-Nine Palms Band of Mission Indians be present during any ground disturbing activities during the project as indicated in TCR-1. The following conditions (CUL 1 -4, TCR-1) would mitigate current concerns for the aforementioned project, however, if there are any changes, please notify the THPO. Response C-1: Comments are noted and mitigation measures are incorporated in the MND document and Mitigation Monitoring and Reporting Program. Thank you for your participation in the public review process. Cheri L. Flores, Senior Planner City of La Quinta 253 From:Rosie Lua To:Cheri Flores Cc:Les Johnson;Tom Brohard Subject:RE: Pavilion Palms Shopping Center-Jefferson and Ave 50 Date:Tuesday, April 10, 2018 8:11:38 AM Hi Cheri, Thank you for the opportunity to review the Initial Study/Mitigated Negative Declaration regarding the Fairway Plaza Specific Plan Amendment No. 2. At this time, we have no further comments on this project. Our previous response letter dated October 18, 2017 which summarized priority items discussed in the Initial Study and Focused Traffic Study remain. Please let us know if you have any further questions. Thank you, Rosie Lua Assistant Planner City of Indio rlua@indio.org 760-391-4016 254 LETTER D D-1 7GMO>2O#-O'I7=G-O GG1=G7>=O61C7O:>C1FO 1F75=O-=0O 1J1;>A<1=GO 1A-CH<1=GO O-:;1O*-<A7/>O #-O'I7=G-OOO %/G>.1COOO 1J1:>A<1=GO)1DJ7/1FO1A-E<1=GO !!! !! ! !!! ! ! ! 1-CO $F O:>C1FO +6-=9OM>IO 2>CO G61O >AA>CGI=7GMO G>O AC>J701O /><<1=GFO >=OG61O &-J7:7>=O &-:<FO )6>AA7=5O 1=G1COAC>81/GOAC>A>F10O-GO G61O=>CH6K1FGO />C=1CO>2O"1231CF>=O)GC11GO -=0OJ1=I1O O *61O O FBI-C1O2>>GOAC>81/GO7=/:I01FO-OFIA1C<-C91GO -O 5-FO FG-G7>=O K7G6O/>=J1=71=/1O <-C91GO27J1O A-0FOK7G6O 0C7J1O G6CIO2-/7:7G71FO-=0O>G61DO/><<1C/7-:O.I7:07=5F O *61O 2@:;?K7=5O-C1O/><<1=GFOAC>J7010O.MO G61O7GMFO *C-237/O =57=11CO C1FA>=07=5OG>OG61O !=7G7-:O)7G1O&:-=O-=0O-O "I:MOO O >/IF10O *C-47/O )GI0MO +C7AO 1=1C-G7>=O ,67;1OA-FF.MOGC7AOC10I/G7>=FO-C1OF6>K=O G61O*C-237/O)GI0MO0>1F =>GO-AA1-COG>O 7=/:I01O-OG-.:1OG6-GOFI<<-C7N1FOA1-9O6>ICO-=0O0-7:MO GC7AO51=1C-G7>= 2>C1/-FGFO2>CO 1-/6O AC>A>F10O .I7:07=5O-FOK1::O-FO7=G1C=-;OGC7AOC10I/G7>=FOK7G67=O-=0 .1GK11=OG61OIF1FO>=OG61O F7G1O7GF1;2O&-51OO>2OG61O+C-47/O)GI0MO7FO<7FF7=5O2C><O<M />AMO>2OG61OC1A>E 1C19O:-=O C7J1O>==1/G7>=O//1FFO7FOAC>A>F10OG>O/>==1/GOG61OF6>AA7=5O/1=G1C G>O1C19O;-=O C7J1O>=OG61O=>CH6O-O:>/-:OFGC11GOG6-GOF1CJ1FOG61O5-G10O(1=-7FF-=/1 C1F701=G7-:O 01J1:>A<1=G O #12HO GIC=FO >IGO >2O 1C19O :-=O C7J1O G>O =>CH6.>I=0 "1231CF>=O)GC11GO-C1OA6MF7/-;:MOAC>67.7G10O.MO-OC-7F10O<107-=OK67;1O=>E6.>I=0O:12G GIC=FO7=G>O 1C19O:-=OC7J1O-C1O-//><<>0-G10O*61O0C7J1K-MO/>==1/G7>=O.1GK11= G61OF6>AA7=5O /1=G1CO-=0O 1C19O:-=O C7J1O F6>I:0O.1O1:7<7=-G10O -FO7GO K7;;O/C1-G1 />=51FG7>=O-GOG61O1=GC-=/11L7GOG>OG61O5-G10OC1F701=G7-:O01J1:>A<1=GO -=0O7GO 0>1F =>GO2-/7:7G-G1O1L7G7=5OG>O G61O=>CG6 255 D-2 D-3 'CD(>F<+L,0L$FB<L'<,L><LG,<F,LL 'DL,-.,BC><L#DB,,DL $2,L$B'/3)L #DF+J 3<+3)'D,CL)><),B<CL2'G,L (,,<L,I@B,CC,+L(JL3DJL>-L'L!F3<D'LCD'/LB,1'B+3<1L@,'7 2>FBL AF,F3<1L3<L D2,L ,'CD(>F<+L 8,-ELDFB<L 9'<,L><L G,<F,LL'DL,-.,BC><L#DB,,D B>;L;JL>(C,BG'D3><CL >-LD23CL3<D,BC,)D3><LD2,L 9><1,CDLAF,F,CLB,CF:DL-B>;L@'B,<D DB3@CLD>L '<+L-B>;LD2,L ,:,;,<D'BJL'<+L;3++9,LC)2>>9CL><LD2,L<>BE2L C3+,L>-LG,<F, LD>LD2,LH,CDLB'D2,BL D2'=L-B>;LDB'+3D3><':L @,'7L2>FBL)>;;FD,BL DB3@CL '9)F9'D3><C 3<LD2,L$B'-.3)L#DF+JL3<+3)'D,LD2'DLCD>B'1,L->BL,'CD(>F<+L:,0LDFB<CL'DL,/,BC><L#DB,,D H399L(,L'+,AF'D,L3<LL '<+L H39:L(,L;'B13<'99JL '+,AF'D,L3<L&,'BLL++3D3><': 9,0LDFB<LCD>B'1,L3CL@B>@>C,+LD>L(,L@B>G3+,+LH,CDL>-LD2,L-F99L')),CCL+B3G,H'JL->BL:,0 DFB<CL 3<D>L D2,L @B>@>C,+L -F9:L ')),CCL +B3G,H'JL '<+L ->BL ,-.,BC><L #DB,,DL $23C DB,'D;,<DL2'CL(,,<LFC,+L3<LFB('<3K,+L 'B,'CLH,B,L:,0L DFB<LCD>B'1,L->BL CD')73<1 ;'JL><:JL(,L;'B13<'9:JL'+,AF'D, ",9>*'D,L G,<F,L L F9:L )),CCL B3G,H'JL FBE2,BL $>L $2,L %,CDL ,-?B, ')),@D3<1LD2,L>@,<,<+,+L ,'CD(>F<+L9,0L DFB<L:'<,L C2>H<L><LD2,LC3D,L @9'<L'<+ +,C)B3(,+L 3;;,+3'D,9JL '(>G,L 3DL 3CL CF11,CD,+L D2'DL '9D,B<'D3G,CL (,L ,I@:>B,+L 3< -FBE2,BL+,D'39L3<):F+3<1 ' 93@LF3:+3<1LL 5FCDLC>FD2L>-L D2,L CF@,B;'B7,DL H3D2L D2,L 'G393><CL F,:L 9>)'D3>< C>FD2,'CDL>-LD2,LCF@,B;'B7,D (",>B3,<DLD2,LCF@,B;'B7,DLC>L3DL3CL@'B':9,9LD>LD2,L+3'1><'9L'DLD2,L<>BE2H,CDL)>B<,B 3<LD2,L C3D, ) ,C31<'D,L'<+L H3+,<LD2,LH,CD,B:JL '3C9,L +B3G,H'JL><LG,<F,LL 'CLD2,L ;'5>B -F:9')),CCL+B3G,H'JL'<+L <'BB>HL'<+L:3;3DL D2,L ,'CD,B:JL+B3G,H'JL><LG,<F,L D>LB312DLDFB<CL><:J L $23CLH>F:+L@B>G3+,L'L9><1,BLD2B>'DL><LD2,LB,@>C3D3><,+L;'6>B -F99L ')),CCL +B3G,H'JL <D,B3<1LD2,L-F,:3<1L 'B,'L'CL)FBB,<D:JL+,C31<,+L-B>;LD2, ;'3<L -F9:L')),CCL +B3G,H'JL)>F8+L @>D,<D3'99JL(9>)7L D2,L ,<D,B3<1LDB'/3)L:'<,L'C ;>D>B3CDCLC,,7LD2,L-3BCDL >@@>BEF<3DJLD>L:3<,LF@L ->BL-F,9L $>L')),CCLD2,L-F,:3<1 @>C3D3><CL ):>C,CDL D>L G,<F,L L B,AF3B,CL 'LC2'B@L B312DLDFB<L1B,'D,BL D2'<L +,1B,,C G,<F,LL 'CDL>-L ,/,BC><L#DB,,DL$2,B,L 'B,L<>L C31<4-3)'<DL 3CCF,CL'CC>)3'D,+ H3D2L D2,L3DBFCL :'K'L"'9@2CL -F99L')),CCL+B3G,H'JL><L D2,L <>BE2L C3+,L>-LG,<F,L '(>FDLL,'CDL>-L ,-.,BC><L#DB,,D 256 D-4 D-5 D-6 ;$0:$> > 0#>$%&$6721>86$$8>4$6 8*20 .>/462;$/$087>2>+/462;$>8)$>86 %&*" 7+(0 .>24$6 8*20> 8>$'$6721>86$$8> 0#>;$0:$> > ><$78!2:0#>6+()8>8:61>(6$$0 662<>2;$6. 4>7)2:.#>!$>"207*#$6$#>+8)>8)+7> ##+8+20 .>%$ 8:6$> 0#> >7)269$6 86 %%*">7*(0 .>"=".$>8)$>*08$67$"8+20>24$6 8*20><2:.#>,/462;$> 0#>#$. =7><2:.#>!$ 6$#:"$#> )$> *8=> 2%> > :*08 >7)2:.#> .72> "207*#$6> "20#*8*20 .>7$6;*"$> 46 "8+"$>:7$#>!=>8)$>*8=>2%>0#+2>72>8) 8>$ 78!2:0#>.$%8>8:607>"2:.#>!$>7$6;$#> 7$"20#>8*/$>+1>8)$>7 /$>7+(0 .>"=".$>+%> >( 4>*0>24427+0(><$78!2:1#>8)62:()>86 '*" 2"":67 ) 1->=2:>%36>8)$>244269:0*8=>82>462;*#$>"2//$087>.$ 7$>"208 "8>/$> 8> > > +%>=2:>) ;$> 0=>5:$78+207>6$( 6#*0(>8)*7>/ 88$6 > +0"$6$.=> 27+$>: > 77+78 18>. 00$6> 257 D-7 April 23, 2017 Rosie Lua, Assistant Planner City of Indio 100 Civic Center Mall Indio, CA 92201 rlua@indio.org SUBJECT: RESPONSE TO COMMENTS ON EA 2017-0006 PAVILION PALMS SHOPPING CENTER MITIGATED NEGATIVE DECLARATION Dear Ms. Lua: Thank you for your comments on the Mitigated Negative Declaration for the proposed Pavilion Palms Shopping Center. The comment letter has been marked with and responses are as follows: Comment D-1: Thank you for the opportunity to review the Initial Study/Mitigated Negative Declaration regarding the Fairway Plaza Specific Plan Amendment No. 2. At this time, we have no further comments on this project. Our previous response letter dated October 18, 2017 which summarized priority items discussed in the Initial Study and Focused Traffic Study remain. Response D-1: We have included the October 18, 2017 letter and comments from that letter are addressed subsequently. Comment D-2: Trip Generation - While pass-by trip reductions are shown, the Traffic Study does not appear to include a table that summarizes peak hour and daily trip generation forecasts for each proposed building as well as internal trip reductions within and between the uses on the site itself. (Page 8 of the Traffic Study is missing from my copy of the report). Response D-2: Page 8 of the Traffic Study is attached which shows the trip generation. The MND included this information and analyzed the project accordingly. Comment D-3: Derek Alan Drive Connection - Access is proposed to connect the shopping center to Derek Alan Drive on the north, a local street that serves the gated Renaissance residential development. Left turns out of Derek Alan Drive to northbound Jefferson Street are physically prohibited by a raised median while northbound left turns into Derek Alan Drive are accommodated. The driveway connection between the shopping center and Derek Alan Drive should be eliminated as it will create congestion at the entrance/exit to the gated residential development and it does not facilitate exiting to the north. Response D-3: The Derek Alan Drive connection has been eliminated. 258 Comment D-4: Eastbound Left Turn Lane on Avenue 50 at Jefferson Street - The Traffic Study indicates concerns have been expressed by City of La Quinta staff regarding peak hour queuing in the eastbound left turn lane on Avenue 50 at Jefferson Street. From my observations of this intersection, the longest queues result from parent trips to and from the elementary and middle schools on the north side of Avenue 50 to the west rather than from traditional peak hour commuter trips. Calculations in the Traffic Study indicate that storage for eastbound left turns at Jefferson Street will be adequate in 2019 and will be marginally adequate in Year 2035. Additional left turn storage is proposed to be provided west of the full access driveway for left turns into the proposed full access driveway and for Jefferson Street. This treatment has been used in urbanized areas were left turn storage for stacking may only be marginally adequate. Response D-4: The MND includes a mitigation measure to account for this situation. Mitigation Measure TRAF-1: Prior to recordation of the Final Tentative Parcel Map, the Applicant shall enter into an agreement with the City of La Quinta and post security to design and construct at the intersection of Avenue 50 and Jefferson Street two eastbound left turn lanes on Avenue 50 to northbound Jefferson Street if required by the Planning Commission. Comment D-5: Relocate Avenue 50 Full Access Driveway Further To The West - Before accepting the open-ended eastbound left turn lane shown on the site plan and described immediately above, it is suggested that alternatives be explored in further detail including: a. Flip Building 8 just south of the supermarket with the Pavilions Fuel location southeast of the supermarket. b. Reorient the supermarket so it is parallel to the diagonal at the northwest corner in the site. c. Designate and widen the westerly aisle driveway on Avenue 50 as the major full- access driveway and narrow and limit the easterly driveway on Avenue 50 to right turns only. This would provide a longer throat on the repositioned major full access driveway. Entering the fueling area as currently designed from the main full access driveway could potentially block the entering traffic lane as motorists seek the first opportunity to line up for fuel. To access the fueling positions closest to Avenue 50 requires a sharp right turn greater than 90 degrees. Response D-5: Mitigation Measure TRAF-1 in the MND would address the concerns with the easterly full access driveway on Avenue 50. Additionally, the suggested alternative configurations would not be feasible since the neighboring communities do not want the fuel center closer to them. Also, reorienting the supermarket would result in inefficient utilization of the property with conflicting diagonal and right angles throughout the parking field and access points. To address the position of the fueling area, the fuel center has been reduced and positioned farther from the Avenue 50 entrance thus eliminating sharp turns. Comment D-6: Avenue 50 East of Jefferson Street - There are no significant issues associated with the Citrus Plaza Ralphs full access driveway on the north side of Avenue 50 about 300' east of Jefferson Street. 259 Response D-6: Thank you for your comment. Comment D-7: Avenue 50 and Jefferson Street Operational Improvements - To improve the traffic signal operation at Jefferson Street and Avenue 50, a westbound right turn green arrow overlap should be considered. With this additional feature and a shorter traffic signal cycle, the intersection operation would improve and delays would be reduced. The City of La Quinta should also consider "conditional service" (a practice used by the City of Indio) so that eastbound left turns could be served a second time in the same signal cycle if a gap in opposing westbound through traffic occurs. Response D-7: Thank you for your comment. Thank you for your participation in the public review process. Cheri L. Flores, Senior Planner City of La Quinta 260 261 6(179,$(0$,/$1'8636$SULO FIORUHV#ODTXLQWDRUJ &KHUL)ORUHV6HQLRU3ODQQHU &LW\RI/D4XLQWD &DOOH7DPSLFR /D4XLQWD&$ Mitigated Negative Declaration (MND) for the Proposed Pavilion Palms Shopping Center 7KH 6RXWK &RDVW $LU 4XDOLW\ 0DQDJHPHQW 'LVWULFW 6&$40' VWDIIDSSUHFLDWHV WKH RSSRUWXQLW\ WR FRPPHQWRQWKHDERYHPHQWLRQHGGRFXPHQW7KHIROORZLQJFRPPHQWLVPHDQWDVJXLGDQFHIRUWKH/HDG $JHQF\DQGVKRXOGEHLQFRUSRUDWHGLQWRWKH)LQDO01' 3URMHFW'HVFULSWLRQ 7KH /HDG $JHQF\ SURSRVHV WR GHYHORS D WRWDO RI VTXDUHIRRW PL[HGXVH FRPPHUFLDO FHQWHU GHYHORSPHQWSURMHFWRQWKHDFUHYDFDQWSDUFHO3URSRVHG3URMHFW7KH3URSRVHG3URMHFWZLOOLQFOXGH YDULRXVFRPPHUFLDOXVHVLQFOXGLQJEDQNVUHVWDXUDQWVJDVROLQHVHUYLFHVWDWLRQDQGJURFHU\VWRUH%DVHG RQDUHYLHZRIDHULDOSKRWRJUDSKVDQG)LJXUH6LWH/RFDWLRQLQWKH01'6&$40'VWDIIIRXQGWKDW UHVLGHQWLDOXVHVDUHORFDWHGLPPHGLDWHO\WRWKHVRXWKDQGVRXWKZHVWRIWKH3URSRVHG3URMHFW &RPSOLDQFHZLWK6&$40'5XOHV 6LQFHWKH3URSRVHG3URMHFWLQFOXGHVJDVROLQHVHUYLFHVWDWLRQDSHUPLWIURP6&$40'ZRXOGEHUHTXLUHG DQG6&$40'VKRXOGEHLGHQWLILHGDVD5HVSRQVLEOH$JHQF\IRUWKLV3URMHFWLQWKH)LQDO01'7KH DVVXPSWLRQVLQWKHDLUTXDOLW\DQDO\VLVLQWKH)LQDO01'ZLOOEHWKHEDVLVIRUSHUPLWFRQGLWLRQVDQGOLPLWV 7KH)LQDO01'VKRXOGDOVRGHPRQVWUDWHFRPSOLDQFHZLWK6&$40'5XOHVLQFOXGLQJEXWDUHQRWOLPLWHG WR5XOH±3HUPLWWR&RQVWUXFW5XOH±3HUPLWWR2SHUDWHDQG5XOH±*DVROLQH7UDQVIHUDQG 'LVSHQVLQJ,IWKHUHDUHSHUPLWWLQJTXHVWLRQVFRQFHUQLQJWKHJDVROLQHVHUYLFHVWDWLRQWKH\FDQEHGLUHFWHG WR6&$40'(QJLQHHULQJDQG3HUPLWWLQJVWDIIDW $LU4XDOLW\$QDO\VLV ,QWKH$LU4XDOLW\DQDO\VLVWKH/HDG$JHQF\IRXQGWKDWWKH3URSRVHG3URMHFW¶VUHJLRQDOFRQVWUXFWLRQDQG RSHUDWLRQDODLUTXDOLW\LPSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW+RZHYHULWGRHVQRWDSSHDUWKDWWKH$LU 4XDOLW\DQDO\VLVLQFOXGHRSHUDWLRQDO52*HPLVVLRQVJHQHUDWHGIURPVWRUDJHWDQNVRUIURPWKHIXHOLQJ SURFHVV7KLVPD\KDYHOLNHO\OHGWRDQXQGHUHVWLPDWLRQRIWKH3URSRVHG3URMHFW¶VRSHUDWLRQDODLUTXDOLW\ LPSDFWV,WLVLPSRUWDQWWRQRWHWKDWZKLOH&DO((0RGTXDQWLILHVPRELOHVRXUFHHPLVVLRQVHJWULSYLVLWV E\ SDWURQV DVVRFLDWHG ZLWK RSHUDWLQJ D JDVROLQH VHUYLFH VWDWLRQ &DO((0RG GRHV QRW TXDQWLI\ WKH RSHUDWLRQDOVWDWLRQDU\VRXUFHHPLVVLRQVIURPWKHVWRUDJHWDQNVDQGIXHOLQJHTXLSPHQW7KHUHIRUHLWLV UHFRPPHQGHGWKDWWKH/HDG$JHQF\TXDQWLI\RSHUDWLRQDOHPLVVLRQVIURPWKHIXHOLQJSURFHVVLQWKH)LQDO 01' +HDOWK5LVN$VVHVVPHQW 7KH3URSRVHG3URMHFWZRXOGEHVLWHGLQFORVHSUR[LPLW\WRH[LVWLQJUHVLGHQWLDOXVHV%HQ]HQHZKLFKLVD WR[LF DLU FRQWDPLQDQW PD\ EH HPLWWHG IURP WKH 3URSRVHG 3URMHFW¶V JDVROLQH UHIXHOLQJ RSHUDWLRQV 01'3DJH &DO((PRGLQFRUSRUDWHVXSWRGDWHVWDWHDQGORFDOO\DSSURYHGHPLVVLRQIDFWRUVDQGPHWKRGRORJLHVIRUHVWLPDWLQJSROOXWDQW HPLVVLRQVIURPW\SLFDOODQGXVHGHYHORSPHQW&DO((0RGLVWKHRQO\VRIWZDUHPRGHOPDLQWDLQHGE\WKH&DOLIRUQLD$LU3ROOXWLRQ &RQWURO2IILFHUV$VVRFLDWLRQ&$3&2$DQGLVDYDLODEOHIUHHRIFKDUJHDWZZZFDOHHPRGFRP 262 LETTER E E-2 E-3 E-4 E-1 6&$40'VWDIILVFRQFHUQHGDERXWWKHSRWHQWLDOKHDOWKLPSDFWVRQWKHUHVLGHQWVIURPEHLQJH[SRVHGWR EHQ]HQH$VVXFKLWLVUHFRPPHQGHGWKDWWKH/HDG$JHQF\HYDOXDWHTXDQWLI\DQGSHUIRUPDKHDOWKULVN DVVHVVPHQWIRUWKH3URSRVHG3URMHFWLQWKH)LQDO01'*XLGDQFHIRUSHUIRUPLQJDJDVROLQHGLVSHQVLQJ VWDWLRQKHDOWKULVNDVVHVVPHQWFDQEHIRXQGLQWKH6&$40'¶V(PLVVLRQ,QYHQWRU\DQG5LVN$VVHVVPHQW *XLGHOLQHVIRU*DVROLQH'LVSHQVLQJ6WDWLRQV *XLGDQFH5HJDUGLQJ*DVROLQH'LVSHQVLQJ)DFLOLWLHV6LWHG1HDU6HQVLWLYH5HFHSWRUV 6&$40'VWDIIUHFRJQL]HVWKDWWKHUHDUHPDQ\IDFWRUV/HDG$JHQFLHVPXVWFRQVLGHUZKHQPDNLQJORFDO SODQQLQJ DQG ODQG XVH GHFLVLRQV 7R IDFLOLWDWH VWURQJHU FROODERUDWLRQ EHWZHHQ /HDG $JHQFLHV DQG 6&$40' WR UHGXFH FRPPXQLW\ H[SRVXUH WR VRXUFHVSHFLILF DQG FXPXODWLYH DLU SROOXWLRQ LPSDFWV 6&$40'DGRSWHGWKH*XLGDQFH'RFXPHQWIRU$GGUHVVLQJ$LU4XDOLW\,VVXHVLQ*HQHUDO3ODQVDQG /RFDO3ODQQLQJLQ$GGLWLRQDOO\LWLVUHFRPPHQGHGWKDWDIRRWVHSDUDWLRQEHWZHHQDJDVROLQH GLVSHQVLQJIDFLOLW\DQGVHQVLWLYHODQGXVHVHJUHVLGHQWLDOXVHV6&$40'VWDIIUHFRPPHQGVWKDWWKH /HDG$JHQF\UHYLHZDQGFRQVLGHUWKHVHJXLGDQFHZKHQPDNLQJORFDOSODQQLQJDQGODQGXVHGHFLVLRQV 0LWLJDWLRQ0HDVXUHV 6L[PLWLJDWLRQPHDVXUHVIURPWKH)DLUZD\3OD]D$PHQGPHQW±5HVROXWLRQDUHLQFRUSRUDWHG LQWKH01'IRUWKH3URSRVHG3URMHFW6LQFH&(4$UHTXLUHVWKDWDOOIHDVLEOHPLWLJDWLRQPHDVXUHVJR EH\RQG ZKDW LV UHTXLUHG E\ ODZ WR PLQLPL]H DQ\ VLJQLILFDQW LPSDFWV DQG WR IXUWKHU UHGXFH FULWHULD SROOXWDQW HPLVVLRQV 6&$40' VWDII UHFRPPHQGV WKDW WKH /HDG $JHQF\ LQFRUSRUDWH WKH IROORZLQJ PLWLJDWLRQ PHDVXUHV WKDW DUH PRUH VWULQJHQW WKDQ WKRVH IURP WKH )DLUZD\ 3OD]D $PHQGPHQW ± 5HVROXWLRQ 5HJDUGLQJWKH6HFRQG%XOOHWRI0LWLJDWLRQ0HDVXUH±³/RZ(PLVVLRQ&RQVWUXFWLRQ(TXLSPHQW´ 7RIXUWKHUUHGXFHSDUWLFXODWHPDWWHUHPLVVLRQVGXULQJFRQVWUXFWLRQDQGPLQLPL]HWKHLULPSDFWVRQQHDUE\ UHVLGHQWV6&$40'VWDIIUHFRPPHQGVWKDWWKH/HDG$JHQF\XVHRII-URDGGLHVHO-SRZHUHGFRQVWUXFWLRQ HTXLSPHQW WKDW PHHWV RU H[FHHGV WKH &$5% DQG 86(3$ 7LHU RII-URDG HPLVVLRQV VWDQGDUGV IRU HTXLSPHQW UDWHG DW KRUVHSRZHU RU JUHDWHU GXULQJ 3URMHFW FRQVWUXFWLRQ 6XFK HTXLSPHQW ZLOO EH RXWILWWHGZLWK%HVW$YDLODEOH&RQWURO7HFKQRORJ\%$&7GHYLFHVLQFOXGLQJD&$5%FHUWLILHG/HYHO 'LHVHO3DUWLFXODWH)LOWHUV'3)/HYHO'3)VDUHFDSDEOHRIDFKLHYLQJDWOHDVWSHUFHQWUHGXFWLRQLQLQ SDUWLFXODWHPDWWHUHPLVVLRQV$OLVWRI&$5%YHULILHG'3)VDUHDYDLODEOHRQWKH&$5%ZHEVLWH7KHVH UHTXLUHPHQWVVKDOOEHLQFOXGHGLQDSSOLFDEOHELGGRFXPHQWVDQGVXFFHVVIXOFRQWUDFWRUVPXVWGHPRQVWUDWH WKHDELOLW\WRVXSSO\VXFKHTXLSPHQW$FRS\RIHDFKXQLW¶VFHUWLILHGWLHUVSHFLILFDWLRQRUPRGHO\HDU VSHFLILFDWLRQDQG&$5%RU6&$40'RSHUDWLQJSHUPLWLIDSSOLFDEOHVKDOOEHDYDLODEOHXSRQUHTXHVWDW WKHWLPHRIPRELOL]DWLRQRIHDFKDSSOLFDEOHXQLWRIHTXLSPHQW ,QWKHHYHQWWKDWFRQVWUXFWLRQHTXLSPHQW FDQQRWPHHWWKH7LHUHQJLQHFHUWLILFDWLRQWKH3URMHFWUHSUHVHQWDWLYHRUFRQWUDFWRUPXVWGHPRQVWUDWH WKURXJKIXWXUHVWXG\ZLWKZULWWHQILQGLQJVVXSSRUWHGE\VXEVWDQWLDOHYLGHQFHWKDWLVDSSURYHGE\WKH/HDG $JHQF\EHIRUHXVLQJRWKHUWHFKQRORJLHVVWUDWHJLHV$OWHUQDWLYHDSSOLFDEOHVWUDWHJLHVPD\LQFOXGHEXW ZRXOGQRWEHOLPLWHGWRUHGXFWLRQLQWKHQXPEHUDQGRUKRUVHSRZHUUDWLQJRIFRQVWUXFWLRQHTXLSPHQW OLPLWLQJWKHQXPEHURIGDLO\FRQVWUXFWLRQKDXOWUXFNWULSVWRDQGIURPWKH3URMHFWXVLQJFOHDQHUYHKLFOH IXHODQGRUOLPLWLQJWKHQXPEHURILQGLYLGXDOFRQVWUXFWLRQSURMHFWSKDVHVRFFXUULQJVLPXOWDQHRXVO\ 6RXWK&RDVW$LU4XDOLW\0DQDJHPHQW'LVWULFW$FFHVVHGDWKWWSZZZDTPGJRYKRPHSHUPLWVULVNDVVHVVPHQW 6RXWK&RDVW$LU4XDOLW\0DQDJHPHQW'LVWULFW0D\*XLGDQFH'RFXPHQWIRU$GGUHVVLQJ$LU4XDOLW\,VVXHVLQ*HQHUDO 3ODQV DQG /RFDO 3ODQQLQJ $FFHVVHG DWKWWSZZZDTPGJRYKRPHOLEUDU\GRFXPHQWVVXSSRUWPDWHULDOSODQQLQJ JXLGDQFHJXLGDQFHGRFXPHQW &DOLIRUQLD $LU 5HVRXUFHV%RDUG$LU4XDOLW\DQG/DQG8VH+DQGERRN$&RPPXQLW\+HDOWK3HUVSHFWLYH3DJH $FFHVVHGDWKWWSVZZZDUEFDJRYFKKDQGERRNSGI 01'3DJH &DOLIRUQLD$LU5HVRXUFHV%RDUG1RYHPEHU'LHVHO2II5RDG(TXLSPHQW0HDVXUH±:RUNVKRS3DJH$FFHVVHG DWKWWSVZZZDUEFDJRYPVSURJRUGLHVHOSUHVHQWDWLRQVQRYBZRUNVKRSSGI ,ELG3DJH 263 E-4 (cont.) E-5 E-6 5HJDUGLQJWKH7KLUG%XOOHWRI0LWLJDWLRQ0HDVXUH±³/RZ92&3DLQWV3ULPHUVDQG&RDWLQJV´ 7RIXUWKHUUHGXFH92&HPLVVLRQVIURPDUFKLWHFWXUDOFRDWLQJ6&$40'VWDIIUHFRPPHQGVWKDWWKH/HDG $JHQF\UHTXLUHWKHXVHRIDUFKLWHFWXUDOFRDWLQJVQRPRUHWKDQJUDPVOLWHURI92&WKDWDUHEH\RQGWKH OLPLWVLQ6&$40'5XOH±$UFKLWHFWXUDO&RDWLQJV 5HJDUGLQJWKH6L[WK%XOOHWRI0LWLJDWLRQ0HDVXUH±³'HOLYHULHVGXULQJ2II3HDN3HULRGV´ 6&$40'VWDIIUHFRPPHQGVWKDWWKH/HDG$JHQF\UHTXLUHWKDWQRGHOLYHU\YHKLFOHVPD\LGOHIRUPRUH WKDQILYHFRQVHFXWLYHPLQXWHV7KLVLVFRQVLVWHQWZLWKWKH&DOLIRUQLD$LU5HVRXUFHV%RDUG¶VLGOLQJSROLF\ JXLGHOLQHV &ORVLQJ 3XUVXDQWWR&(4$*XLGHOLQHV6HFWLRQSULRUWRDSSURYLQJWKH3URSRVHG3URMHFWWKH/HDG$JHQF\ VKDOOFRQVLGHUWKH01'IRUDGRSWLRQWRJHWKHUZLWKDQ\FRPPHQWVUHFHLYHGGXULQJWKHSXEOLFUHYLHZ SURFHVV3OHDVHSURYLGHWKH6&$40'ZLWKZULWWHQUHVSRQVHVWRDOOFRPPHQWVFRQWDLQHGKHUHLQSULRUWR WKHFHUWLILFDWLRQRIWKH)LQDO01':KHQUHVSRQGLQJWRLVVXHVUDLVHGLQWKHFRPPHQWVUHVSRQVHVKRXOG SURYLGHVXIILFLHQWGHWDLOVJLYLQJUHDVRQVZK\VSHFLILFFRPPHQWVDQGVXJJHVWLRQVDUHQRWDFFHSWHG7KHUH VKRXOG EH JRRG IDLWK UHDVRQHG DQDO\VLV LQ UHVSRQVH &RQFOXVRU\ VWDWHPHQWV XQVXSSRUWHG E\ IDFWXDO LQIRUPDWLRQGRQRWIDFLOLWDWHWKHSXUSRVHDQGJRDORI&(4$RQSXEOLFGLVFORVXUHDQGDUHQRWPHDQLQJIXO RUXVHIXOWRGHFLVLRQPDNHUVDQGWRWKHSXEOLFZKRDUHLQWHUHVWHGLQWKH3URSRVHG3URMHFW 6&$40'VWDIILVDYDLODEOHWRZRUNZLWKWKH/HDG$JHQF\WRDGGUHVVDQ\DLUTXDOLW\TXHVWLRQVWKDWPD\ DULVHIURPWKLVFRPPHQWOHWWHU3OHDVHFRQWDFWPHDWOVXQ#DTPGJRYLI\RXKDYHDQ\TXHVWLRQV 6LQFHUHO\ Lijin Sun /LMLQ6XQ-' 3URJUDP6XSHUYLVRU&(4$,*5 3ODQQLQJ5XOH'HYHORSPHQW $UHD6RXUFHV /6 59& &RQWURO1XPEHU 6RXWK &RDVW $LU 4XDOLW\ 0DQDJHPHQW 'LVWULFW 5XOH $UFKLWHFWXUDO &RDWLQJV $FFHVVHG DW KWWSZZZDTPGJRYGRFVGHIDXOWVRXUFHUXOHERRNUHJ[LUSGI &DOLIRUQLD $LU 5HVRXUFHV %RDUG -XQH :ULWWHQ ,GOLQJ 3ROLF\ *XLGHOLQHV $FFHVVHG DW KWWSVZZZDUEFDJRYPVSURJRUGLHVHOJXLGDQFHZULWWHQLGOLQJJXLGHSGI 264 E-6 (cont.) E-7 April 23, 2017 Lijin Sun, J.D., Program Supervisor, CEQA IGR SCAQMD Planning, Rule Development & Area Sources 21865 Copley Drive Diamond Bar, CA 91765-4178 SUBJECT: RESPONSE TO COMMENTS ON EA 2017-0006 PAVILION PALMS SHOPPING CENTER MITIGATED NEGATIVE DECLARATION Dear Ms. Sun: Thank you for your comments on the Mitigated Negative Declaration for the proposed Pavilion Palms Shopping Center. The comment letter has been marked and is attached. Responses are as follows: Comment E-1: Project Description—The Lead Agency proposes to develop a total of 125,800 square-foot mixed-use commercial center development project on the 12-acre vacant parcel (Proposed Project). The Proposed Project will include various commercial uses, including banks, restaurants, gasoline service station, and grocery store. Based on a review of aerial photographs and Figure 2, Site Location, in the MND, SCAQMD staff found that residential uses are located immediately to the south and southwest of the Proposed Project. Response E-1: Pages 1 and 8 of the MND identify that while the total project is 125,800 square feet, 100,460 square feet was already approved in 2002. The uses approved in 2002 are the same as the uses currently proposed. Therefore, the MND uses the analysis from the previously certified MND (2002) for the approved 100,460 square feet and is only required to focus on the impacts of adding of 25,340 square feet to the retail areas. Comment E-2: Compliance with SCAQMD Rules—Since the Proposed Project includes gasoline service station, a permit from SCAQMD would be required, and SCAQMD should be identified as a Responsible Agency for this Project in the Final MND. The assumptions in the air quality analysis in the Final MND will be the basis for permit conditions and limits. The Final MND should also demonstrate compliance with SCAQMD Rules, including, but are not limited to, Rule 201 – Permit to Construct, Rule 203 – Permit to Operate, and Rule 461 – Gasoline Transfer and Dispensing. If there are permitting questions concerning the gasoline service station, they can be directed to SCAQMD Engineering and Permitting staff at (909) 396-2551. Response E-2: The applicant has been made aware of the requirement to obtain a permit from the SCQAMD for the gasoline service station. Comment E-3: Air Quality Analysis—In the Air Quality analysis, the Lead Agency found that the Proposed Project’s regional construction and operational air quality impacts would be less than 265 significant. However, it does not appear that the Air Quality analysis include operational ROG emissions generated from storage tanks or from the fueling process. This may have likely led to an under-estimation of the Proposed Project’s operational air quality impacts. It is important to note that while CalEEMod quantifies mobile source emissions (e.g., trip visits by patrons) associated with operating a gasoline service station, CalEEMod does not quantify the operational stationary source emissions from the storage tanks and fueling equipment. Therefore, it is recommended that the Lead Agency quantify operational emissions from the fueling process in the Final MND. Response E-3: The Proposed Project which was analyzed is the added 25,340 square feet to the retail areas. The previous approval included an air quality analysis for the gasoline service station, therefore, no further analysis was conducted for the gasoline station. However, a Localized Significance Thresholds (LST) analysis was prepared for the additional 25,340 square feet, and the results (which were less than significant) were identified in the MND. Comment E-4: Health Risk Assessment—The Proposed Project would be sited in close proximity to existing residential uses. Benzene, which is a toxic air contaminant, may be emitted from the Proposed Project’s gasoline refueling operations. SCAQMD staff is concerned about the potential health impacts on the residents from being exposed to benzene. As such, it is recommended that the Lead Agency evaluate, quantify, and perform a health risk assessment for the Proposed Project in the Final MND. Guidance for performing a gasoline dispensing station health risk assessment can be found in the SCAQMD’s Emission Inventory and Risk Assessment Guidelines for Gasoline Dispensing Stations. Response E-4: The Lead Agency determined that a Health Risk Assessment wasn’t necessary since it is not a requirement. The comment will be shared with the Planning Commission for consideration. Comment E-5: Guidance Regarding Gasoline Dispensing Facilities Sited Near Sensitive Receptors—SCAQMD staff recognizes that there are many factors Lead Agencies must consider when making local planning and land use decisions. To facilitate stronger collaboration between Lead Agencies and SCAQMD to reduce community exposure to source-specific and cumulative air pollution impacts, SCAQMD adopted the Guidance Document for Addressing Air Quality Issues in General Plans and Local Planning in 2005. Additionally, it is recommended that a 50-foot separation between a gasoline dispensing facility and sensitive land uses (e.g., residential uses). SCAQMD staff recommends that the Lead Agency review and consider these guidance when making local planning and land use decisions. Response E-5: Thank you for your comment. The location of the proposed gasoline dispensing facility is over 50 feet away from sensitive uses in the area. The guidance will be considering in planning and land use decisions. Comment E-6: Mitigation Measures—Six mitigation measures from the Fairway Plaza Amendment 1 – Resolution 2002-2006 are incorporated in the MND for the Proposed Project. 266 Since CEQA requires that all feasible mitigation measures go beyond what is required by law to minimize any significant impacts, and to further reduce criteria pollutant emissions, SCAQMD staff recommends that the Lead Agency incorporate the following mitigation measures that are more stringent than those from the Fairway Plaza Amendment 1 – Resolution 2002-2006. Regarding the Second Bullet of Mitigation Measure – “Low Emission Construction Equipment” To further reduce particulate matter emissions during construction and minimize their impacts on nearby residents, SCAQMD staff recommends that the Lead Agency use off-road diesel- powered construction equipment that meets or exceeds the CARB and USEPA Tier 4 off-road emissions standards for equipment rated at 50 horsepower or greater during Project construction. Such equipment will be outfitted with Best Available Control Technology (BACT) devices including a CARB certified Level 3 Diesel Particulate Filters (DPF). Level 3 DPFs are capable of achieving at least 85 percent reduction in in particulate matter emissions. A list of CARB verified DPFs are available on the CARB website. These requirements shall be included in applicable bid documents and successful contractor(s) must demonstrate the ability to supply such equipment. A copy of each unit’s certified tier specification or model year specification and CARB or SCAQMD operating permit (if applicable) shall be available upon request at the time of mobilization of each applicable unit of equipment. In the event that construction equipment cannot meet the Tier 4 engine certification, the Project representative or contractor must demonstrate through future study with written findings supported by substantial evidence that is approved by the Lead Agency before using other technologies/strategies. Alternative applicable strategies may include, but would not be limited to, reduction in the number and/or horsepower rating of construction equipment, limiting the number of daily construction haul truck trips to and from the Project, using cleaner vehicle fuel, and/or limiting the number of individual construction project phases occurring simultaneously. Regarding the Third Bullet of Mitigation Measure – “Low VOC Paints, Primers, and Coatings” To further reduce VOC emissions from architectural coating, SCAQMD staff recommends that the Lead Agency require the use of architectural coatings (no more than 50 grams/liter of VOC) that are beyond the limits in SCAQMD Rule 1113 – Architectural Coatings. Regarding the Sixth Bullet of Mitigation Measure – “Deliveries during Off-Peak Periods” SCAQMD staff recommends that the Lead Agency require that no delivery vehicles may idle for more than five consecutive minutes. This is consistent with the California Air Resources Board’s idling policy guidelines. Response E-6: Page 22 of the MND states: 6. The operator shall comply with all existing and future California Air Resources Board (CARB) and SCAQMD regulations related to diesel-fueled trucks, which may include among others: (1) meeting more stringent emission standards; (2) retrofitting existing engines with particulate traps; (3) use of low sulfur fuel; and (4) use of alternative fuels or equipment. 267 Additionally, Mitigation Measures will be added to the Final EIR which address SCAQMD’s concerns. AIR-2: To the extent feasible, project applicant shall use paints and coatings with a VOC content lower than SCAQMD Rule 1113 requires or more stringent standards if in place at the time development occurs. AIR-3: In accordance with California Air Resources Board’s idling policy guidelines, no delivery vehicles may idle for more than five consecutive minutes. Comment E-7: Closing—Pursuant to CEQA Guidelines Section 15074, prior to approving the Proposed Project, the Lead Agency shall consider the MND for adoption together with any comments received during the public review process. Please provide the SCAQMD with written responses to all comments contained herein prior to the certification of the Final MND. When responding to issues raised in the comments, response should provide sufficient details giving reasons why specific comments and suggestions are not accepted. There should be good faith, reasoned analysis in response. Conclusory statements unsupported by factual information do not facilitate the purpose and goal of CEQA on public disclosure and are not meaningful or useful to decision makers and to the public who are interested in the Proposed Project. Response E-7: Responses to your comments have been provided as requested. Thank you for your participation in the public review process. Cheri L. Flores, Senior Planner City of La Quinta 268 From:Kelly, Pat To:Cheri Flores Subject:Pavilions Palms Shopping Center Date:Wednesday, April 18, 2018 2:27:01 PM My name is Pat Kelly and I reside at 50375 Via Puesta Del Sol, La Quinta. This is the Palmilla Development located at Avenue 50 & Jefferson. I have some concerns about the proposed Pavilions Palms Shopping Center 1)It appears that there is a fuel island designed on the southwest portion of the property. I believe this is unsafe and should be moved to the north and up against Jefferson Street. Light pollution from a fuel island, especially if opened 24 hours, will have a negative impact on my residence. 2)How are U-turns from this development going to be prevented at the entrance to Palmilla on Avenue 50.? The City of La Quinta police does an awful job of patrolling Avenue 50 as it is, so how would this safety issue be mitigated? 3)How will the developer mitigate noise that will impact properties near the development? This appears to be a high density development and will have lots of traffic & noise so how will this be addressed? I am concerned that this will have a negative impact on my residence. 4)Avenue 50 is already in terrible shape and this development will likely make it even worse. What is the City of La Quinta’s plan to fix the pavement that is already in awful shape, and is basically never even maintained? Thank you, Pat Kelly 269 F-1 LETTER F April 23, 2017 Pat Kelly 50375 Via Puesta Del Sol La Quinta, CA 92253 SUBJECT: RESPONSE TO COMMENTS ON EA 2017-0006 PAVILION PALMS SHOPPING CENTER MITIGATED NEGATIVE DECLARATION Dear Pat: Thank you for your comments on the Mitigated Negative Declaration for the proposed Pavilion Palms Shopping Center. The comment letter has been marked and is attached. Responses are as follows: Comment F-1: It appears that there is a fuel island designed on the southwest portion of the property. I believe this is unsafe and should be moved to the north and up against Jefferson Street. Light pollution from a fuel island, especially if opened 24 hours, will have a negative impact on my residence. How are U-turns from this development going to be prevented at the entrance to Palmilla on Avenue 50.? The City of La Quinta police does an awful job of patrolling Avenue 50 as it is, so how would this safety issue be mitigated? How will the developer mitigate noise that will impact properties near the development? This appears to be a high density development and will have lots of traffic & noise so how will this be addressed? I am concerned that this will have a negative impact on my residence. Response F-1: The fuel center will be in operation from 7 a.m. to 10 p.m. A lighting plan has been designed to result in no light spillage onto surrounding properties. The project includes a full movement access point at the easterly driveway on Avenue 50. Vehicles exiting the shopping center on Avenue 50 would be able to turn left out of this driveway in order to go in the eastbound direction. There would be minimal U-turns at the Palmilla entrance on Avenue 50. A noise study was prepared for the project that evaluated the project’s noise impact on the area and was included in the Mitigated Negative Declaration. The existing ambient noise in the area which is generated from traffic along Jefferson Street and Avenue 50 is approximately 65 decibels. The noise study shows that the project would not generate noise levels in excess of this. Additionally, the Mitigated Negative Declaration included mitigation measures to reduce noise impacts to less than significant levels. 270 Mitigation Measures: NOI-1 It is recommended that the Pavilions delivery dock is enclosed with walls and a roof, and that an acoustically absorptive material is used to partially line the internal walls to control noise build up. This will limit potential disturbance from unloading. NOI-2 Vehicle loading and unloading for all retail units should be carried out in a quiet manner. NOI-3 It is recommended that HVAC equipment on roofs is screened by a noise barrier from the residences. This barrier should at a minimum, provide line of sight screening. NOI-4 It is recommended that noisy HVAC equipment at grade is enclosed with CMU walls at least 2 feet higher than the equipment. NOI-5 It is recommended that noise from HVAC equipment is limited to 60 dB(A) at the site boundary. NOI-6 Reduce the noise from the audible devices for the drive-through eating establishments using any and/or all methods as follows: Position devices away from the site boundary to the south. x Provide additional screening such as positioning of the retail buildings or a noise barrier close to the device; x Reduce the number of audible devices, such as one device to serve two drive throughs; x Orient the device perpendicular to the vehicle and at ear height, with the device aimed at the listener in the vehicle; x The sound from the devices should be limited to a maximum of 75 dB(A) at 3 feet; x There shall be no annunciator tones, whistles, beeps or other characteristic sounds. NOI-7 Lay out the site working to keep noise-producing activities as far as possible from residences, minimize the use of backup alarms, and minimize truck activity and truck queuing near the residential areas. NOI-8 Perform construction in a manner to minimize noise where practicable. For example: x Where practicable, use hydraulic rather than pneumatic impact tools x Operate equipment to minimize banging, clattering, buzzing, and other annoying types of noises x Turn off idling equipment and vehicles x All internal combustion equipment shall be fitted with properly operating mufflers and air intake silencers 271 x All stationary equipment shall be located as far as practical from adjacent potential residential units x Phase in start-up and shut-down of site equipment x Conduct truck loading, unloading and hauling operations to keep noise to a minimum x Limit the time that steel decking or plates for street decking or covering excavated areas are in use x Limit the use of annunciators or public address systems, except for emergency notifications x All on-site deliveries shall be limited to between 7:00 a.m. to 10:00 p.m. Thank you for your participation in the public review process. Cheri L. Flores, Senior Planner City of La Quinta 272 From:Kent Bailey To:Cheri Flores Cc:Dana S Bailey Subject:Proposed Pavilions Palms Center Comment Date:Friday, April 20, 2018 4:42:30 PM Hi Cheri, Thanks for the note, I’ll try again! After reviewing the summary of the plan for the proposed shopping, food and fuel center, my wife and I are most concerned. We can understand a need for a modest sized upscale grocery, but find a new center unnecessary when a desireable space is already available nearby. We’re disappointed that the developer, the current owner and city haven’t worked together to rehab the old Ralph’s location and dilapidated mall on Washington and Calle Tampico. As you no doubt know, there is an existing good sized grocery pad and space for numerous retail spaces that are way under utilized. With modest change a 24 pump fuel center could be placed on the lot as well. The 50th and Jefferson location is objectionable to us and many of our neighbors in Palmilla, with our entrance almost across the street from the proposed center. The center would negatively impact our quality of life us in the following ways: Much more traffic and congestion on 50th and at the Jefferson intersection. The Palmilla egress would be especially impacted and difficult. Late night fast food drive thrus and gas pump intercoms... noise pollution some of which would pollute for 24 hrs daily. High intensity lighting creates light pollution, the Ralph’s Center across the street has plenty of that already. A larger than needed fuel center would serve hundreds of vehicles daily and further impact traffic on our busy intersection. If it were placed further North on Jefferson that would be Mitgate some of the congestion and be a possible alternative site. Restaurant emissions of smoke and smell such as exists along Hwy 111 between Stater Bros and Wells Fargo is unacceptable in any residential setting such as ours. The commotion and traffic created by the addition of this center would no doubt drive our property values down and in fact lead to lower property tax revenue. We urge the city to say NO to this proposal in favor of a better center on the space across from City Hall on Calle Tampico. J Kent Bailey Dana S Bailey 50415 Via Serenidad LaQuinta Ca 92253 206 890 5386 Cell 273 LETTER G G-1 April 23, 2017 Kent Bailey 50415 Via Serenidad La Quinta, CA 92253 SUBJECT: RESPONSE TO COMMENTS ON EA 2017-0006 PAVILION PALMS SHOPPING CENTER MITIGATED NEGATIVE DECLARATION Dear Mr. Bailey: Thank you for your comments on the Mitigated Negative Declaration for the proposed Pavilion Palms Shopping Center. The comment letter has been marked and is attached. Responses are as follows: Comment G-1: The 50th and Jefferson location is objectionable to us and many of our neighbors in Palmilla, with our entrance almost across the street from the proposed center. The center would negatively impact our quality of life us in the following ways: Much more traffic and congestion on 50th and at the Jefferson intersection. The Palmilla egress would be especially impacted and difficult. Late night fast food drive thrus and gas pump intercoms... noise pollution some of which would pollute for 24 hrs daily. High intensity lighting creates light pollution, the Ralph’s Center across the street has plenty of that already. Response G-1: The Mitigated Negative Declaration addresses the impacts of traffic on the Avenue 50 and Jefferson intersection. The project includes a full movement access point at the easterly driveway on Avenue 50. Vehicles exiting the shopping center on Avenue 50 would be able to turn left out of this driveway in order to go in the eastbound direction. There would be minimal U-turns at the Palmilla entrance on Avenue 50. Additionally, implementation of Mitigation Measure TRAF-1 would reduce impacts to less than significant levels. Mitigation Measure TRAF-1: Prior to recordation of the Final Tentative Parcel Map, the Applicant shall enter into an agreement with the City of La Quinta and post security to design and construct at the intersection of Avenue 50 and Jefferson Street two eastbound left turn lanes on Avenue 50 to northbound Jefferson Street if required by the Planning Commission. A noise study was prepared for the project that evaluated the project’s noise impact on the area and was included in the Mitigated Negative Declaration. The existing ambient noise in the area which is generated from traffic along Jefferson Street and Avenue 50 is 274 approximately 65 decibels. The noise study shows that the project would not generate noise levels in excess of this. Additionally, the Mitigated Negative Declaration included mitigation measures to reduce noise impacts to less than significant levels. Mitigation Measures: NOI-1 It is recommended that the Pavilions delivery dock is enclosed with walls and a roof, and that an acoustically absorptive material is used to partially line the internal walls to control noise build up. This will limit potential disturbance from unloading. NOI-2 Vehicle loading and unloading for all retail units should be carried out in a quiet manner. NOI-3 It is recommended that HVAC equipment on roofs is screened by a noise barrier from the residences. This barrier should at a minimum, provide line of sight screening. NOI-4 It is recommended that noisy HVAC equipment at grade is enclosed with CMU walls at least 2 feet higher than the equipment. NOI-5 It is recommended that noise from HVAC equipment is limited to 60 dB(A) at the site boundary. NOI-6 Reduce the noise from the audible devices for the drive-through eating establishments using any and/or all methods as follows: Position devices away from the site boundary to the south. x Provide additional screening such as positioning of the retail buildings or a noise barrier close to the device; x Reduce the number of audible devices, such as one device to serve two drive throughs; x Orient the device perpendicular to the vehicle and at ear height, with the device aimed at the listener in the vehicle; x The sound from the devices should be limited to a maximum of 75 dB(A) at 3 feet; x There shall be no annunciator tones, whistles, beeps or other characteristic sounds. NOI-7 Lay out the site working to keep noise-producing activities as far as possible from residences, minimize the use of backup alarms, and minimize truck activity and truck queuing near the residential areas. NOI-8 Perform construction in a manner to minimize noise where practicable. For example: x Where practicable, use hydraulic rather than pneumatic impact tools x Operate equipment to minimize banging, clattering, buzzing, and other annoying types of noises x Turn off idling equipment and vehicles 275 x All internal combustion equipment shall be fitted with properly operating mufflers and air intake silencers x All stationary equipment shall be located as far as practical from adjacent potential residential units x Phase in start-up and shut-down of site equipment x Conduct truck loading, unloading and hauling operations to keep noise to a minimum x Limit the time that steel decking or plates for street decking or covering excavated areas are in use x Limit the use of annunciators or public address systems, except for emergency notifications x All on-site deliveries shall be limited to between 7:00 a.m. to 10:00 p.m. The fuel center will be in operation from 7 a.m. to 10 p.m. A lighting plan has been designed to result in no light spillage onto surrounding properties. Thank you for your participation in the public review process. Cheri L. Flores, Senior Planner City of La Quinta 276 As President of Palmilla HOA, a 159-single home development with a main entrance guard gate off of 50th just 500 feet west of Jefferson, our main concerns center around the traffic issues involved with this development. 1. The primary issue concerns location and the stacking capacity of the gas pumps. The gas station has the same number of dispensers as Costco, which implies sales of over 15,000 gallons per day. That translates into roughly 1,000 vehicles per day. However, the stacking design is not as long as the one at Costco that creates a potential bottleneck and interferes with the ingress and egress, thus backing up onto 50th Question: Can you explain your methodology and assumptions for the stacking lanes, especially during peak traffic times? We contend that the movement of the gas station 200 ft north on Jefferson can easily mitigate this issue. 2. Also at issue are concerns regarding the ingress/egress to our community from our main traffic gate on 50th. The current gas station location will force drivers to exit onto west bound traffic onto 50th. We believe that 50% of the new west bound traffic will U-turn at the entry into Palmilla to travel back east or back to Jefferson. (Via Palmilla is our street name.) Question: What were your estimates of U-turn activity and how were they based? We disagree with the EIR assessment and feel that a “no U turn sign” on 50th at our main entrance would discourage this, encourage people to exit onto Jefferson and prevent problems with our access. 3. The EIR indicated that noise issues would be mitigated yet it didn’t address whether the fuel dispensers will have the small TV’s (audible devises) on top showing minute commercials. This noise travels differently than normal ambient noise. Our homeowners nearest to the gas pumps will be adversely impacted if this is the case. Question: Can we be assured that the gas pumps discussed will not have these screens? If they do, what measures will be taken to mitigate this issue? We feel strongly that this type of audible advertising is intrusive in residential adjacent areas and should not be allowed. 4. When our community was being built, Avenue 50 was a two-lane road. Yes, we knew it was going to be widened but the result is that homes adjacent to the street have lost value due to the noise level. 277 LETTER H H-1 H-2 H-3 H-4 Question: Is the city considering building a sound wall to or raising our community wall to mitigate the growing commercial and traffic noise issues. As the city grows and fills out, we feel that the pressure will increase from local residents to mitigate some of the impact. 5. The developer is anticipating up to 5 fast food restaurants and area residents are concerned about blowing trash. Question: What are the developer’s plans to mitigate this issue or will it reside with each fast food establishment? We would like some assurances that a plan is in place and responsibility assigned. 6. As we all know, there are many empty storefronts and restaurants in La Quinta. In addition to the 5 fast food restaurants, the plans call for two free standing bank branches (5,000 and 6,000 sq. feet) with drive-through windows. A report on NBC showed that big banks are still shuttering their locations. Citigroup closed 7 percent of North American branches year over year. And they are looking to take up less space. Technology is dramatically changing how they do business with the ability to do more transactions by computer and phone. We are concerned that this plan is overly ambitious and may wind up with empty commercial storefronts, obsolete bank buildings, and shuttered or less than desirable fast food alternatives. Question: How does the developer plan to roll out the build-out? In addition to the Pavilions market, gas station and convenience market, what other buildings will be built first? Will any other structures be built without a firm commitment from a store, restaurant or bank? What will the empty “pads” look like as we wait for the future commitments? We welcome the addition of the new. high quality grocery store. It will be an added benefit to those of us who live in the neighborhood. We just don’t want to live next to an empty shopping center or one that appears “failed” like others in the La Quinta community because they are overbuilt or not in demand (Sam’s Club, Ralph’s across from city hall, Jules, etc.) We are all proud to call La Quinta home and want it to reflect the appearance and values of our upscale community. 278 H-4 (cont.) H-5 H-6 April 23, 2017 Ken Hulbert, President Palmilla Homeowners Association ken.hulbert@daumcommercial.com SUBJECT: RESPONSE TO COMMENTS ON EA 2017-0006 PAVILION PALMS SHOPPING CENTER MITIGATED NEGATIVE DECLARATION Dear Mr. Hulbert: Thank you for your comments on the Mitigated Negative Declaration for the proposed Pavilion Palms Shopping Center. The comment letter has been marked and is attached. Responses are as follows: Comment H-1: The primary issue concerns location and the stacking capacity of the gas pumps. The gas station has the same number of dispensers as Costco, which implies sales of over 15,000 gallons per day. That translates into roughly 1,000 vehicles per day. However, the stacking design is not as long as the one at Costco that creates a potential bottleneck and interferes with the ingress and egress, thus backing up onto 50th Question: Can you explain your methodology and assumptions for the stacking lanes, especially during peak traffic times? We contend that the movement of the gas station 200 ft north on Jefferson can easily mitigate this issue. Response H-1: The proposed fuel center is not expected serve the needs beyond the immediate community and therefore will operate at significantly less volumes than the fuel center at Costco. As planned, there will be 12 pumping stations with the capacity for 12 additional cars in waiting, for a total of 24 car parked at any one time. Based on the proposed operator’s experience, the number of pumps and queue capacity are adequate to safely and conveniently handle expected volumes even at peak hours. Comment H-2: Also at issue are concerns regarding the ingress/egress to our community from our main traffic gate on 50th. The current gas station location will force drivers to exit onto west bound traffic onto 50th. We believe that 50% of the new west bound traffic will U-turn at the entry into Palmilla to travel back east or back to Jefferson. (Via Palmilla is our street name.) Question: What were your estimates of U-turn activity and how were they based? We disagree with the EIR assessment and feel that a “no U turn sign” on 50th at our main entrance would discourage this, encourage people to exit onto Jefferson and prevent problems with our access. 279 Response H-2: The project includes a full movement access point at the easterly driveway on Avenue 50. Vehicles exiting the shopping center on Avenue 50 would be able to turn left out of this driveway in order to go in the eastbound direction. There would be minimal U-turns at the Palmilla entrance on Avenue 50. Comment H-3: The EIR indicated that noise issues would be mitigated yet it didn’t address whether the fuel dispensers will have the small TV’s (audible devises) on top showing minute commercials. This noise travels differently than normal ambient noise. Our homeowners nearest to the gas pumps will be adversely impacted if this is the case. Question: Can we be assured that the gas pumps discussed will not have these screens? If they do, what measures will be taken to mitigate this issue? We feel strongly that this type of audible advertising is intrusive in residential adjacent areas and should not be allowed. Response H-3: Audible advertising devises are to be restricted from the pump island. Comment H-4: When our community was being built, Avenue 50 was a two-lane road. Yes, we knew it was going to be widened but the result is that homes adjacent to the street have lost value due to the noise level. Question: Is the city considering building a sound wall to or raising our community wall to mitigate the growing commercial and traffic noise issues. As the city grows and fills out, we feel that the pressure will increase from local residents to mitigate some of the impact. Response H-4: Avenue 50 has been designated as a 4-lane divided roadway in the City’s General Plan and is currently mostly built to this designation. The project would build out the rest of the roadway per the General Plan designation. A noise study was prepared for the project that evaluated the project’s noise impact on the area and was included in the Mitigated Negative Declaration. The existing ambient noise in the area which is generated from traffic along Jefferson Street and Avenue 50 is approximately 65 decibels. The noise study shows that the project would not generate noise levels in excess of this. The noise study does not show the need for additional sound walls or raising the Palmilla community wall. Additionally, the Mitigated Negative Declaration included mitigation measures to reduce noise impacts to less than significant levels. Mitigation Measures: NOI-1 It is recommended that the Pavilions delivery dock is enclosed with walls and a roof, and that an acoustically absorptive material is used to partially line the internal walls to control noise build up. This will limit potential disturbance from unloading. 280 NOI-2 Vehicle loading and unloading for all retail units should be carried out in a quiet manner. NOI-3 It is recommended that HVAC equipment on roofs is screened by a noise barrier from the residences. This barrier should at a minimum, provide line of sight screening. NOI-4 It is recommended that noisy HVAC equipment at grade is enclosed with CMU walls at least 2 feet higher than the equipment. NOI-5 It is recommended that noise from HVAC equipment is limited to 60 dB(A) at the site boundary. NOI-6 Reduce the noise from the audible devices for the drive-through eating establishments using any and/or all methods as follows: Position devices away from the site boundary to the south. x Provide additional screening such as positioning of the retail buildings or a noise barrier close to the device; x Reduce the number of audible devices, such as one device to serve two drive throughs; x Orient the device perpendicular to the vehicle and at ear height, with the device aimed at the listener in the vehicle; x The sound from the devices should be limited to a maximum of 75 dB(A) at 3 feet; x There shall be no annunciator tones, whistles, beeps or other characteristic sounds. NOI-7 Lay out the site working to keep noise-producing activities as far as possible from residences, minimize the use of backup alarms, and minimize truck activity and truck queuing near the residential areas. NOI-8 Perform construction in a manner to minimize noise where practicable. For example: x Where practicable, use hydraulic rather than pneumatic impact tools x Operate equipment to minimize banging, clattering, buzzing, and other annoying types of noises x Turn off idling equipment and vehicles x All internal combustion equipment shall be fitted with properly operating mufflers and air intake silencers x All stationary equipment shall be located as far as practical from adjacent potential residential units x Phase in start-up and shut-down of site equipment x Conduct truck loading, unloading and hauling operations to keep noise to a minimum 281 x Limit the time that steel decking or plates for street decking or covering excavated areas are in use x Limit the use of annunciators or public address systems, except for emergency notifications x All on-site deliveries shall be limited to between 7:00 a.m. to 10:00 p.m. Comment H-5: The developer is anticipating up to 5 fast food restaurants and area residents are concerned about blowing trash. Question: What are the developer’s plans to mitigate this issue or will it reside with each fast food establishment? We would like some assurances that a plan is in place and responsibility assigned. Response H-5: The project proposes up to 3 drive throughs which would not necessarily all be fast food restaurants. With this submittal, the applicant has not proposed any fast food drive through restaurants. The applicant has indicated that housekeeping to maintain first class standards will be incorporated within the CC & R’s. Comment H-6: As we all know, there are many empty storefronts and restaurants in La Quinta. In addition to the 5 fast food restaurants, the plans call for two free standing bank branches (5,000 and 6,000 sq. feet) with drive-through windows. A report on NBC showed that big banks are still shuttering their locations. Citigroup closed 7 percent of North American branches year over year. And they are looking to take up less space. Technology is dramatically changing how they do business with the ability to do more transactions by computer and phone. We are concerned that this plan is overly ambitious and may wind up with empty commercial storefronts, obsolete bank buildings, and shuttered or less than desirable fast food alternatives. Question: How does the developer plan to roll out the build-out? In addition to the Pavilions market, gas station and convenience market, what other buildings will be built first? Will any other structures be built without a firm commitment from a store, restaurant or bank? What will the empty “pads” look like as we wait for the future commitments? Response H-6: In addition to the market, fuel center and convenience market, the initial build-out will include Shops 1 along the north end of the development. In addition, all the infrastructure for the development including all perimeter street improvements, sidewalks and landscaping will be completed with the initial development. Any building area not included with the initial build-out will be treated with a dust control agent and dressed out with decorative ground cover. 282 Thank you for your participation in the public review process. Cheri L. Flores, Senior Planner City of La Quinta 283 !HJ;BUUU #:5LCU)U%BFJ5MU /5E<FKU,B1EE5JU #;OTUF6U)1U-P;EO1U,B1EE;E9U$5H1JOD5EOU U #1BB5U01DH;3FU )1U-P;EO1U#!UU $51JU*MU%BFK5MU ,C51M5UM55UO:5U6GCCFR<E9U3FDD5EOMUK591J4<E9UO:5U'/U 6FJUO:5U12FQ5U EFO54UHKF@53OU ! &5E5J1BU#FDD5EO 0:5U HK5H1K54U 'E;O;1BU /OP4TU;MU 1U 2;1M54U 4F3PD5EOUM<E35U <OU R1MU3FDD<MM<FE54U2TUO:5U 1HHB;31EOU1E4U;OU;MUFEBTU3FEM;45J;E9UO:5U144;O<FE1BU1HHJFS;D1O5UUI6OU O:1OU:1MU255EU 14454UOFUO:5UHJF?53OUM;E35UO:5U1HHKFQ1BUF6UO:5UFJ;9;E1BU/H53<6<3U,B1EU/,U;EU U ,B51M5U EFO5UO:1OUO:5U5EO;J5U HJF?53OU1E4U;OMU 3PDPC1O<Q5U;DH13OMUF6U2P;B4;E9U1U6PBBU M:FHH<E9U 35EO5JU M:1BBU 25U 3FEM;45KU M;E35U O:5U FJ;9;E1BU /,U R1MUHK5H1J54U<EU U R:5K5U O:5J5U R1MU EFU 45Q5BFHD5EOUR<O:;EUORFUUMIP1K5UD<C5UF6UO:5UHJF@53OUHB51M5UM55UO:5U#FPEOTUF6U .;Q5KM;45U &'/UD1HMU6JFDUUUUFJUM55U1OO13:54U " 0J18<3U#FDD5EOM "1M54UFEUO:5U'E<O<1CU /OP4TUO:5UOK18;3UMOP4TUR1MU4FE5U;EU(PE5UU1E4UO:5UOJ167;3UMOP4TU J565JMUOFUO:5UHJ5H1K1O;FEU41O5U1MU*1J3:UF6UUH195UUF6UOK167<3UMOP4TU #FBB53O;E9UO:5U OJ167<3U41O1U<EU (PE5U;MUEFOU133PJ1O5UM<E5U;OU;MUFPOM;45UF6UO:5UM51MFEU1E4U3FBB53O;E9UO:5UOJ167<3U 41O1U;EU+1J3:U;MU EFOU5;O:5JUM<E35U<OU<MU1OUO:5UO1<BU5E4UF6UO:5U M51MFEU 0:5UOK18;3U MOP4TU<MU21M54UFEU O:5U 6;JMOUM;O5UHB1EU O:1OU45C;E51O5MU1EU5S;OUFEU $5J5AU!CB5EU :FR5Q5KUO:5U6;E1BU M<O5UHB1EU 4F5MUEFOUM:FRU O:<MU5S<OU 0:5J56GJ5U O:5UOK18;3U MOP4TUE554MUOFU 25UPH41O54UOFUM:FRUR:5J5UO:5U 31JMUO:1OUFJ;9;E1BBTUR5J5UMPHHFN54UOFU5S;OU$5K5AU!BB5EU RFPC4U9FU R:1OU;MUO:5<KU ;DH13OUFEUO:5U FO:5KU4J;Q5R1TU1HHJF13:5MUOFU 1E4U 6KFDUO:5U M;O5 U 1E4UFEUO:5UFQ5K1BBUM<O5MU3;J3PB1O;FEU 0:5U4J<Q5U O:JPU6FJU 2P;B4<E9U EPD25JU ORFU UM:1CBU 25UJ545M;9EU 0:5U HJFHFM54U45M<9EUR;BCU EFOU RFJA U 0:5UOPJE;E9UK14<PMU;MU OFFUM:1JHU1E4UO:5U MH135U;MUQ5KTUB;D;O54 U O:5J56FJ5UO:5U 31J5MU E554U4FU1U O:J55 HF;EOUOPKEU1E4U 213AUPHU<EOFUO:5U D1<EU4J;Q5U 1<MC5U;EU FK45KUOFU 95OUOFU O:5U4J=Q5UO:JPU 0:>MUR;BBU3J51O5U1U M165OTUHJF2B5DU ,195U F6U 284 LETTER I I-1 I-2 ! *=:;P=G:\!HEE6GPO 1;6\O>P6\JLHJHO6O\ \ 7HHP\B>:<P\JHC6O \\ ?O\P<6\<6=:;P\H7\2\P;L66\ 2G5\;2C7\OPHLV\ 3Q=C5=G:\ 1;6\JLHJHO65\<6?:;P\>O\GHP\2446JP23B6\7HL\4HEE6L4=2B\46GP6MO\P;2P\2L6\23QPP>G:\ M6O=56GP=2C\G6=:;3HM;HH5O\ " ,H>O6\!HEE6GPO 1;6\GH>O6\OPQ5V\OP2P6O\P;2P\%P\=O\2OOQE=G:\P;2P\P;6\56R6CHJE6GP\T>BB\GHP\HJ6L2P6\P;LHQ:;\ P;6\G=:;P\J2:6\\H7\GH=O6\OPQ5V\1;>O\2OOQEJP=HG\>O\TLHG:\O=G46\32O65\HG\P;6\0J64=7=4\ -B2G\P;6\4HGR6G=6G46\OPHL6\T>BC\HJ6M2P6\7MHE\\2E\PH\\QGP>C\E>5G>:;P\1;6L67IM6\ P;6\JMHJHO65\E>P=:2P=HG\E62OQM6O\T=BB\GHP\E=P=:2P6\P;6\GH>O6\JHBCQP=HG\O=G46\P;6\E=P=:2P>HG\ E62OQL6O\HGCV\E2V\M65Q46\P;6\GH=O6\5QM>G:\52V\2G5\GHP\255L6OO=G:\P<6\GH=O6\5QL=G:\ G=:;P \ 1;6\GH=O6\52P2\T2O\4HCC64P65\8LHE\\JE\PH\\JE\HG\+2V\\\J2:6\\H7\,H=O6\ 0PQ5V\1<6\52P2\P23B6\\J2:6\\H8\,H>O6\0PQ5V\>G5=42P6O\P;2P\P;6\GH>O6\C6R6C\6U4665O\ \53\JC62O6\GHP6\\53\?O\P;6\2446JP23B6\GH=O6\C6R6C\9L\O6GO?P>R6\C2G5\QO6O\OQ4;\2O\ M6O>56GP=2C\QO6O\ #R6G\T>P;\2JJDV?G:\P;6\E=P?:2P65\E62OQL6O\P<6\GH=O6\C6R6C\T=BB\6U4665\ 2446JP23C6\GH>O6\C6R6C\\53 \8HL\O6GO=P=R6\QO6O\OQ4<\2O\L6O?56GP>2B\QO6O\ CB\23HR6\GHP65\=OOQ6O\T=CB\=EJ24P\HG\P;6\;62BP;\2G5\P;6\KQ2B>PV\H8\C=86\H8\P;6\J6HJC6\B>R>G:\ 25@246GP\PH\P;6\JLHJHO65\!6GP6L\ 1;6M67HM6\ &\L6OJ64P7QCBV\M6KQ6OP\P;6\!?PV\PH\M6OJHGO6\ PH\ EV\ 4HEE6GPO\2G5\J6M;2JO\ QJ52P6\ P;6\23HR6\GHP65\ OPQ5=6O\ PH\ L67C64P\ P;6\ 24PQ2C\ O>PQ2P=HG\ 0;HQC5\VHQ\<2R6\2GV\KQ6OP=HGO\JB62O6\766B\8M66\PH\4HGP24P\E6\ 0>G46L6CV\ )Y=Z[\ \ B=\!P\ *2\.Q>GP2\! \\ C6=D2G2FS2LW2<HH4HE\ !4\*=G52\#R2GO\+2VHM\H7\)2\.Q=GP2\ (2P;B66G\$?PXJ2PL=4A\+2VHL\-LH\16N\ 'H<G\-6G2\!HQG4?B\+6E36L\ /H336L\/25=\!HQG4>D\+6E36M\ 0P6R6\02G4<6X\!HQG4=C\+6E36M\ -2:6\\H7\\ 285 I-3 I-4 286 287 288 289 April 23, 2017 Leila Namvar 49590 Ali Ct La Quinta, CA 92253 leilanamvar@yahoo.com SUBJECT: RESPONSE TO COMMENTS ON EA 2017-0006 PAVILION PALMS SHOPPING CENTER MITIGATED NEGATIVE DECLARATION Dear Leila: Thank you for your comments on the Mitigated Negative Declaration for the proposed Pavilion Palms Shopping Center. The comment letter has been marked and is attached. Responses are as follows: Comment I-1: The prepared Initial Study is a biased document, since it was commissioned by the applicant and it is only considering the additional (approximate) 20,000 q.ft. that has been added to the project, since the approval of the original Specific Plan (SP) in 1999. Please note that the entire project and its cumulative impacts of building a full shopping center shall be consider, since the original SP was prepared in 1999, where there was no development within two (2) square mile of the project (please see the County of Riverside GIS maps from 1996 & 2011 or see attached). Response I-1: The Lead Agency determined that it was appropriate to consider the additional square footage added to the project as allowed by CEQA Section 15162 regarding subsequent environmental analysis. Since the project has already been approved previously and no substantial changes to the project were proposed, the analysis of the additional square footage was appropriate. Cumulative impacts were based on the analysis of the City’s 2035 General Plan since the project site is zoned and general planned for commercial use; therefore, the project would have been considered in the General Plan EIR. Comment I-2: Based on the Initial Study the traffic study was done in June 2017, and the traffic study refers to the preparation date as March of 2017 (page 14 of traffic study). Collecting the traffic data in June is not accurate, sine it is outside of the season and collecting the traffic data in March is not either, since it is at the tail end of the season. The traffic study is based on the first site plan that delineates an exit on Derek Allen; however, the final site plan does not show this exit. Therefore, the traffic study needs to be updated to show where the cars that "originally" were supposed to exit Derek Allen would go, what is their impact on the other driveway approaches (to and from the site), and on the overall site's circulation. 290 The drive thru for building number two (2) shall be redesign. The proposed design will not work. The turning radius is too sharp and the space is very limited; therefore, the cares need do a three-point turn and back up into the main drive aisle in order to get to the drive thru. This will create a safety problem. Response I-2: The Mitigated Negative Declaration discussed the impacts of the closure of the Derek Alan Drive driveway. The closure has little to no impact on-site circulation or on- street circulation/access. A limited number of residents living in the surrounding residential neighborhood would be impacted by the closure since they would have to drive on arterial streets (Jefferson St. and Avenue 50) to access the project rather than being able to access the project directly from Derek Alan Drive. Regarding on-street circulation, it is unlikely that northbound Jefferson Street motorists destined to the Shopping Center would drive past the left-turn access driveway on Jefferson Street to turn on to Derek Alan Drive only to have to make another left-turn into the site. Likewise, it is unlikely that southbound Jefferson Street traffic would turn right in large numbers on to Derek Alan Drive in order to make a sharp left-turn to enter the far corner of the Shopping Center when they can just continue straight on Jefferson and make a right-turn at one of the other project driveways closest to their destination within the Center. The applicant will be conditioned to redesign the entry to the drive thru at Building 2. The plan does meet the minimum driveway width required of 12 ft. Comment I-3: The site proposes 14, 40-foot light poles. 40' is the height of a three and half story building. The proposed height is not acceptable for commercial centers that are abutting residential neighborhoods. Response I-3: The site is zoned for Community Commercial use which allows a maximum building height of 40 ft. The parking lot design standards in Municipal Code Section 9.150.100 state that light poles in the parking areas are allowed to be the same height as allowed in the underlying zone or 18 ft., whichever is greater. The light poles would be allowed to be 40 ft. per this section of the code. Additionally, the lighting plan for the project shows that there would be no light spillage onto surrounding properties. Comment I-4: The noise study states that: "It is assuming that the development will not operate through the night" (page 3 of noise study). This assumption is wrong, since based on the Specific Plan the convenience store will operate from 5:00 am to 12:00 (until midnight). Therefore, the proposed mitigation measures will not mitigate the noise pollution, since the mitigation measures only may reduce the noise during day and not addressing the noise during night. The noise data was collected from 4:50 pm to 5:50 pm on May 30, 2017 (page 5 of Noise Study). The data (table 2, page 9 of Noise Study) indicates that the noise level exceeds 50 db. (please note 50 db. is the acceptable noise level for sensitive land uses such as residential uses). Even with applying the mitigated measures, the noise level will exceed acceptable noise level (50 db.) for sensitive uses such as residential uses. 291 Response I-4: The City’s Noise Ordinance shows that normal acceptable levels in residential areas are up to 60 dB. Noise limits are 65 dBA from 7 am to 10 pm. The hours of operation for the fuel center would be 7 a.m. to 10 p.m. The projected noise levels from the shopping center would not exceed the normal acceptable levels of 60 dBA or the noise limits in the City’s ordinance of 65 dBA. Additionally, the Mitigated Negative Declaration incorporated mitigation measures to reduce noise impacts to less than significant levels. Mitigation Measures: NOI-1 It is recommended that the Pavilions delivery dock is enclosed with walls and a roof, and that an acoustically absorptive material is used to partially line the internal walls to control noise build up. This will limit potential disturbance from unloading. NOI-2 Vehicle loading and unloading for all retail units should be carried out in a quiet manner. NOI-3 It is recommended that HVAC equipment on roofs is screened by a noise barrier from the residences. This barrier should at a minimum, provide line of sight screening. NOI-4 It is recommended that noisy HVAC equipment at grade is enclosed with CMU walls at least 2 feet higher than the equipment. NOI-5 It is recommended that noise from HVAC equipment is limited to 60 dB(A) at the site boundary. NOI-6 Reduce the noise from the audible devices for the drive-through eating establishments using any and/or all methods as follows: Position devices away from the site boundary to the south. x Provide additional screening such as positioning of the retail buildings or a noise barrier close to the device; x Reduce the number of audible devices, such as one device to serve two drive throughs; x Orient the device perpendicular to the vehicle and at ear height, with the device aimed at the listener in the vehicle; x The sound from the devices should be limited to a maximum of 75 dB(A) at 3 feet; x There shall be no annunciator tones, whistles, beeps or other characteristic sounds. NOI-7 Lay out the site working to keep noise-producing activities as far as possible from residences, minimize the use of backup alarms, and minimize truck activity and truck queuing near the residential areas. NOI-8 Perform construction in a manner to minimize noise where practicable. For example: x Where practicable, use hydraulic rather than pneumatic impact tools 292 x Operate equipment to minimize banging, clattering, buzzing, and other annoying types of noises x Turn off idling equipment and vehicles x All internal combustion equipment shall be fitted with properly operating mufflers and air intake silencers x All stationary equipment shall be located as far as practical from adjacent potential residential units x Phase in start-up and shut-down of site equipment x Conduct truck loading, unloading and hauling operations to keep noise to a minimum x Limit the time that steel decking or plates for street decking or covering excavated areas are in use x Limit the use of annunciators or public address systems, except for emergency notifications x All on-site deliveries shall be limited to between 7:00 a.m. to 10:00 p.m. Thank you for your participation in the public review process. Cheri L. Flores, Senior Planner City of La Quinta 293 DH:=S S S !.S'K:BJ.S 9JOSCKB0:>S.B1S%>.BB9B6SC@@9II9CBS !.S'K:BJ.S:JOS .=?S S.??3S+.AD:0CS!.S(K:BJ.S.=:4CHB:.S !.2:3IS.B2S3BJ=3A3BS +8.B<SOCKS4CHSJ83SCDDCHJKB:JOSJCSDHCL:23S4332/.0<SCBSJ83SDHCDCI32S&.L:=:CBS &.?AIS 23L3?CDA3BJS ?C0.J32S.JSJ83S #CHJ8M3IJS0CHB3HSC4SL3BK3SS .B2S 3443HICBSIS:JS:IS0KHH3BJ?OS23I:6B32SJ83S 13L3?CD@3BJSM:??S.2L3HI3?OS.4430JSJ83SB3:68/CH:B6S0CAAKB:J:3ISC4S&.?A:??.S)3B.:II.B03S"CKBJ.:BS ,:3MS:JHKIS.B2S IJ.B0:.S +83SD?.BSI8CK?1SKB13H6CS0?CI3SI0HKJ:BOS.B1S3NJ3BI:L3S@C1:4:0.J:CBSJCS @:B:A:Q3SBC:I3S?:68JS.B1S.:HSDC??KJ:CBS.ISM3=?S.ISJH.44:0S.B2SJ3?30C@@KB:0.J:CBISCL3H=C.1S JS.SA:B:AK@S J83S4K3?S03BJ3H @:B:S@.HJS.B2S2H:L3SJ8HCK68S/K:?2:B6ISI8CK?2S/3S3?:A:B.J32S4HCAS J83SD=.BIS4CHSI3L3H.?SH3.ICBIS #C:I3?:78JSEC??KJ:CB.:HSFK.?:JPS R !:68JSDC??KJ:CBS4HC@SJ83SS8CKHSCD3H.J:CBSC4S.S4K3?S03BJ3H R #C:I3S?3L3?IS4HC@S:BJ3H0C@IS.B2S2H:L3SJ8HCK68SI3HL:03SM:B2CMI R $44S8CKHS .B2S4H3GK3BJS13?:L3H:3ISJCS.S?.H63S&.L:?:CBIS@.H<3JS.B1SH3IJ.KH.BJISM:=?S0.KI3 0CBJ:BKCKIS2:IJKH/.B03IS4CHSJ83S.1;.03BJSH3I:23B03I R A:II:CBIS4HC@S4.IJS4CC2SH3IJ.KH.BJIS.B2S0.HIS:2?:B6S.JS2H:L3SJ8HCK68SI3HL:03SM:B2CMISM:=? 1:A:B:I8SJ83S.:HSGK.?:JO +H.44:0J3=30C@AKB:0.J:CBSCL3H=C.2S R L3SS.B2S 3443HICBS:BJ3HI30J:CBS:IS.=H3.2OS83.L:?OSJH.L3?32S.B2SJ83S.22:J:CBSC4SS0.HISM:?= 0H3.J3S.BSKBI.43SJH.44:0S36H3IIS2K3SJCSJ83SDCCH=OSD=.BB32S?C0.J:CBSC4SJ83S4K3?S03BJ3H R +83H3S:ISBCSJH.BI:JSIJCDSB3.H/OS.B1SL38:0K?.HSJH.45:0SM:??S:BJ3BI:4O R CJ8SL3BK3SS.B2S 3443HICBS.H3SA.:BS.003IISHCKJ3IS1KH:B6S43IJ:L.=SI3.ICBS.B2S3L3BJISM:J8 8:68SJH.44:0S0CB63IJ:CB R N:IJ:B6SJ3?30CA@KB:0.J:CBSI3HL:03S:BSJ8:ISD.HJSC4S!.S(K:BJ.S:IS .B2SACH3 23L3=CD@3BJSM:?=S.22SJCS.BS3N:IJ:B6SDHC/?3@ S!*JO?3SIJH:DS@.=?SC4SJ8:ISA.6B:JK23S.JSJ8:IS?C0.J:CBS2:A:B:I83ISDHCD3HJOSL.?K3IS.B2S2C3ISBCJS JHK?OS4:JSJ83SIA.??SJCMBS!.S(K:BJ.S=:43IJO?3SS23L3=CD@3BJSM:J8S.SL:??.63SL:/3S.B2S4.H@3HIS@.H<3JS IJO?3S.A3B:J:3ISMCK?2S /3JJ3HSIK:JSJ83SB331IS.B1S.3IJ83J:0ISC4SJ83S0C@@KB:JOS -:J8SICS@K08SL.0.BJS0CAA3H0:.?SID.03SM:J8:BSJ83S0:JOSC4S!.S(K:BJ.SM3SH3GK3IJSJ8.JSJ83S&=.BB:B6S C@A:II:CBSI:6B:4:0.BJ?OS2CMBI:Q3SJ8:ISDHCDCI32S23L3?CDA3BJS.B1S<33DS?.H63SI0.?3S0CAA3H0:.?S 13L3=CDA3BJISM:J8:BSJ83S :68M.OS -.I8:B6JCBS*JH33JS0CHH:2CHIS +8.B<SOCKS4CHSOCKHS0CBI:23H.J:CBS )C/3HJS!S 6S S,:.SA.BJ3S !.S(K:BJ.S SS 294 LETTER J J-1 J-2 April 23, 2017 Robert and Marilyn Lang 50460 Via Amante La Quinta, CA 92253 SUBJECT: RESPONSE TO COMMENTS ON EA 2017-0006 PAVILION PALMS SHOPPING CENTER MITIGATED NEGATIVE DECLARATION Dear Mr. and Ms. Lang: Thank you for your comments on the Mitigated Negative Declaration for the proposed Pavilion Palms Shopping Center. The comment letter has been marked and is attached. Responses are as follows: Comment J-1: Noise/light pollution/air quality • Light pollution from the 24 hour operation of a fuel center. • Noise levels from intercoms and drive through service windows. • Off hour and frequent deliveries to a large Pavilions market and restaurants will cause continuous disturbances for the adjacent residences. • Emissions from fast food restaurants and cars idling at drive through service windows will diminish the air quality. Response J-1: Impacts from noise, light pollution and air quality were considered in the project’s Mitigated Negative Declaration. The fuel center operating hours will be limited to the hours of 7 a.m. to 10 p.m. Additionally, the project’s lighting plan shows that there would be no light spillage onto surrounding properties. Mitigation measures will be implemented during project construction and operations to reduce impacts to less than significant levels. Mitigation Measures: NOI-1 It is recommended that the Pavilions delivery dock is enclosed with walls and a roof, and that an acoustically absorptive material is used to partially line the internal walls to control noise build up. This will limit potential disturbance from unloading. NOI-2 Vehicle loading and unloading for all retail units should be carried out in a quiet manner. NOI-3 It is recommended that HVAC equipment on roofs is screened by a noise barrier from the residences. This barrier should at a minimum, provide line of sight screening. NOI-4 It is recommended that noisy HVAC equipment at grade is enclosed with CMU walls at least 2 feet higher than the equipment. 295 NOI-5 It is recommended that noise from HVAC equipment is limited to 60 dB(A) at the site boundary. NOI-6 Reduce the noise from the audible devices for the drive-through eating establishments using any and/or all methods as follows: Position devices away from the site boundary to the south. x Provide additional screening such as positioning of the retail buildings or a noise barrier close to the device; x Reduce the number of audible devices, such as one device to serve two drive throughs; x Orient the device perpendicular to the vehicle and at ear height, with the device aimed at the listener in the vehicle; x The sound from the devices should be limited to a maximum of 75 dB(A) at 3 feet; x There shall be no annunciator tones, whistles, beeps or other characteristic sounds. NOI-7 Lay out the site working to keep noise-producing activities as far as possible from residences, minimize the use of backup alarms, and minimize truck activity and truck queuing near the residential areas. NOI-8 Perform construction in a manner to minimize noise where practicable. For example: x Where practicable, use hydraulic rather than pneumatic impact tools x Operate equipment to minimize banging, clattering, buzzing, and other annoying types of noises x Turn off idling equipment and vehicles x All internal combustion equipment shall be fitted with properly operating mufflers and air intake silencers x All stationary equipment shall be located as far as practical from adjacent potential residential units x Phase in start-up and shut-down of site equipment x Conduct truck loading, unloading and hauling operations to keep noise to a minimum x Limit the time that steel decking or plates for street decking or covering excavated areas are in use x Limit the use of annunciators or public address systems, except for emergency notifications x All on-site deliveries shall be limited to between 7:00 a.m. to 10:00 p.m. Comment J-2: Traffic/telecommunication overload • Ave 50 and Jefferson intersection is already heavily traveled and the addition of 300+ cars will create an unsafe traffic egress due to the poorly planned location of the fuel center 296 • There is no transit stop nearby and vehicular traffic will intensify. • Both Avenue 50 and Jefferson are main access routes during festival season and events with high traffic congestion. • Existing telecommunication service in this part of La Quinta is already suboptimal and more development will add to an existing problem. Response J-2: The proposed project has been planned for in the City’s General Plan and was factored into the growth projections of the General Plan. The Mitigated Negative Declaration evaluated traffic impacts and incorporated Mitigation Measure TRAF-1 to reduce traffic impacts. Mitigation Measure TRAF-1: Prior to recordation of the Final Tentative Parcel Map, the Applicant shall enter into an agreement with the City of La Quinta and post security to design and construct at the intersection of Avenue 50 and Jefferson Street two eastbound left turn lanes on Avenue 50 to northbound Jefferson Street if required by the Planning Commission. Additionally, the City continuously coordinates with Sunline Transit Agency to identify opportunities for transit stop locations. At this time, no transit stops are needed, however, that may change in the future. Telecommunication services are continuously being updated as available. Thank you for your participation in the public review process. Cheri L. Flores, Senior Planner City of La Quinta 297 April 20, 2018 La Quinta – Renaissance Cheri L. Flores clflores@la-quinta.org Senior Planner City of La Quinta Planning Department 78495 Calle Tampico La Quinta, CA 92253 Dear Ms. Flores, As a resident of Renaissance at La Quinta, please accept my respectful opposition of the proposed Pavilion Palms Development on the corner of Jefferson and Ave 50 th. Although I appreciate the right of the builder to develop his commercially zoned property, I strongly oppose to the type of use and the potential negative impact on those neighborhoods surrounding the project as well as the City of La Quinta as a whole. The City of La Quinta’s General Plan 2035, among other things, aims to reduce air pollution and greenhouse gasses, to provide high quality community design, to promote efficient use of car, to advocate for expansion of other non-motorized means of transportation, to encourage transportation options that do not rely as much on the automobile, and to improve the health of residences by promoting healthy living practices. The proposed commercial project is upsettingly auto oriented. It is more suitable for the I-10 corridor or Highway 111, not a neighborhood community. The project (among other retail uses) is proposing 2 drive-thru fast food facilities, a late night gas station and mini mart selling alcoholic beverages similar to that proposed on the corner of Washington and avenue 50 a few years back, which was not approved. I do not believe you will find any type of similar development with a gas station, mini mart and fast food drive-thru restaurants off of the Hwy 111 corridor in La Quinta. I don’t believe this location should be the first for our beautiful City or neighbors. Concerns from our neighbors as it relates to noise, increased traffic and its impact on air quality; lighting from a late night gas station, minimart and fast food restaurants; possible increase in crime and an impacted view of the Santa Rosa Mountains are just a few reasons this project should be removed from consideration. Also, as we understand from our April 11th meeting which the developer himself attended, the proposed project does not meet the approved requirements in regards to square footage and density. As a result, an amendment to the approved additional environmental review is needed. 298 K-1 LETTER K Please note the developer has a shopping center within the City of Indio (Showcase at Indio Shopping Center). That center is not being maintained properly. The center is full of trash and debris, with vacant dirt pads that are partially covered with weeds. The trash enclosures are dirty and full of trash. The buildings’ paint is faded and 30% of the parking lot trees are either missing or dead. There are shops with boarded and broken windows. It should also be noted that the Center has not been completed since its approval on 2006 and there are still several empty pads including an empty anchor, Super Target, which closed over a year ago. During our meeting with the Developer on Wednesday April 11 th, he stated that he only has the Pavilions committed and once again we could end up with the same scenario as indicated above. Less than half occupied and dying landscape. We already have this at the closed Sam’s club location. An empty warehouse, closed gas station and dying landscape. I would like to add that approving this project, the way it has been proposed, will be a huge missed opportunity for the City of La Quinta and the community as whole. The Applicant does not live in our City or even in the Valley. The Applicant owns a great piece of commercial real estate in La Quinta and plans to build it for financial gain “ONLY”, without paying attention to the City’s General Plan and/or basic elements of urban planning. I find this project to be a public health and safety risk for the citizens and visitors of the great City of La Quinta. I do encourage you to review this proposal thoroughly and reject it to be re-designed and to conform to the City’s General Plan. Should you have any questions please feel free to contact me directly. Respectfully, Steven Cenicola 79963 Julee court La Quinta, CA. 92253 scenicola@thevintageclub.com Cc: Linda Evans, Mayor of La Quinta Kathleen Fitzpatrick, Mayor Pro Tem Avail Property Management 299 April 23, 2017 Steve Cenicola 79963 Julee Court La Quinta, CA 92253 SUBJECT: RESPONSE TO COMMENTS ON EA 2017-0006 PAVILION PALMS SHOPPING CENTER MITIGATED NEGATIVE DECLARATION Dear Mr. Cenicola: Thank you for your comments on the Mitigated Negative Declaration for the proposed Pavilion Palms Shopping Center. The comment letter has been marked and is attached. Responses are as follows: Comment K-1: Concerns from our neighbors as it relates to noise, increased traffic and its impact on air quality; lighting from a late night gas station, minimart and fast food restaurants; possible increase in crime and an impacted view of the Santa Rosa Mountains are just a few reasons this project should be removed from consideration. Response K-1: The Mitigated Negative Declaration evaluated impacts regarding noise, traffic, air quality and lighting. Regarding noise, hours of operation in the center would be limited to 7 a.m. to 10 p.m. A noise study was prepared for the project that evaluated the project’s noise impact on the area and was included in the Mitigated Negative Declaration. The existing ambient noise in the area which is generated from traffic along Jefferson Street and Avenue 50 is approximately 65 decibels. The noise study shows that the project would not generate noise levels in excess of this. Additionally, the Mitigated Negative Declaration included mitigation measures to reduce noise impacts to less than significant levels. Mitigation Measures: NOI-1 It is recommended that the Pavilions delivery dock is enclosed with walls and a roof, and that an acoustically absorptive material is used to partially line the internal walls to control noise build up. This will limit potential disturbance from unloading. NOI-2 Vehicle loading and unloading for all retail units should be carried out in a quiet manner. NOI-3 It is recommended that HVAC equipment on roofs is screened by a noise barrier from the residences. This barrier should at a minimum, provide line of sight screening. NOI-4 It is recommended that noisy HVAC equipment at grade is enclosed with CMU walls at least 2 feet higher than the equipment. 300 NOI-5 It is recommended that noise from HVAC equipment is limited to 60 dB(A) at the site boundary. NOI-6 Reduce the noise from the audible devices for the drive-through eating establishments using any and/or all methods as follows: Position devices away from the site boundary to the south. x Provide additional screening such as positioning of the retail buildings or a noise barrier close to the device; x Reduce the number of audible devices, such as one device to serve two drive throughs; x Orient the device perpendicular to the vehicle and at ear height, with the device aimed at the listener in the vehicle; x The sound from the devices should be limited to a maximum of 75 dB(A) at 3 feet; x There shall be no annunciator tones, whistles, beeps or other characteristic sounds. NOI-7 Lay out the site working to keep noise-producing activities as far as possible from residences, minimize the use of backup alarms, and minimize truck activity and truck queuing near the residential areas. NOI-8 Perform construction in a manner to minimize noise where practicable. For example: x Where practicable, use hydraulic rather than pneumatic impact tools x Operate equipment to minimize banging, clattering, buzzing, and other annoying types of noises x Turn off idling equipment and vehicles x All internal combustion equipment shall be fitted with properly operating mufflers and air intake silencers x All stationary equipment shall be located as far as practical from adjacent potential residential units x Phase in start-up and shut-down of site equipment x Conduct truck loading, unloading and hauling operations to keep noise to a minimum x Limit the time that steel decking or plates for street decking or covering excavated areas are in use x Limit the use of annunciators or public address systems, except for emergency notifications x All on-site deliveries shall be limited to between 7:00 a.m. to 10:00 p.m. Regarding traffic and air quality, Mitigation Measures will be implemented to reduce impacts to less than significant levels. 301 Mitigation Measure TRAF-1: Prior to recordation of the Final Tentative Parcel Map, the Applicant shall enter into an agreement with the City of La Quinta and post security to design and construct at the intersection of Avenue 50 and Jefferson Street two eastbound left turn lanes on Avenue 50 to northbound Jefferson Street if required by the Planning Commission. Mitigation Measures: Fairway Plaza Amendment 1 - Resolution 2002-006: x All construction equipment shall be maintained in good operating condition, and shall be properly serviced and repaired as needed. ࿕ x Prior to the issuance of the first grading permit, the project proponent shall demonstrate, or cause to be demonstrated to the Community Development Department that all construction equipment to be utilized shall be low emission, or how the use of low emission construction equipment is infeasible. x Low VOC paints, primers and coatings shall be required for all buildings on the project site. All paints shall be applied using either a high volume/low pressure spray or by hand. x The proposed project shall provide a bus turnout, shelter and associated improvements on Jefferson Street and on Avenue 50, unless Sunline Transit provides written confirmation-that no such turnout(s) or shelters are needed. x As required by the Municipal Code, the businesses operating within the proposed project shall conform to the Transportation Demand Management requirements in place at the time they begin operation. x Deliveries to the project site shall occur during off-peak periods. Mitigation Measures: AIR-1: Contractor is to implement at a minimum a 10-day painting schedule. AIR-2: To the extent feasible, project applicant shall use paints and coatings with a VOC content lower than SCAQMD Rule 1113 requires or more stringent standards if in place at the time development occurs. (added per request by South Coast Air Quality Management District) AIR-3: In accordance with California Air Resources Board’s idling policy guidelines, no delivery vehicles may idle for more than five consecutive minutes. (added per request by South Coast Air Quality Management District) Additionally, a lighting plan has been designed to result in no light spillage onto surrounding properties. Comment K-2: Also, as we understand from our April 11th meeting which the developer himself attended, the proposed project does not meet the approved requirements in regards to square footage and density. As a result, an amendment to the approved additional environmental review is needed. Response K-2: The applicant has prepared a Specific Plan Amendment and updated Mitigated Negative Declaration for the proposed project which addresses the increase in 302 square footage. The Mitigated Negative Declaration was circulated for public review March 23, 2108 through April 23, 2018. Additionally, the maximum Floor Area Ratio (FAR) allowed under the Community Commercial Zone is 0.30, which would allow up to approximately 162,000 square feet. The project proposes approximately 122,000 square feet, which results in a FAR of 0.22. Thank you for your participation in the public review process. Cheri L. Flores, Senior Planner City of La Quinta 303 e"^-G@0e:6K0ce SWEIg gg B8WEg!IOW8[g,8LEOWg 'I0LL8Wg E\egO9g$0g)^EL\0g g 0II8g.0JSE3Og $0g)^EL\0ggg + g '0aEIEOLg'0IJ[g 80Wg %[g B8WEg!IOW8[g $'e 4X6WeL ]e 'PTDK9Ye !*GIe'QTCK9Xe *];63VGe<]de %*K.;Me=U,96e !*GIe4Z4S]e K1>*Ke)7FEXe *e#^>K]*e K1BOe L*/;6HF*e &5U\?16eL_K]de /BE[g I8\\8WgW8[SOL5[g\Og eO^Wg W8V_8[\g 9PWg 3OJJ8L\[g W8@1W5EL@g \B8gSWOSO[85g '0aEIEOLg ' 0 I J [ g IO30\85gOMg\B8g LOW\Bc8[\g 3OWL8WgO9g#8<8W[OLg,\W88\g 0L5g a8L^8gg cE\BELg \B8g$0g *^EL\0g.B8g ,^L$EL8g .W0L[E\g @8L3eg ,^L$EL8g [\0=g B0[g W8aE8c85g \B8g SWOF83\g 0L5g O 9 ; 8 W [ g \ C 8 g 9PIIOcEL@g 3OJJ8L\[g ,^L$EL8g [\0>[g 0[[8[[J 8L\g 3OL3I_58[g \B8g SWOSO[85g SWOG83\g c E I I g B 0 a 8 g L O g EJS03\gOLg \ W 0 L [ E \ g [8XbE48[g (I80[8g H88Sg [\0=gEM?XJ86gO9g1Mfg 0TSXQa0I[g0N6OWg 9_]`W8g 3B0LA8[g\Og ]D8gSZRUO[86g SWOF83\g[Ogc8g30Lg H88Sg0IIg 8dE[\EL@g 2^[g[\OS[g 0L5g [8WbE48[gWO_\8[g 3_WW8L\g 5 6 E \ EOL0IIegE9g \B8W8g E[g0gL885g :PWg\W0L[E\g [8WaE38g0L5 OWg \W0L[E\g0J8LE\E8[gELg\B8g:_\^W8g,^L$EL8 g[\0=gcEIIg 3OOW5EL0\8gE\g cE\Bg\B8g E\egO9g$0g)^EM\0 g ,BO^I7geO_g B0a8g V_8[\EOL[gOWg 3OL38WL[gW8@0W5EL@g \BE[g I8\\8WgSI80[8g 3OL\03\gJ8g0\g g8d\ gg .W0L[E\gOJK^LE40\EOL[g ,8WaE38g ,S83E0IE[\g 33g $0^Y8Lg,HEa8Wg"8M8W0Ig&0L0@8Wg ,\8SB0LE8g-^WE8Ig 8S^\egBE89gO9g5JELE[\W0\EOLg e +RRce G@`6 Re(R+@Ge (;N^[+K2e "+GJ[e +G@8NSK@+e e ";NK6e e +be e aaa[^KGAK6NR:e304 L-1 LETTER L April 23, 2017 Anita Petke, Transit Communications Service Specialist 32-505 Harry Oliver Trail Thousand Palms, CA 92276 SUBJECT: RESPONSE TO COMMENTS ON EA 2017-0006 PAVILION PALMS SHOPPING CENTER MITIGATED NEGATIVE DECLARATION Dear Anita: Thank you for your comments on the Mitigated Negative Declaration for the proposed Pavilion Palms Shopping Center. The comment letter has been marked and is attached. Responses are as follows: Comment L-1: SunLine staff’s assessment concludes the proposed project will have no impact on transit services. Please keep staff informed of any approvals and/or future changes to the proposed project so we can keep all existing bus stops and services routes current. Additionally, if there is a need for transit service and/or transit amenities in the future, SunLine staff will coordinate it with the City of La Quinta. Response L-1: Thank you for your comments. The City will continue to work with Sunline on transit service coordination. Thank you for your participation in the public review process. Cheri L. Flores, Senior Planner City of La Quinta 305 Revisions in Response to Comments Received Revisions have been made to the text of the Draft MND in response to comments received during the public review period from South Coast Air Quality Management District regarding air quality mitigation measures and in response to revisions in the traffic study. The added air quality mitigation measures reflect typical practices that have been updated since the previous MND was certified in 1999. The addition of this text does not constitute a substantial revision per Section 15073.5 (c)(1) of the CEQA Guidelines. All revisions to the Draft EIR are done with new text being underlined, and deleted text stricken through. Text to be added to Section 1 Introduction, page 1: July 2019 Revision Note: An additional traffic study was conducted at the request of the City. The results are included in Appendix F and Section XVI. The results of the study revealed no additional impacts. Text to be added to Section 4-III Air Quality, Mitigation Measures, page 25 and to Section 5, Summary of Mitigation Measures, page 80: AIR-2: To the extent feasible, project applicant shall use paints and coatings with a VOC content lower than SCAQMD Rule 1113 requires or more stringent standards if in place at the time development occurs. AIR-3: In accordance with California Air Resources Board’s idling policy guidelines, no delivery vehicles may idle for more than five consecutive minutes. Text to be added to Section 4-XVI Transportation/Traffic, page 69: An updated traffic study was completed in July 2019 per the request of the City to study additional intersections (Appendix E). The 2017 Traffic Study studied the intersection of Jefferson Street and Avenue 50. The 2019 Traffic Study analyzed the following intersections: x Jefferson Street at Avenue 48 x Jefferson Street at Avenue 49 x Avenue 50 at Park Avenue x Jefferson Street at Avenue 50 x Avenue 50 at Madison Street x Jefferson Street at Pomelo 306 x Jefferson Street at Avenue 52 x Jefferson Street at N project driveway x Avenue 50 at E project driveway To analyze the “existing conditions + project traffic” scenario, the expected project trips were added to the existing traffic volumes at the study intersections according to the anticipated project trip distribution, while the pass-by project trips are added back into the traffic volumes only at the project driveways. Additional traffic from a planned expansion of the existing Citrus Plaza, located across Jefferson Street from the proposed Project site, was also added to the opening day traffic volumes, based on project details obtained from the applicant developer and City of Indio staff, to ensure cumulative traffic impacts were analyzed. The 2019 Traffic study identified that all of the Project intersections operate at a similar level of service, with the Project or without the Project, and including ambient growth and growth from the neighboring Citrus Plaza. Text to be revised in Section 4-XVI Transportation/Traffic, page 71: The July 2017 traffic study indicated that without the project, the intersection of Jefferson Street and Avenue 50 will operate at LOS D, assuming a 2 percent ambient growth rate in the area (Albert Grover and Associates, July 27, 2017, Appendix E, Table 3). Assuming the ambient area growth, plus the new expected project trips, as well as the additional westbound through lane capacity, and implementation of Mitigation Measure TRAF-1 and project improvements listed above, the intersection of Jefferson Street and Avenue 50 is expected to operate at its current LOS D, which is an acceptable level of service per the General Plan and EB 06-13., and the proposed full-access driveway on Avenue 50 will operate at LOS A at opening day conditions. However, some delays are expected for vehicles entering traffic on Jefferson Street and Avenue 50 from the project driveways, which are expected to operate at LOS E during the PM peak hour. Per EB 06-13, however, this is considered acceptable traffic operations conditions for a stop control at a driveway location. Therefore, the impact of this criterion is anticipated to be less than significant with mitigation. The results of the 2019 Traffic Study identified that all the additional intersections studied with the Project, without the Project, and with the ambient growth of the area, including the Citrus Plaza development, will continue to operate LOS D during AM and PM peak hours, which is the same operating condition without the Project. The impact of this criterion is anticipated to be less than significant with the incorporation of Mitigation Measure TRAF-1 as previously identified. 307 MITIGATION MEASURERESPONSIBLE FOR MONITORINGTIMINGCRITERIACOMPLIANCE CHECKED BYSTATUS / DATE /INITIALSAESTHETICSAES-13URYLGHVKLHOGLQJIRUWKHGXDOKHDGSROHLQWKHVRXWKZHVWFRUQHUDVSHUWKHOLJKWLQJGHVLJQHQJLQHHULQJUHFRPPHQGDWLRQV AIR QUALITY $,5 &RQWUDFWRULVWRLPSOHPHQWDWDPLQLPXPDGD\SDLQWLQJVFKHGXOH$,5 $,57RWKHH[WHQWIHDVLEOHSURMHFWDSSOLFDQWVKDOOXVHSDLQWVDQGFRDWLQJVZLWKD92&FRQWHQWORZHUWKDQ6&$40'5XOHUHTXLUHVRUPRUHVWULQJHQWVWDQGDUGVLILQSODFHDWWKHWLPHGHYHORSPHQWRFFXUV$,5 ,QDFFRUGDQFHZLWK&DOLIRUQLD$LU5HVRXUFHV%RDUG¶VLGOLQJSROLF\JXLGHOLQHVQRGHOLYHU\YHKLFOHVPD\LGOHIRUPRUHWKDQILYHFRQVHFXWLYHPLQXWHVBIOLOGICAL RESOURCES%,2 $Q\JUXEELQJEUXVKLQJRUWUHHUHPRYDOVKRXOGEHFRQGXFWHGRXWVLGHRIWKH6WDWHLGHQWLILHGQHVWLQJVHDVRQIRUPLJUDWRU\ELUGVZKLFKLVW\SLFDOO\0DUFKWKURXJK6HSWHPEHU308 %,2±FRQWLQXHG ,IZRUNFDQQRWEHFRQGXFWHGRXWVLGHRIQHVWLQJVHDVRQDPLJUDWRU\QHVWLQJELUGVXUYH\ZLWKLQDQGDGMDFHQWWRWKHSURMHFWVLWHVKDOOEHFRQGXFWHGE\DTXDOLILHGELRORJLVWZLWKLQWKUHHGD\VSULRUWRLQLWLDWLQJWKHFRQVWUXFWLRQDFWLYLWLHV ,IDFWLYHQHVWVDUHIRXQGGXULQJWKHSUHFRQVWUXFWLRQQHVWLQJELUGVXUYH\VD1HVWLQJ%LUG3ODQ1%3ZLOOEHSUHSDUHGDQGLPSOHPHQWHG$WDPLQLPXPWKH1%3ZLOOLQFOXGHJXLGHOLQHVIRUDGGUHVVLQJDFWLYHQHVWVHVWDEOLVKLQJEXIIHUVPRQLWRULQJDQGUHSRUWLQJ7KH1%3ZLOOLQFOXGHDFRS\RIPDSVVKRZLQJWKHORFDWLRQRIDOOQHVWVDQGDQDSSURSULDWHEXIIHU]RQHDURXQGHDFKQHVWVXIILFLHQWWRSURWHFWWKHQHVWIURPGLUHFWDQGLQGLUHFWLPSDFW7KHVL]HDQGORFDWLRQRIDOOEXIIHU]RQHVLIUHTXLUHGVKDOOEHGHWHUPLQHGE\WKHELRORJLVWDQGVKDOOEHEDVHGRQWKHQHVWLQJVSHFLHVLWVVHQVLWLYLW\WRGLVWXUEDQFHDQGH[SHFWHGW\SHVRIGLVWXUEDQFH7KHQHVWVDQG 309 MITIGATION MEASURERESPONSIBLE FOR MONITORINGTIMINGCRITERIACOMPLIANCE CHECKED BYSTATUS / DATE / INITIALS%,2±FRQWLQXHGEXIIHU]RQHVVKDOOEHILHOGFKHFNHGZHHNO\E\DTXDOLILHGELRORJLFDOPRQLWRU7KHDSSURYHGEXIIHU]RQHVKDOOEHPDUNHGLQWKHILHOGZLWKFRQVWUXFWLRQIHQFLQJZLWKLQZKLFKQRYHJHWDWLRQFOHDULQJRUJURXQGGLVWXUEDQFHVKDOOFRPPHQFHXQWLOWKHTXDOLILHGELRORJLVWKDVGHWHUPLQHGWKH\RXQJELUGVKDYHVXFFHVVIXOO\IOHGJHGDQGDPRQLWRULQJUHSRUWKDVEHHQVXEPLWWHGUHYLHZHGDQGDSSURYHGE\WKH&LW\RI/D4XLQWD 310 MITIGATION MEASURERESPONSIBLE FOR MONITORINGTIMINGCRITERIACOMPLIANCE CHECKED BYSTATUS / DATE / INITIALSCULTURAL RESOURCES&8/ *UDGLQJDFWLYLWLHVVKDOOEHRYHUVHHQE\DTXDOLILHGDUFKHRORJLFDOPRQLWRU,QWKHHYHQWXQDQWLFLSDWHGDUFKDHRORJLFDOUHVRXUFHVDUHGLVFRYHUHGx7KHDUFKDHRORJLFDOPRQLWRUVKDOOQRWLI\WKHSURMHFWIRUHPDQx7KH$UFKDHRORJLFDOPRQLWRUKDVWKHDXWKRULW\WRWHPSRUDULO\KDOWZRUNLQWKHDUHDRIDUFKDHRORJLFDOGLVFRYHULHVXQWLOWKHUHVRXUFHKDVEHHQHYDOXDWHGx$OOZRUNLQWKHYLFLQLW\RIWKHILQGVKDOOKDOWx:RUNLQWKHDUHDRIWKHGLVFRYHU\VKDOOQRWUHVXPHXQWLOZULWWHQQRWLILFDWLRQLVUHFHLYHGIURPWKH3URMHFWDUFKDHRORJLVW 311 MITIGATION MEASURERESPONSIBLE FOR MONITORINGTIMINGCRITERIACOMPLIANCE CHECKED BYSTATUS / DATE / INITIALS&8/ *UDGLQJDFWLYLWLHVVKDOOEHRYHUVHHQE\DTXDOLILHGSDOHRQWRORJLFDOPRQLWRU3DOHRQWRORJLFDOPRQLWRUVVKRXOGEHHTXLSSHGWRVDOYDJHIRVVLOVDVWKH\DUHXQHDUWKHGWRDYRLGFRQVWUXFWLRQGHOD\VDQGWRUHPRYHVDPSOHVRIVHGLPHQWVWKDWDUHOLNHO\WRFRQWDLQWKHUHPDLQVRIVPDOOIRVVLOLQYHUWHEUDWHVDQGYHUWHEUDWHV0RQLWRUVZLOOEHHPSRZHUHGWRWHPSRUDULO\KDOWRUGLYHUWHTXLSPHQWWRDOORZUHPRYDORIDEXQGDQWRUODUJHVSHFLPHQV0RQLWRULQJZLOOEHUHGXFHGLIWKHSRWHQWLDOO\IRVVLOLIHURXVXQLWVDVGHVFULEHGE\WKH6DQ%HUQDUGLQR&RXQW\0XVHXP'LYLVLRQRI(DUWK6FLHQFHV0D\UHSRUWDUHQRWSUHVHQWRULISUHVHQWDUHGHWHUPLQHGXSRQH[SRVXUHDQGH[DPLQDWLRQE\TXDOLILHGSDOHRQWRORJLFDOSHUVRQQHOWRKDYHORZSRWHQWLDOWRFRQWDLQIRVVLOUHVRXUFHV&8/ ,IKXPDQUHPDLQVDUHHQFRXQWHUHGGXULQJWKHXQGHUWDNLQJ6WDWH+HDOWKDQG6DIHW\&RGH6HFWLRQVWDWHVWKDWQRIXUWKHUGLVWXUEDQFHVKDOORFFXUXQWLOWKH&RXQW\&RURQHUKDVPDGHDGHWHUPLQDWLRQRIRULJLQDQGGLVSRVLWLRQ 312 MITIGATION MEASURERESPONSIBLE FOR MONITORINGTIMINGCRITERIACOMPLIANCE CHECKED BYSTATUS / DATE / INITIALS&8/FRQWLQXHG SXUVXDQWWR3XEOLF5HVRXUFHV&RGH6HFWLRQ7KHORFDODXWKRULWLHVPXVWEHQRWLILHGRIWKHILQGLPPHGLDWHO\,IWKHUHPDLQVDUHGHWHUPLQHGWREHSUHKLVWRULFWKH&RURQHUZLOOQRWLI\WKH1DWLYH$PHULFDQ+HULWDJH&RPPLVVLRQ1$+&ZKLFKZLOOGHWHUPLQHDQGQRWLI\D0RVW/LNHO\'HVFHQGDQW0/':LWKWKHSHUPLVVLRQRIWKHODQGRZQHURUKLVKHUDXWKRUL]HGUHSUHVHQWDWLYHWKH0/'PD\LQVSHFWWKHVLWHRIWKHGLVFRYHU\7KH0/'VKDOOFRPSOHWHWKHLQVSHFWLRQZLWKLQKRXUVRIQRWLILFDWLRQE\WKH1$+&GEOLOGY AND SOILS*(2 3ULRUWRJUDGLQJSODQDSSURYDOVXEPLWIRUUHYLHZDQGDSSURYDOE\WKH&LW\(QJLQHHUD30OPDQDJHPHQWSODQ*(2 )RUSRUWLRQVRIWKHVLWHQRWLPPHGLDWHO\XQGHUFRQVWUXFWLRQHQVXUHWKHVWDELOL]DWLRQRIVRLOVWKURXJKWKHXVHRIVRLOFHPHQWRUUHYHJHWDWLRQIUHTXHQWZDWHULQJLQFOXGLQJZDWHULQJGXULQJWKHHYHQLQJDQGZHHNHQGVGXULQJVLJQLILFDQWZLQGHYHQWVVWUHHWVZHHSLQJRUZDVKLQJGXULQJFRQVWUXFWLRQDQGWKHFKHPLFDOVWDELOL]DWLRQRIXQSDYHGFRQVWUXFWLRQURDGZD\V 313 MITIGATION MEASURERESPONSIBLE FOR MONITORINGTIMINGCRITERIACOMPLIANCE CHECKED BYSTATUS / DATE / INITIALSHAZARDS AND HAZARDOUS MATERIALS+$=± $KD]DUGRXVVSLOOSUHYHQWLRQSODQVKDOOEHSUHSDUHGE\WKH$SSOLFDQWDQGVXEPLWWHGWRWKH&LW\IRUDSSURYDOWRPLQLPL]HWKHOLNHOLKRRGRIDVSLOOVKDOOEHSUHSDUHGSULRUWRFRQVWUXFWLRQ7KHSODQVKDOOVWDWHWKHDFWLRQVWKDWZRXOGEHUHTXLUHGLIDVSLOORFFXUVWRSUHYHQWFRQWDPLQDWLRQRIVXUIDFHZDWHUVDQGSURYLGHIRUFOHDQXSRIWKHVSLOO7KHSODQVKDOOIROORZ)HGHUDOVWDWHDQGORFDOVDIHW\JXLGHOLQHVDQGVWDQGDUGVWRDYRLGLQFUHDVHGH[SRVXUHWRWKHVHSROOXWDQWV+$=± ,IDFRQWDPLQDWHGDUHDLVHQFRXQWHUHGGXULQJFRQVWUXFWLRQFRQVWUXFWLRQVKDOOFHDVHLQWKHYLFLQLW\RIWKHFRQWDPLQDWHGDUHD7KHFRQVWUXFWLRQFRQWUDFWRUVKDOOQRWLI\DOODSSURSULDWHDXWKRULWLHVLQFOXGLQJWKH(3$DQGWKH&LW\,IQHFHVVDU\WKHFRQWDPLQDWHGVLWHVKDOOEHUHPHGLDWHGWRPLQLPL]HWKHSRWHQWLDOIRUH[SRVXUHRIWKHSXEOLFDQGWRDOORZWKH3URMHFWWREHVDIHW\FRQVWUXFWHG 314 MITIGATION MEASURERESPONSIBLE FOR MONITORINGTIMINGCRITERIACOMPLIANCE CHECKED BYSTATUS / DATE / INITIALSHYDROLOGY AND WATER QUALITY+<' 3ULRUWR3URMHFWDSSURYDOWKH3URMHFW$SSOLFDQWVKDOOSUHSDUHD:DWHU4XDOLW\0DQDJHPHQW3ODQWKDWVKDOODWPLQLPXPLQFOXGHWKHIROORZLQJx,GHQWLILHVDOOSURMHFWUHODWHGSROOXWDQWVLPSDFWVWRWKHVLWH¶VK\GURORJLFFRQGLWLRQDQGSRWHQWLDOLPSDFWVWRORFDOZDWHUZD\VFDXVHGE\3URMHFWSRVWFRQVWUXFWLRQUXQRIIx,GHQWLILHV%03VUHTXLUHGWRUHPRYHSROOXWDQWVIURPWKH3URMHFWV¶SRVWFRQVWUXFWLRQUXQRIIDQGSUHYHQWGRZQVWUHDPK\GURPRGLILFDWLRQx,GHQWLILHVSDUWLHVUHVSRQVLEOHIRUORQJWHUPRSHUDWLRQDQGPDLQWHQDQFHDFWLYLWLHVRIDOO%03Vx,GHQWLILHVWKHGHVLJQRSHUDWLRQDQGPDLQWHQDQFHRIWKHXQGHUJURXQGVWRUPZDWHUFROOHFWLRQV\VWHP 315 MITIGATION MEASURERESPONSIBLE FOR MONITORINGTIMINGCRITERIACOMPLIANCE CHECKED BYSTATUS / DATE /INITIALSNOISE12, ,WLVUHFRPPHQGHGWKDWWKH3DYLOLRQVGHOLYHU\GRFNLVHQFORVHGZLWKZDOOVDQGDURRIDQGWKDWDQDFRXVWLFDOO\DEVRUSWLYHPDWHULDOLVXVHGWRSDUWLDOO\OLQHWKHLQWHUQDOZDOOVWRFRQWUROQRLVHEXLOGXS7KLVZLOOOLPLWSRWHQWLDOGLVWXUEDQFHIURPXQORDGLQJ12, 9HKLFOHORDGLQJDQGXQORDGLQJIRUDOOUHWDLOXQLWVVKRXOGEHFDUULHGRXWLQDTXLHWPDQQHU12, ,WLVUHFRPPHQGHGWKDW+9$&HTXLSPHQWRQURRIVLVVFUHHQHGE\DQRLVHEDUULHUIURPWKHUHVLGHQFHV7KLVEDUULHUVKRXOGDWDPLQLPXPSURYLGHOLQHRIVLJKWVFUHHQLQJ12, ,WLVUHFRPPHQGHGWKDWQRLV\+9$&HTXLSPHQWDWJUDGHLVHQFORVHGZLWK&08ZDOOVDWOHDVWIHHWKLJKHUWKDQWKHHTXLSPHQW12, ,WLVUHFRPPHQGHGWKDWQRLVHIURP+9$&HTXLSPHQWLVOLPLWHGWRG%$DWWKHVLWHERXQGDU\ 316 MITIGATION MEASURERESPONSIBLE FOR MONITORINGTIMINGCRITERIACOMPLIANCE CHECKED BYSTATUS / DATE /INITIALS12, 5HGXFHWKHQRLVHIURPWKHDXGLEOHGHYLFHVIRUWKHGULYHWKURXJKHDWLQJHVWDEOLVKPHQWVXVLQJDQ\DQGRUDOOPHWKRGVDVIROORZVx3RVLWLRQGHYLFHVDZD\IURPWKHVLWHERXQGDU\WRWKHVRXWKx3URYLGHDGGLWLRQDOVFUHHQLQJVXFKDVSRVLWLRQLQJRIWKHUHWDLOEXLOGLQJVRUDQRLVHEDUULHUDVFORVHWRWKHGHYLFHx5HGXFHWKHQXPEHURIDXGLEOHGHYLFHVVXFKDVRQHGHYLFHWRVHUYHWZRGULYHWKURXJKVx2ULHQWWKHGHYLFHSHUSHQGLFXODUWRWKHYHKLFOHDQGDWHDUKHLJKWZLWKWKHGHYLFHDLPHGDWWKHOLVWHQHULQWKHYHKLFOHx7KHVRXQGIURPWKHGHYLFHVVKRXOGEHOLPLWHGWRDPD[LPXPRIG%$DWIHHWx7KHUHVKDOOEHQRDQQXQFLDWRUWRQHVZKLVWOHVEHHSVRURWKHUFKDUDFWHULVWLFVRXQGV12, /D\RXWWKHVLWHZRUNLQJWRNHHSQRLVHSURGXFLQJDFWLYLWLHVDVIDUDVSRVVLEOHIURPUHVLGHQFHVPLQLPL]HWKHXVHRIEDFNXSDODUPVDQGPLQLPL]HWUXFNDFWLYLW\DQGWUXFNTXHXLQJQHDUWKHUHVLGHQWLDODUHDV 317 MITIGATION MEASURERESPONSIBLE FORMONITORINGTIMINGCRITERIACOMPLIANCE CHECKED BYSTATUS / DATE /INITIALS12, 3HUIRUPFRQVWUXFWLRQLQDPDQQHUWRPLQLPL]HQRLVHZKHUHSUDFWLFDEOH)RUH[DPSOHx:KHUHSUDFWLFDEOHXVHK\GUDXOLFUDWKHUWKDQSQHXPDWLFLPSDFWWRROVx2SHUDWHHTXLSPHQWWRPLQLPL]HEDQJLQJFODWWHULQJEX]]LQJDQGRWKHUDQQR\LQJW\SHVRIQRLVHVx7XUQRIILGOLQJHTXLSPHQWDQGYHKLFOHVx$OOLQWHUQDOFRPEXVWLRQHTXLSPHQWVKDOOEHILWWHGZLWKSURSHUO\RSHUDWLQJPXIIOHUVDQGDLULQWDNHVLOHQFHUVx$OOVWDWLRQDU\HTXLSPHQWVKDOOEHORFDWHGDVIDUDVSUDFWLFDOIURPDGMDFHQWSRWHQWLDOUHVLGHQWLDOXQLWVx3KDVHLQVWDUWXSDQGVKXWGRZQRIVLWHHTXLSPHQWx&RQGXFWWUXFNORDGLQJXQORDGLQJDQGKDXOLQJRSHUDWLRQVWRNHHSQRLVHWRDPLQLPXPx/LPLWWKHWLPHWKDWVWHHOGHFNLQJRUSODWHVIRUVWUHHWGHFNLQJRUFRYHULQJH[FDYDWHGDUHDVDUHLQXVHx/LPLWWKHXVHRIDQQXQFLDWRUVRUSXEOLFDGGUHVVV\VWHPVH[FHSWIRUHPHUJHQF\QRWLILFDWLRQVx$OORQVLWHGHOLYHULHVVKDOOEHOLPLWHGWRDP7RSP 318 MITIGATION MEASURERESPONSIBLE FOR MONITORINGTIMINGCRITERIACOMPLIANCE CHECKED BYSTATUS / DATE /INITIALS12, 3HUIRUPFRQVWUXFWLRQLQDPDQQHUWRPLQLPL]HQRLVHZKHUHSUDFWLFDEOH)RUH[DPSOHx:KHUHSUDFWLFDEOHXVHK\GUDXOLFUDWKHUWKDQSQHXPDWLFLPSDFWWRROVx2SHUDWHHTXLSPHQWWRPLQLPL]HEDQJLQJFODWWHULQJEX]]LQJDQGRWKHUDQQR\LQJW\SHVRIQRLVHVx7XUQRIILGOLQJHTXLSPHQWDQGYHKLFOHVx$OOLQWHUQDOFRPEXVWLRQHTXLSPHQWVKDOOEHILWWHGZLWKSURSHUO\RSHUDWLQJPXIIOHUVDQGDLULQWDNHVLOHQFHUVx$OOVWDWLRQDU\HTXLSPHQWVKDOOEHORFDWHGDVIDUDVSUDFWLFDOIURPDGMDFHQWSRWHQWLDOUHVLGHQWLDOXQLWVx3KDVHLQVWDUWXSDQGVKXWGRZQRIVLWHHTXLSPHQWx&RQGXFWWUXFNORDGLQJXQORDGLQJDQGKDXOLQJRSHUDWLRQVWRNHHSQRLVHWRDPLQLPXPx/LPLWWKHWLPHWKDWVWHHOGHFNLQJRUSODWHVIRUVWUHHWGHFNLQJRUFRYHULQJH[FDYDWHGDUHDVDUHLQXVHx/LPLWWKHXVHRIDQQXQFLDWRUVRUSXEOLFDGGUHVVV\VWHPVH[FHSWIRUHPHUJHQF\QRWLILFDWLRQVx$OORQVLWHGHOLYHULHVVKDOOEHOLPLWHGWRDP7RSP 319 MITIGATION MEASURERESPONSIBLE FOR MONITORINGTIMINGCRITERIACOMPLIANCE CHECKED BYSTATUS / DATE /INITIALSTRAFFIC75$) 3ULRUWRUHFRUGDWLRQRIWKH)LQDO7HQWDWLYH3DUFHO0DSWKH$SSOLFDQWVKDOOHQWHULQWRDQDJUHHPHQWZLWKWKH&LW\RI/D4XLQWDDQGSRVWVHFXULW\WRGHVLJQDQGFRQVWUXFWDWWKHLQWHUVHFWLRQRI$YHQXHDQG-HIIHUVRQ6WUHHWWZRHDVWERXQGOHIWWXUQODQHVRQ$YHQXHWRQRUWKERXQG-HIIHUVRQ6WUHHWLIUHTXLUHGE\WKH3ODQQLQJ&RPPLVVLRQTRIBAL AND CULTURAL RESOURCES75& 1DWLYH$PHULFDQ0RQLWRUVIURPWKH7ZHQW\1LQH3DOPV%DQGRI0LVVLRQ,QGLDQVRU$JXD&DOLHQWH%DQGRI&DKXLOOD,QGLDQVVKRXOGEHSUHVHQWGXULQJWKHLQLWLDOJUDGLQJJURXQGGLVWXUELQJDFWLYLWLHV 320 CITY COUNCIL RESOLUTION 2020 - A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF LA QUINTA, CALIFORNIA, FOR APPROVAL OF A SPECIFIC PLAN AMENDMENT, TENTATIVE PARCEL MAP, AND SITE DEVELOPMENT PERMIT FOR THE PAVILION PALMS SHOPPING CENTER LOCATED AT THE NORTHWEST CORNER OF JEFFERSON STREET AND AVENUE 50. CASE NUMBERS: SPECIFIC PLAN 2017-0002 TENTATIVE PARCEL MAP 2017-0003 SITE DEVELOPMENT PERMIT 2017-0009 APPLICANT: LUNDIN DEVELOPMENT COMPANY WHEREAS the City Council of the City of La Quinta, California did, on the 7th day of July, 2020, hold a duly noticed Public Hearing to consider a request by Lundin Development Company for approval of the Pavilion Palms Shopping Center, consisting of approximately 125,800 sq. ft., generally located at the northwest corner of Jefferson Street and Avenue 50 more particularly described as: APN 602-180-004 WHEREAS, the Design and Development Department published a public hearing notice in The Desert Sun newspaper on June 26, 2020 as prescribed by the Municipal Code. Public hearing notices were also mailed to all property owners within 500 feet of the site; and WHEREAS, the City Council of the City of La Quinta, California did previously hold a duly noticed Public Hearing on May 5, 2020, to consider this project and continued the Public Hearing, at the applicant’s request to allow the applicant additional time to revise the site plan and prepare the revised application package; and WHEREAS, the City Council of the City of La Quinta, California did previously hold a duly noticed Public Hearings on February 4 and March 3, 2020, to consider this project and continued the Public Hearing, to allow the applicant time to revise the site plan; and 321 City Council Resolution 2020 - Specific Plan 2017-0002 Tentative Parcel Map 2017-0003 Site Development Permit 2017-0009 Pavilion Palms Shopping Center July 7, 2020 Page 2 of 12 WHEREAS, the Planning Commission of the City of La Quinta, California did, previously on the 10th day of December, 2019, hold a duly noticed Public Hearing where the Planning Commission recommended approval of this project; WHEREAS, the Planning Commission of the City of La Quinta, California did previously hold a duly noticed Public Hearing on October 8, 2019 to consider this project and continued the Public Hearing, to allow the applicant time to revise the site plan; and WHEREAS, the Planning Commission of the City of La Quinta, California did previously hold a duly noticed Public Hearing on June 26, 2018 to consider this project and continued the Public Hearing, to allow the applicant time to revise the traffic study and include an analysis of other intersections in the area; and Specific Plan (Amendment) 2017-0002 WHEREAS, at said Public Hearing, upon hearing and considering all testimony and arguments, if any, of all interested persons desiring to be heard, said City Council, having great deference in interpreting the project’s consistency with General Plan Goals and Policies, knowing that it is nearly impossible for a project to be in perfect conformity with each and every General Plan Goal and Policy (Sierra Club v. County of Napa (2004) 121 Cal.App.4th 1490, 1510-1511), did make the following mandatory findings pursuant to Section 9.240.010 of the La Quinta Municipal Code to justify approval of said Specific Plan: 1. Consistency with General Plan The proposed Specific Plan Amendment is consistent with the goals and policies of the La Quinta General Plan in that it will result in the development of an approximate 125,800 sq. ft. shopping center which is permitted in the General Commercial land use designation. The proposed project is consistent with and would not frustrate the Goals and Policies of the General Plan as follows: x Goals LU-6 and ED-1 as it will contribute to a balanced and varied economic base which provides fiscal stability to the 322 City Council Resolution 2020 - Specific Plan 2017-0002 Tentative Parcel Map 2017-0003 Site Development Permit 2017-0009 Pavilion Palms Shopping Center July 7, 2020 Page 3 of 12 City, and a broad range of goods and services to its residents and the region. x Policy LU-2.2 which requires Specific Plans for projects proposing flexible development standards that differ from the Zoning Ordinance. This project proposes variations from several development standards therefore a Specific Plan is appropriate for the project. x Policy CIR-1.12 to reduce vehicular traffic on major roadways and to reduce vehicle miles traveled by traffic originating in the City by the development of a land use pattern that maximizes interactions between adjacent or nearby land uses. This project proposes a shopping center near residences which would provide jobs near housing and provide goods and services near residences to shorten vehicle miles traveled. x Policy CIR-2.3 to develop and encourage the use of continuous and convenient pedestrian and bicycle routes and multi-use paths to places of employment, recreation, shopping, schools, and other high activity areas by providing sidewalks on Avenue 50 and Jefferson Street along the project’s frontage as well as walkable areas within the project site. x Policy SC-1.6 to expand the City’s alternative transportation network by providing sidewalks along Avenue 50 and Jefferson Street to connect gaps in the City’s sidewalk system. x Program PR-1.8.c: to promote and improve public access to farmers markets and grocery stores that sell fresh produce and healthy foods with the establishment of a supermarket at the site. x Policy AQ-1.6 which states that proposed development air quality emissions of criteria pollutants shall be analyzed under CEQA. The project’s MND analyzed these and determined 323 City Council Resolution 2020 - Specific Plan 2017-0002 Tentative Parcel Map 2017-0003 Site Development Permit 2017-0009 Pavilion Palms Shopping Center July 7, 2020 Page 4 of 12 that mitigation measures would reduce impacts to less than significant levels. x Policy BIO-1.2 which states that site-specific, species-specific surveys shall be required for species not covered by the MSHCP. The project’s MND includes mitigation that requires pre-construction surveys for burrowing owl, which is not a covered species under the MSHCP. x GOAL CUL-1 which supports protection of significant archaeological, historic and paleontological resources which occur in the City. The project’s MND includes mitigation measures to include a tribal monitor during ground disturbing activities. x GOAL N-1 which supports a healthful noise environment which complements the City’s residential and resort character. The project’s MND includes mitigation measures to reduce noise impacts to less than significant levels. x GOAL GEO-1 which supports the protection of the residents’ health and safety, and of their property, from geologic and seismic hazards. The project’s MND determined that with implementation of required building and seismic code standards, the project would have a less than significant impact on geological resources. x Policy FH-1.3 which states that the City shall continue to implement development standards that provide for a reduction in runoff from developed lands and are consistent with local and regional stormwater management plans. The project is consistent with this policy since underground retention will be provided that will contain the 100-year storm for the site. x Policy PF-1.3 which states that the City shall identify all viable financing mechanisms for the funding of construction, maintenance and operation of municipal facilities. The project 324 City Council Resolution 2020 - Specific Plan 2017-0002 Tentative Parcel Map 2017-0003 Site Development Permit 2017-0009 Pavilion Palms Shopping Center July 7, 2020 Page 5 of 12 will be required to pay development impact fees which is a funding mechanism for municipal facilities and public services. x The project conceptual landscape design is consistent with Goal WR-1 and Policy UTL-1.2 as it will result in the efficient use and conservation of the City’s water resources. 2. Public Welfare Approval of the proposed Specific Plan Amendment will not create conditions materially detrimental to public health, safety and general welfare. The Design and Development Department has prepared Environmental Assessment 2017-0006 for this project, in compliance with the requirements of the California Environmental Quality Act (CEQA). The Design and Development Director has determined that although the proposed project could have a significant effect on the environment, there will not be a significant effect because revisions in the project have been made by or agreed to by the project proponent and mitigation measures have been incorporated. 3. Land Use Compatibility The proposed Specific Plan incorporates a land use that is compatible with zoning on adjacent properties. The property will continue to be zoned as Community Commercial which is intended to provide for the sale of general merchandise, hardware and building materials, food, drugs, sundries, personal services and similar goods and services to meet the needs of multi-neighborhood area. The proposed shopping center would result in a floor area ratio of 0.23, which is below the allowed 0.30 floor area ratio in the Community Commercial zone. 4. Property Suitability The uses permitted in the Specific Plan are suitable and appropriate for the subject property in that the site is relatively flat, vacant, and the area can be served by all necessary public services and utilities. The proposed project is located at the intersection of arterial streets and provides convenience to goods and services to residential neighborhoods in the vicinity. 325 City Council Resolution 2020 - Specific Plan 2017-0002 Tentative Parcel Map 2017-0003 Site Development Permit 2017-0009 Pavilion Palms Shopping Center July 7, 2020 Page 6 of 12 Tentative Parcel Map 2017-0003 WHEREAS, at said Public Hearing, upon hearing and considering all testimony and arguments, if any, of all interested persons desiring to be heard, the City Council did make the following mandatory findings to justify approval of said Tentative Tract Map: 1. Tentative Parcel Map 37370 is consistent with the La Quinta General Plan, and Specific Plan 2017-0002 as proposed. The Tentative Parcel Map is consistent with the General Commercial land use designation as set forth in the General Plan, and as set forth in Specific Plan 2017-0002. 2. The design and improvement of Tentative Parcel Map 37370 is consistent with the La Quinta General Plan, and Specific Plan 2017- 0002 with the implementation of recommended conditions of approval. 3. The design of Tentative Parcel Map 37370 and proposed improvements are not likely to cause substantial environmental damage, nor substantially and avoidably injure fish or wildlife or their habitat. The Design and Development Department has prepared Environmental Assessment 2017-0006 for this project, in compliance with the requirements of the California Environmental Quality Act (CEQA). The Design and Development Director has determined that although the proposed project could have a significant effect on the environment, there will not be a significant effect because revisions in the project have been made by or agreed to by the project proponent and mitigation measures have been incorporated. 4. The design of Tentative Parcel Map 37370 and type of improvements are not likely to cause serious public health problems, insofar as the project will be required to comply with all laws, standards and requirements associated with sanitary sewer collection, water quality and other public health issues. 5. The site of the proposed subdivision is physically suitable for the 326 City Council Resolution 2020 - Specific Plan 2017-0002 Tentative Parcel Map 2017-0003 Site Development Permit 2017-0009 Pavilion Palms Shopping Center July 7, 2020 Page 7 of 12 type of development and proposed density of development given the site’s location at the corner of two arterial roadways and the site is relatively flat, vacant, and can be served by all necessary public services and utilities. 6. The proposed subdivision is consistent with all applicable provisions of this title and the La Quinta Zoning Ordinance, including, but not limited to, minimum lot area requirements, any other applicable provisions of this code, and the Subdivision Map Act. 7. The design and improvements required for Tentative Parcel Map 37370 will not conflict with easements, acquired by the public at large, for access through or use of the property. All roadway improvements, easements, if any and surrounding improvements will be completed to City standards. Site Development Permit 2017-0009 WHEREAS, at said Public Hearing, upon hearing and considering all testimony and arguments, if any, of all interested persons desiring to be heard, said City Council, having great deference in interpreting the project’s consistency with General Plan Goals and Policies, knowing that it is nearly impossible for a project to be in perfect conformity with each and every General Plan Goal and Policy (Sierra Club v. County of Napa (2004) 121 Cal.App.4th 1490, 1510-1511), did make the following mandatory findings pursuant to Section 9.210.010 of the Municipal Code to justify approval of said Site Development Permit: 1. Consistency with General Plan The proposed development is consistent with the General Plan land use designation of General Commercial. The City’s General Plan policies relating to General Commercial encourage shopping centers in the City, and the proposed use maintains those policies. The proposed project is consistent with and would not frustrate the Goals and Policies of the General Plan as follows: x Goals LU-6 and ED-1 as it will contribute to a balanced and varied economic base which provides fiscal stability to the 327 City Council Resolution 2020 - Specific Plan 2017-0002 Tentative Parcel Map 2017-0003 Site Development Permit 2017-0009 Pavilion Palms Shopping Center July 7, 2020 Page 8 of 12 City, and a broad range of goods and services to its residents and the region. x Policy LU-2.2 which requires Specific Plans for projects proposing flexible development standards that differ from the Zoning Ordinance. This project proposes variations from several development standards therefore a Specific Plan is appropriate for the project. x Policy CIR-1.12 to reduce vehicular traffic on major roadways and to reduce vehicle miles traveled by traffic originating in the City by the development of a land use pattern that maximizes interactions between adjacent or nearby land uses. This project proposes a shopping center near residences which would provide jobs near housing and provide goods and services near residences to shorten vehicle miles traveled. x Policy CIR-2.3 to develop and encourage the use of continuous and convenient pedestrian and bicycle routes and multi-use paths to places of employment, recreation, shopping, schools, and other high activity areas by providing sidewalks on Avenue 50 and Jefferson Street along the project’s frontage as well as walkable areas within the project site. x Policy SC-1.6 to expand the City’s alternative transportation network by providing sidewalks along Avenue 50 and Jefferson Street to connect gaps in the City’s sidewalk system. x Program PR-1.8.c: to promote and improve public access to farmers markets and grocery stores that sell fresh produce and healthy foods with the establishment of a supermarket at the site. x Policy AQ-1.6 which states that proposed development air quality emissions of criteria pollutants shall be analyzed under CEQA. The project’s MND analyzed these and determined 328 City Council Resolution 2020 - Specific Plan 2017-0002 Tentative Parcel Map 2017-0003 Site Development Permit 2017-0009 Pavilion Palms Shopping Center July 7, 2020 Page 9 of 12 that mitigation measures would reduce impacts to less than significant levels. x Policy BIO-1.2 which states that site-specific, species-specific surveys shall be required for species not covered by the MSHCP. The project’s MND includes mitigation that requires pre-construction surveys for burrowing owl, which is not a covered species under the MSHCP. x GOAL CUL-1 which supports protection of significant archaeological, historic and paleontological resources which occur in the City. The project’s MND includes mitigation measures to include a tribal monitor during ground disturbing activities. x GOAL N-1 which supports a healthful noise environment which complements the City’s residential and resort character. The project’s MND includes mitigation measures to reduce noise impacts to less than significant levels. x GOAL GEO-1 which supports the protection of the residents’ health and safety, and of their property, from geologic and seismic hazards. The project’s MND determined that with implementation of required building and seismic code standards, the project would have a less than significant impact on geological resources. x Policy FH-1.3 which states that the City shall continue to implement development standards that provide for a reduction in runoff from developed lands and are consistent with local and regional stormwater management plans. The project is consistent with this policy since underground retention will be provided that will contain the 100-year storm for the site. x Policy PF-1.3 which states that the City shall identify all viable financing mechanisms for the funding of construction, maintenance and operation of municipal facilities. The project 329 City Council Resolution 2020 - Specific Plan 2017-0002 Tentative Parcel Map 2017-0003 Site Development Permit 2017-0009 Pavilion Palms Shopping Center July 7, 2020 Page 10 of 12 will be required to pay development impact fees which is a funding mechanism for municipal facilities and public services. x The project conceptual landscape design is consistent with Goal WR-1 and Policy UTL-1.2 as it will result in the efficient use and conservation of the City’s water resources. 2. Consistency with Zoning Code The proposed development, as conditioned, is consistent with the purpose and intent of the Community Commercial District as well as the development standards of the City’s Zoning Code and Specific Plan 2017-0002 in terms of architectural style and landscaping. The project satisfies the District’s intent to provide for the sale of general merchandise, hardware and building materials, food, drugs, sundries, personal services and similar goods and services to meet the needs of multi-neighborhood area. The project is generally consistent with the non-residential development standards and permitted use table, except deviations that include requested reductions from landscape setback standards, increased retail building size, and allowance of automotive service station as a permitted use. These development standard and land use deviations may be approved with the Specific Plan Amendment. 3. Compliance with CEQA The Design and Development Department has prepared Environmental Assessment 2017-0006 for this project, in compliance with the requirements of the California Environmental Quality Act (CEQA). The Design and Development Director has determined that although the proposed project could have a significant effect on the environment, there will not be a significant effect because revisions in the project have been made by or agreed to by the project proponent and mitigation measures have been incorporated. 4. Architectural Design The architectural design of the project, including, but not limited to, the architectural style, scale, building mass, materials, colors, architectural details, roof style and other architectural elements are 330 City Council Resolution 2020 - Specific Plan 2017-0002 Tentative Parcel Map 2017-0003 Site Development Permit 2017-0009 Pavilion Palms Shopping Center July 7, 2020 Page 11 of 12 compatible with surrounding development and with the quality of design prevalent in the city. 5. Site Design The site design of the project including, but not limited to, project entries, interior circulation, pedestrian and bicycle access, pedestrian amenities, screening of equipment and trash enclosures, exterior lighting, and other site design elements are compatible with surrounding development and with the quality of design prevalent in the city. 6. Landscape Design Project landscaping, including, but not limited to, the location, type, size, color, texture and coverage of plant materials, has been designed so as to provide visual relief, complement buildings, visually emphasize prominent design elements and vistas, screen undesirable views, provide a harmonious transition between adjacent land uses and between development and open space, and provide an overall unifying influence to enhance the visual continuity of the project. The proposed project is consistent with the landscaping standards and plant palette and implements the standards for landscaping and aesthetics established in the General Plan and Zoning Code. The permanent overall site landscaping utilizes various tree and shrub species to enhance the building architecture. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of La Quinta, California, as follows: SECTION 1. That the above recitations are true and constitute the Findings of the City Council in this case; SECTION 2. That the City Council does hereby approve Specific Plan 2017- 0002, Tentative Parcel Map 2017-0003 and Site Development Permit 2017- 0009. 331 City Council Resolution 2020 - Specific Plan 2017-0002 Tentative Parcel Map 2017-0003 Site Development Permit 2017-0009 Pavilion Palms Shopping Center July 7, 2020 Page 12 of 12 PASSED, APPROVED, and ADOPTED at a regular meeting of the City of La Quinta City Council, held on this the 7th day of July, 2020, by the following vote: AYES: NOES: ABSENT: ABSTAIN: ________________________________ LINDA EVANS, Mayor City of La Quinta, California ATTEST: _________________________________________ MONIKA RADEVA, City Clerk City of La Quinta, California APPROVED AS TO FORM: _________________________________________ WILLIAM IHRKE, City Attorney City of La Quinta, California 332 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL – RECOMMENDED SPECIFIC PLAN 2017-0002 (SPECIFIC PLAN 1998-034, AMENDMENT 2) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 1 OF 2 SPECIFIC PLAN 2017-0002 GENERAL 1. The applicant agrees to defend, indemnify and hold harmless the City of La Quinta (“City”), its agents, officers and employees from any claim, action or proceeding to attack, set aside, void, or annul the approval of this Specific Plan. The City shall have sole discretion in selecting its defense counsel. The City shall promptly notify the applicant of any claim, action or proceeding and shall cooperate fully in the defense. 2. Specific Plan 2017-0002 shall be developed in compliance with these conditions, and the approved Specific Plan document. In the event of any conflicts between these conditions and the provisions of Specific Plan 2017- 0002, these conditions shall take precedence. 3. Specific Plan 2017-0002 shall comply with all applicable terms, conditions and/or mitigation measures for the following related approvals: Environmental Assessment 1998-375 and 2017-0006 Tentative Parcel Map 2017-0003 (TTM 37370) Site Development Permit 2017-0009 In the event of any conflict(s) between approval conditions and/or provisions of these approvals, the Design and Development Director shall adjudicate the conflict by determining the precedence. 4. Within 30 days of City Council approval, applicant shall provide an electronic copy (.pdf) and three bound paper copies of the Final Specific Plan document to the Design and Development Department. The Final Specific Plan shall include all text and graphics, all amendments per this action, and correction of any typographical errors, internal document inconsistencies, and other amendments deemed necessary by the Planning Manager. 5. Fuel center operating hours shall be limited to 7:00 a.m. to 10:00 p.m. as stated in the Specific Plan. Any changes that need to be made to these hours after approval of the Specific Plan shall be subject to approval by the Design and Development Director. 6. Representatives from tribes within the project vicinity commented and have requested the following considerations: 333 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL – RECOMMENDED SPECIFIC PLAN 2017-0002 (SPECIFIC PLAN 1998-034, AMENDMENT 2) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 2 OF 2 A. The presence of an approved Agua Caliente Native American Cultural Resource Monitor(s) shall be onsite during any ground disturbing activities (including archaeological testing and surveys). B. Should buried cultural deposits be encountered, the Monitor may request that destructive construction halt and the Monitor shall notify a Qualified Archaeologist (Secretary of the Interior’s Standards and Guidelines) to investigate and, if necessary, prepare a mitigation plan for submission to the State Historic Preservation Officer and the Agua Caliente Tribal Historic Preservation Office. 334 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 1 of 27 GENERAL 1. The applicant agrees to defend, indemnify and hold harmless the City of La Quinta (“City”), its agents, officers and employees from any claim, action or proceeding to attack, set aside, void, or annul the approval of this Site Development Permit, or any Final Map recorded thereunder. The City shall have sole discretion in selecting its defense counsel. The City shall promptly notify the applicant of any claim, action or proceeding and shall cooperate fully in the defense. 2. Site Development Permit 2017-0009 shall comply with all applicable conditions for the following related approval(s): Environmental Assessment 2017-0006 Tentative Parcel Map 2017-0003 (Tentative Parcel Map 37370) Specific Plan 2017-0002 In the event of any conflict(s) between approval conditions and/or provisions of these approvals, the Director of Design and Development shall adjudicate the conflict by determining the precedence. 3. Pad Buildings 1, 2, 8, 9, and 10 shall require, prior to construction of any structures, a Site Development Permit to be reviewed and approved by the Planning Commission at a public hearing. The architectural and landscaping design for these pad buildings shall be congruous with the design approved in Site Development Permit 2017-0006. 4. The Site Development Permit shall expire two years from City Council approval and shall become null and void in accordance with La Quinta Municipal Code Section 9.200.080, unless a building permit has been issued. A time extension may be requested per LQMC Section 9.200.080. 5. Prior to the issuance of any grading, construction, or building permit by the City, the applicant shall obtain any necessary clearances and/or permits from the following agencies, if required: x Riverside County Fire Marshal x La Quinta Development Services Division (Grading Permit, Green Sheet (Public Works Clearance) for Building Permits, Water Quality 335 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 2 of 27 Management Plan(WQMP) Exemption Form – Whitewater River Region, Improvement Permit) x La Quinta Planning Division x Riverside Co. Environmental Health Department x Desert Sands Unified School District (DSUSD) x Coachella Valley Water District (CVWD) x Imperial Irrigation District (IID) x California Regional Water Quality Control Board (CRWQCB) x State Water Resources Control Board x SunLine Transit Agency (SunLine) x South Coast Air Quality Management District Coachella Valley (SCAQMD) The applicant is responsible for all requirements of the permits and/or clearances from the above listed agencies. When these requirements include approval of improvement plans, the applicant shall furnish proof of such approvals when submitting those improvements plans for City approval. 6. Coverage under the State of California Construction General Permit must be obtained by the applicant; who then shall submit a copy of the Regional Water Quality Control Board’s (“RWQCB”) acknowledgment of the applicant’s Notice of Intent (“NOI”) and Waste Discharger Identification (WDID) number to the City prior to the issuance of a grading or building permit. 7. The applicant shall comply with applicable provisions of the City’s NPDES stormwater discharge permit, LQMC Sections 8.70.010 et seq. (Stormwater Management and Discharge Controls), and 13.24.170 (Clean Air/Clean Water); Riverside County Ordinance No. 457; the California Regional Water Quality Control Board – Colorado River Basin Region Board Order No. R7-2013-0011 and the State Water Resources Control Board’s Order No. 2012-0006-DWQ. A. For construction activities including clearing, grading or excavation of land that disturbs one (1) acre or more of land, or that disturbs less than one (1) acre of land, but which is a part of a construction project that encompasses more than one (1) acre of land, the Permitee shall be required to submit a Storm Water Pollution Protection Plan (“SWPPP”) to the State Water Resources Control Board. 336 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 3 of 27 The applicant or design professional can obtain the California Stormwater Quality Association SWPPP template at www.cabmphandbooks.com for use in their SWPPP preparation. B. The applicant shall ensure that the required SWPPP is available for inspection at the project site at all times through and including acceptance of all improvements by the City. C. The applicant’s SWPPP shall include provisions for all of the following Best Management Practices (“BMPs”) (LQMC Section 8.70.020 (Definitions)): 1) Temporary Soil Stabilization (erosion control). 2) Temporary Sediment Control. 3) Wind Erosion Control. 4) Tracking Control. 5) Non-Storm Water Management. 6) Waste Management and Materials Pollution Control. D. The SWPPP and BMPs shall remain in effect for the entire duration of project construction until all improvements are completed and accepted by the City Council. E. The inclusion in the Conditions, Covenants, and Restrictions (CC&Rs), a requirement for the perpetual maintenance and operation of all post-construction BMPs as required. 8. Permits issued under this approval shall be subject to the provisions of the Development Impact Fee and Transportation Uniform Mitigation Fee programs in effect at the time of issuance of building permit(s). 9. Developer shall reimburse the City, within thirty (30) days of presentment of the invoice, all costs and actual attorney’s fees incurred by the City Attorney to review, negotiate and/or modify any documents or instruments required by these conditions, if Developer requests that the City modify or revise any documents or instruments prepared initially by the City to effect these conditions. This obligation shall be paid in the time noted above without deduction or offset and Developer’s failure to make such payment shall be a material breach of the Conditions of Approval. 337 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 4 of 27 10. Developer shall reimburse the City, within thirty (30) days of presentment of the invoice, all costs and actual consultant’s fees incurred by the City for engineering and/or surveying consultants to review and/or modify any documents or instruments required by this project. This obligation shall be paid in the time noted above without deduction or offset and Developer’s failure to make such payment shall be a material breach of the Conditions of Approval. PROPERTY RIGHTS 11. Prior to issuance of any permit(s), the applicant shall acquire or confer easements and other property rights necessary for the construction or proper functioning of the proposed development. Conferred rights shall include irrevocable offers to dedicate or grant access easements to the City for emergency services and for maintenance, construction and reconstruction of essential improvements. Said conferred rights shall also include grant of access easement to the City of La Quinta for the purpose of graffiti removal by City staff or assigned agent in perpetuity and agreement to the method to remove graffiti and to paint over to best match existing. The applicant shall establish the aforementioned requirements in the CC&R’s for the development or other agreements as approved by the City Engineer. Pursuant to the aforementioned, the applicant shall submit and execute an “AUTHORIZATION TO REMOVE GRAFFITI FROM PRIVATE PROPERTY” form located at the Public Works Department Counter prior to Certificate of Occupancy. 12. Pursuant to the aforementioned condition, conferred rights shall include approvals from the master developer over easements and other property rights necessary for construction and proper functioning of the proposed development not limited to access rights over proposed and/or existing private streets that access public streets and open space/drainage facilities of the master development. 13. The applicant shall offer for dedication all public street rights-of-way in conformance with the City's General Plan, Municipal Code, applicable specific plans, site development permit, and/or as required by the City Engineer. 14. The public street right-of-way offers for dedication required for this development include: 338 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 5 of 27 A. PUBLIC STREETS 1) Jefferson Street (Major Arterial) – 64 feet from the centerline of Jefferson Street for a total 128-foot ultimate developed right of way except additional variable right of way dedication to accommodate improvements conditioned under STREET AND TRAFFIC IMPROVEMENTS. 2) Avenue 50 (Primary Arterial) – 54 feet from the centerline of Avenue 50 for a total 108-foot ultimate developed right of way except additional variable right of way dedication to accommodate improvements conditioned under STREET AND TRAFFIC IMPROVEMENTS. 15. Dedications shall include additional widths as necessary for dedicated right and left turn lanes, bus turnouts, and other features contained in the approved construction plans. Pursuant to this requirement, the Applicant shall include in the submittal packet containing the rough grading plans submitted for plan checking, an offsite street geometric layout, drawn at 1” equals 40 feet, detailing the following design aspects: median curb line, outside curb line, lane line alignment including lane widths, left turn lanes, deceleration lane(s) and bus stop turnout(s). The geometric layout shall be accompanied with sufficient professional engineering studies to confirm the appropriate length of all proposed turn pockets and auxiliary lanes that may impact the right of way dedication required of the project and the associated landscape setback requirement. 16. When the City Engineer determines that access rights to the proposed street rights-of-way shown on the approved Site Development Permit are necessary prior to approval of the improvements dedicating such right-of- way, the applicant shall grant the necessary right-of-way within 60 days of a written request by the City. 17. The applicant shall create perimeter landscaping setbacks along all public rights-of-way as follows: A. Jefferson Street (Major Arterial) – Minimum 18-foot from the R/W- P/L. B. Avenue 50 (Primary Arterial) – Minimum 18-foot from the R/W-P/L. 339 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 6 of 27 The listed setback depth shall be the average depth where a meandering wall design is approved. The setback requirements shall apply to all frontages including, but not limited to, remainder parcels and sites dedicated for utility purposes. Where public facilities (e.g., sidewalks) are placed on privately-owned setbacks, the applicant shall offer for dedication blanket easements for those purposes on the Final Map. 18. The applicant shall offer for dedication those easements necessary for the placement of, and access to, utility lines and structures, drainage basins, mailbox clusters, park lands, and common areas. 19. Direct vehicular access to Jefferson Street and Avenue 50 is restricted, except for those access points identified on the tentative parcel map, or as otherwise conditioned in these conditions of approval. The vehicular access restriction shall be shown on the recorded final parcel map 20. The applicant shall furnish proof of easements, or written permission, as appropriate, from those owners of all abutting properties on which grading, retaining wall construction, permanent slopes, or other encroachments will occur. 21. The applicant shall cause no easement to be granted, or recorded, over any portion of the subject property after the date of approval of the Site Development Permit unless such easement is approved by the City Engineer. STREET AND TRAFFIC IMPROVEMENTS 22. The applicant shall comply with the provisions of LQMC Sections 13.24.060 (Street Improvements), 13.24.070 (Street Design - Generally) & 13.24.100 (Access for Individual Properties and Development) for public streets. 23. Streets shall have vertical curbs or other approved curb configurations that will convey water without ponding, and provide lateral containment of dust and residue during street sweeping operations. Unused curb cuts on any lot shall be restored to standard curb height prior to final inspection of permanent building(s) on the lot. 340 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 7 of 27 24. The applicant shall construct the following street improvements to conform with the General Plan (street type noted in parentheses.) A. OFF-SITE STREETS 1) Jefferson Street (Major Arterial) a. Widen the west side of the street along frontage as necessary in order to accommodate deceleration/right turn only lanes serving the two entrances to the project. b. Reconstruct the existing landscaped median to provide the left turn in with physical left turn out restriction and restore the median landscaping. c. Class II bike lane as approved by the City Engineer d. Reconstruct sidewalk improvements as needed and applicant to reimburse City for sidewalk improvements made to applicant’s frontage through the City’s Capital Improvement Program. 2) Avenue 50 (Primary Arterial) a. Widen the north side of the street along all frontage to the project boundary to its ultimate width on the north side as specified in the General Plan and the requirements of these conditions. Street widening improvements shall include all appurtenant components such as, but not limited to curb, gutter, traffic control striping, legends, and signs. b. A deceleration/right turn only lane serving the entrances to the project as approved by the City Engineer c. 12-foot wide landscaped median along the entire boundary of the project plus variable width as needed to accommodate for a left turn lane into the easterly 341 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 8 of 27 Avenue 50 project entry and for a left turn lane for eastbound Avenue 50 traffic at the intersection of Avenue 50 and Jefferson Street as approved by the City Engineer. d. Class II bike lane as approved by the City Engineer e. 6-foot wide sidewalk—The applicant shall revise the site plan and landscape plan to include a non-curb adjacent 6-foot wide sidewalk along Avenue 50 at a minimum distance of 4 feet from the street curb. The site plan and landscape plan shall be reviewed and approved by the City Engineer and Planning Manager prior to construction. f. The applicant is responsible for the cost to design and install dual eastbound left turn lanes to northbound Jefferson Street when determined by the City Engineer and a traffic study prepared for the applicant per Engineering Bulletin #06-13 that the left-turn volumes cannot be adequately served by the single left-turn lane. Applicant shall enter into a SIA to post separate security for the cost to design and install the dual eastbound left turn lanes. This obligation will remain in effect for 10 years after recordation of the final map unless otherwise approved by the City Engineer. 3) Jefferson Street/Avenue 50 Intersection: All necessary traffic signal modifications in the northwest quadrant of the intersection and any other modifications warranted by the timing and traffic generation of this development. 4) Other required improvements in the right-of-way and/or adjacent landscape setback area include: all appurtenant components such as, but not limited to: curb, gutter, traffic control striping, legends, and signs. The applicant is responsible for construction of all improvements mentioned above. 342 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 9 of 27 The applicant shall extend improvements beyond the project boundaries to ensure they safely integrate with existing improvements (e.g., grading; traffic control devices and transitions in alignment, elevation or dimensions of streets and sidewalks). 25. General access points and turning movements of traffic are limited to the following: Jefferson Street (northerly): Right turn in, right turn out, and left turn in movements are permitted. Left turn out movements are prohibited. Jefferson Street (southerly): Right turn in and right turn out movements are permitted. Left turn in and left turn out movements are prohibited. Avenue 50 (westerly): Right turn in and right turn out movements are permitted. Left turn in and left turn out movements are prohibited. Avenue 50 (easterly): Full turn movements in and out are allowed. 26. Standard knuckles and corner cut-backs shall conform to Riverside County Standard Drawings #801 and #805, respectively, unless otherwise approved by the City Engineer. PARKING LOTS and ACCESS POINTS 27. The design of parking facilities shall conform to LQMC Chapter 9.150 and in particular the following: A. The parking stall and aisle widths and the double hairpin stripe parking stall design shall conform to LQMC Chapter 9.150. B. Cross slopes should be a maximum of 2% where ADA accessibility is required including accessibility routes between buildings. C. Building access points shall be shown on the Precise Grading Plans to evaluate ADA accessibility issues can be evaluated. D. Accessibility routes to public streets and adjacent development shall be shown on the Precise Grading Plan. E. Parking stall lengths shall be according to LQMC Chapter 9.150 and be a minimum of 17 feet in length with a 2-foot overhang for standard parking stalls and 18 feet with a 2-foot overhang for 343 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 10 of 27 handicapped parking stall or as approved by the City Engineer. One van accessible handicapped parking stall is required per 8 handicapped parking stalls. F. Drive aisles between parking stalls shall be a minimum of 26 feet with access drive aisles to Public Streets a minimum of 30 feet or as approved by the City Engineer. Entry drives, main interior circulation routes, corner cutbacks, bus turnouts, dedicated turn lanes, ADA accessibility route to public streets and other features shown on the approved construction plans, may require additional street widths and other improvements as may be determined by the City Engineer. 28. The applicant shall design street pavement sections using CalTrans' design procedure for 20-year life pavement, and the site-specific data for soil strength and anticipated traffic loading (including construction traffic). Minimum structural sections shall be as follows: Parking Lot & Aisles (Low Traffic) 3.0" a.c./4.5" c.a.b. Parking Lot & Aisles (High Traffic) 4.5" a.c /5.5" c.a.b. Loading Areas 6” P.C.C./4” c.a.b. or the approved equivalents of alternate materials per the City Engineer. 29. The applicant shall submit current mix designs (less than two years old at the time of construction) for base, asphalt concrete and Portland cement concrete. The submittal shall include test results for all specimens used in the mix design procedure. For mix designs over six months old, the submittal shall include recent (less than six months old at the time of construction) aggregate gradation test results confirming that design gradations can be achieved in current production. The applicant shall not schedule construction operations until mix designs are approved. 30. Improvements shall include appurtenances such as traffic control signs, markings and other devices, raised medians if required, street name signs and sidewalks. Mid-block street lighting is not required. 31. Improvements shall be designed and constructed in accordance with City adopted standards, supplemental drawings and specifications, or as 344 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 11 of 27 approved by the City Engineer. Improvement plans for streets, access gates and parking areas shall be stamped and signed by engineers registered in California. IMPROVEMENT PLANS As used throughout these Conditions of Approval, professional titles such as “engineer,” “surveyor,” and “architect,” refer to persons currently certified or licensed to practice their respective professions in the State of California. 32. Improvement plans shall be prepared by or under the direct supervision of qualified engineers and/or architects, as appropriate, and shall comply with the provisions of LQMC Section 13.24.040 (Improvement Plans). 33. The following improvement plans shall be prepared and submitted for review and approval by the Design and Development Department. A separate set of plans for each line item specified below shall be prepared. The plans shall utilize the minimum scale specified, unless otherwise authorized by the City Engineer in writing. Plans may be prepared at a larger scale if additional detail or plan clarity is desired. Note, the applicant may be required to prepare other improvement plans not listed here pursuant to improvements required by other agencies and utility purveyors. A. On-Site Rough Grading Plan 1" = 40' Horizontal B. PM10 Plan 1” = 40’ Horizontal C. Erosion Control Plan 1” = 40’ Horizontal D. WQMP (Plan submitted in Report Form) NOTE: A through D to be submitted concurrently. E. Off-Site Street Improvement/Storm Drain Plan 1" = 40' Horizontal, 1" = 4' Vertical F. Off-Site Signing & Striping Plan 1” = 40’ Horizontal The Off-Site street improvement plans shall have separate plan sheet(s) (drawn at 20 scale) that show the meandering sidewalk, 345 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 12 of 27 mounding, and berming design in the combined parkway and landscape setback area. G. On Site Sewer and Water Improvement Plan 1" = 40' Horizontal H. On-Site Street Improvements/Signing & Striping/Storm Drain Plan 1" = 40' Horizontal, 1"= 4' Vertical I. On-Site Precise Grading Plan 1” = 30’ Horizontal (Separate Storm Drain Plans if applicable) Other engineered improvement plans prepared for City approval that are not listed above shall be prepared in formats approved by the City Engineer prior to commencing plan preparation. All Off-Site Plan & Profile Street Plans and Signing & Striping Plans shall show all existing improvements for a distance of at least 200-feet beyond the project limits, or a distance sufficient to show any required design transitions. All On-Site Signing & Striping Plans shall show, at a minimum; Stop Signs, Limit Lines and Legends, No Parking Signs, Raised Pavement Markers (including Blue RPMs at fire hydrants) and Street Name Signs per Public Works Standard Plans and/or as approved by the Design and Development Department. “Rough Grading” plans shall normally include perimeter walls with Top Of Wall & Top Of Footing elevations shown. All footings shall have a minimum of 1-foot of cover, or sufficient cover to clear any adjacent obstructions. “On-Site Precise Grading” plans shall normally include all on-site surface improvements including but not limited to finish grades for curbs & gutters, building floor elevations, wall elevations, parking lot improvements and ADA requirements. 34. The City maintains standard plans, detail sheets and/or construction notes for elements of construction which can be accessed via the “Plans, Notes and Design Guidance” section of the Public Works Development Division at the City website (www.la-quinta.org). Please navigate to the 346 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 13 of 27 Design and Development Department home page and look for the Standard Drawings hyperlink. 35. The applicant shall furnish a complete set of the mylars of all approved improvement plans acceptable to the City Engineer. 36. Upon completion of construction, and prior to final acceptance of the improvements by the City, the applicant shall furnish the City with reproducible record drawings of all improvement plans which were approved by the City. Each sheet shall be clearly marked "Record Drawing" and shall be stamped and signed by the engineer or surveyor certifying to the accuracy and completeness of the drawings. The applicant shall have all approved mylars previously submitted to the City, revised to reflect the as-built conditions. The applicant shall employ or retain the Engineer Of Record during the construction phase of the project so that the EOR can make site visits in support of preparing "Record Drawing". However, if subsequent approved revisions have been approved by the City Engineer and reflect said "Record Drawing" conditions, the Engineer Of Record may submit a letter attesting to said fact to the City Engineer in lieu of mylar submittal. IMPROVEMENT SECURITY AGREEMENTS 37. Prior to approval of any Final Map, the applicant shall construct all on and off-site improvements and satisfy its obligations for same, or shall furnish a fully secured and executed Subdivision Improvement Agreement (“SIA”) guaranteeing the construction of such improvements and the satisfaction of its obligations for same, or shall agree to any combination thereof, as may be required by the City. 38. Any Subdivision Improvement Agreement (“SIA”) entered into by and between the applicant and the City of La Quinta, for the purpose of guaranteeing the completion of any improvements related to this Tentative Parcel Map, shall comply with the provisions of LQMC Chapter 13.28 (Improvement Security). 39. Prior to constructing any off-site improvements, the applicant shall deposit securities equivalent to both a Performance and Labor & Material Bonds each valued at 100% of the cost of the off-site improvements, or as approved by the City Engineer. 347 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 14 of 27 40. Improvements to be made, or agreed to be made, shall include the removal of any existing structures or other obstructions which are not a part of the proposed improvements; and shall provide for the setting of the final survey monumentation. 41. When improvements are phased through a “Phasing Plan,” or an administrative approval (e.g., Site Development Permits), all off-site improvements and common on-site improvements (e.g., backbone utilities, retention basins, perimeter walls, landscaping and gates) shall be constructed, or secured, prior to the issuance of any permits in the first phase of the development, or as otherwise approved by the City Engineer. If construction of the commercial center proceeds in phases, the first phase of development shall include the construction and completion of the Anchor tenant building and associated fuel center, Shop 1, project landscaping and parking areas. Improvements and obligations required of each subsequent phase shall either be completed, or secured, prior to the completion of homes or the occupancy of permanent buildings within such latter phase, or as otherwise approved by the City Engineer. In the event the applicant fails to construct the improvements for the development, or fails to satisfy its obligations for the development in a timely manner, pursuant to the approved phasing plan, the City shall have the right to halt issuance of all permits, and/or final inspections, withhold other approvals related to the development of the project, or call upon the surety to complete the improvements. 42. Depending on the timing of the development of this Site Development Permit, and the status of the off-site improvements at the time, the applicant may be required to: A. Construct certain off-site improvements. B. Construct additional off-site improvements, subject to the reimbursement of its costs by others. C. Reimburse others for those improvements previously constructed that are considered to be an obligation of this Site Development Permit. 348 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 15 of 27 D. Secure the costs for future improvements that are to be made by others. E. To agree to any combination of these actions, as the City may require. Off-Site Improvements should be completed on a first priority basis. The applicant shall complete Off-Site Improvements in the first phase of construction or by the issuance of the 20% Building Permit. In the event that any of the improvements required for this development are constructed by the City, the applicant shall, prior to the approval of the Final Map, or the issuance of any permit related thereto, reimburse the City for the costs of such improvements. 43. If the applicant elects to utilize the secured agreement alternative, the applicant shall submit detailed construction cost estimates for all proposed on-site and off-site improvements, including an estimate for the final survey monumentation, for checking and approval by the City Engineer. Such estimates shall conform to the unit cost schedule as approved by the City Engineer. Estimates for improvements under the jurisdiction of other agencies shall be approved by those agencies and submitted to the City along with the applicant’s detailed cost estimates. Security will not be required for telephone, natural gas, or Cable T.V. improvements. 44. Should the applicant fail to construct the improvements for the development, or fail to satisfy its obligations for the development in a timely manner, the City shall have the right to halt issuance of building permits, and/or final building inspections, withhold other approvals related to the development of the project, or call upon the surety to complete the improvements. GRADING 45. The applicant shall comply with the provisions of LQMC Section 13.24.050 (Grading Improvements). 46. Prior to occupancy of the project site for any construction, or other purposes, the applicant shall obtain a grading permit approved by the City Engineer. 349 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 16 of 27 47. To obtain an approved grading permit, the applicant shall submit and obtain approval of all of the following: A. A grading plan prepared by a civil engineer registered in the State of California, B. A preliminary geotechnical (“soils”) report prepared by an engineer registered in the State of California, C. A Fugitive Dust Control Plan prepared in accordance with LQMC Chapter 6.16, (Fugitive Dust Control), and D. A Best Management Practices report prepared in accordance with LQMC Sections 8.70.010 and 13.24.170 (NPDES Stormwater Discharge Permit and Storm Management and Discharge Controls). E. WQMP prepared by an engineer registered in the State of California. All grading shall conform with the recommendations contained in the Preliminary Soils Report, and shall be certified as being adequate by soils engineer, or engineering geologist registered in the State of California. The applicant shall furnish security, in a form acceptable to the City, and in an amount sufficient to guarantee compliance with the approved Fugitive Dust Control Plan provisions as submitted with its application for a grading permit. Additionally, the applicant shall replenish said security if expended by the City of La Quinta to comply with the Plan as required by the City Engineer. 48. The applicant shall maintain all open graded, undeveloped land in order to prevent wind and/or water erosion of such land. All open graded, undeveloped land shall either be planted with interim landscaping, or stabilized with such other erosion control measures, as were approved in the Fugitive Dust Control Plan. 49. Grading within the perimeter setback and parkway areas shall have undulating terrain and shall conform with the requirements of LQMC Section 9.60.240(F) except as otherwise modified by this condition requirement. The maximum slope shall not exceed 3:1 anywhere in the landscape setback area, except for the backslope (i.e. the slope at the back of the landscape lot) which shall not exceed 2:1 if fully planted with 350 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 17 of 27 ground cover. The maximum slope in the first six (6) feet adjacent to the curb shall not exceed 4:1 when the nearest edge of sidewalk is within six feet (6’) of the curb, otherwise the maximum slope within the right of way shall not exceed 3:1. All unpaved parkway areas adjacent to the curb shall be depressed one and one-half inches (1.5") in the first eighteen inches (18") behind the curb. 50. Building pad elevations on the rough grading plan submitted for City Engineer’s approval shall conform with pad elevations shown on the tentative map, unless the pad elevations have other requirements imposed elsewhere in these Conditions of Approval, or as approved by the City Engineer. 51. Building pad elevations of perimeter lots shall not differ by more than one foot higher from the building pads in adjacent developments. 52. The applicant shall minimize the differences in elevation between the adjoining properties and the lots within this development. 53. Prior to any site grading or regrading that will raise or lower any portion of the site by more than plus or minus half of a foot (0.5’) from the elevations shown on the approved Site Development Permit Site Plan, the applicant shall submit the proposed grading changes to the City Engineer for a substantial conformance finding review. 54. Prior to the issuance of a building permit for any building lot, the applicant shall provide a lot pad certification stamped and signed by a qualified engineer or surveyor with applicable compaction tests and over excavation documentation. Each pad certification shall list the pad elevation as shown on the approved grading plan, the actual pad elevation and the difference between the two, if any. Such pad certification shall also list the relative compaction of the pad soil. The data shall be organized by lot number, and listed cumulatively if submitted at different times. DRAINAGE 55. Stormwater handling shall conform with the approved hydrology and drainage report for the Pavilions Plaza Commercial Development project (TPM37370 and SDP2017-0009), or as approved by the City Engineer. Nuisance water shall be disposed of in an approved manner. 351 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 18 of 27 Nuisance water shall be retained onsite and disposed of via an underground percolation improvement approved by the City Engineer. 56. The applicant shall comply with the provisions of LQMC Section 13.24.120 (Drainage), Retention Basin Design Criteria, Engineering Bulletin No. 06- 16 – Hydrology Report with Preliminary Hydraulic Report Criteria for Storm Drain Systems and Engineering Bulletin No. 06-015 - Underground Retention Basin Design Requirements. More specifically, stormwater falling on site during the 100 year storm shall be retained within the development, unless otherwise approved by the City Engineer. The design storm shall be the 1 hour, 3 hour, 6 hour or 24 hour event producing the greatest total run off. 57. Nuisance water shall be retained on site. Nuisance water shall be disposed of per approved methods contained in Engineering Bulletin No. 06-16 – Hydrology Report with Preliminary Hydraulic Report Criteria for Storm Drain Systems and Engineering Bulletin No. 06-015 - Underground Retention Basin Design Requirements. 58. In design of retention facilities, the maximum percolation rate shall be two inches per hour. The percolation rate will be considered to be zero unless the applicant provides site specific data indicating otherwise and as approved by the City Engineer. 59. The project shall be designed to accommodate purging and blowoff water (through underground piping and/or retention facilities) from any on-site or adjacent well sites granted or dedicated to the local water utility authority as a requirement for development of this property. 60. No fence or wall shall be constructed around any retention basin unless approved by the Planning Manager and the City Engineer. 61. For on-site above ground common retention basins, retention depth shall be according to Engineering Bulletin No. 06-16 – Hydrology Report with Preliminary Hydraulic Report Criteria for Storm Drain Systems. Side slopes shall not exceed 3:1 and shall be planted with maintenance free ground cover. Additionally, retention basin widths shall be not less than 20 feet at the bottom of the basin. 62. Stormwater may not be retained in landscaped parkways or landscaped setback lots. Only incidental storm water (precipitation which directly falls onto the setback) will be permitted to be retained in the landscape 352 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 19 of 27 setback areas. The perimeter setback and parkway areas in the street right-of-way shall be shaped with berms and mounds, pursuant to LQMC Section 9.100.040(B)(7). 63. The design of the development shall not cause any increase in flood boundaries and levels in any area outside the development. 64. The development shall be graded to permit storm flow in excess of retention capacity to flow out of the development through a designated overflow and into the historic drainage relief route. 65. Storm drainage historically received from adjoining property shall be received and retained or passed through into the historic downstream drainage relief route. 66. The applicant shall comply with applicable provisions for post construction runoff per the City’s NPDES stormwater discharge permit, LQMC Sections 8.70.010 et seq. (Stormwater Management and Discharge Controls), and 13.24.170 (Clean Air/Clean Water); Riverside County Ordinance No. 457; and the California Regional Water Quality Control Board – Colorado River Basin (CRWQCB-CRB) Region Board Order No. R7-2013-0011. A. For post-construction urban runoff from New Development and Redevelopments Projects, the applicant shall implement requirements of the NPDES permit for the design, construction and perpetual operation and maintenance of BMPs per the approved Water Quality Management Plan (WQMP) for the project as required by the California Regional Water Quality Control Board – Colorado River Basin (CRWQCB-CRB) Region Board Order No. R7- 2013-0011. B. The applicant shall implement the WQMP Design Standards per (CRWQCB-CRB) Region Board Order No. R7-2013-0011 utilizing BMPs approved by the City Engineer. A project specific WQMP shall be provided which incorporates Site Design and Treatment BMPs utilizing first flush infiltration as a preferred method of NPDES Permit Compliance for Whitewater River receiving water, as applicable. C. The developer shall execute and record a Stormwater Management/BMP Facilities Agreement that provides for the perpetual maintenance and operation of stormwater BMPs. 353 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 20 of 27 UTILITIES 67. The applicant shall comply with the provisions of LQMC Section 13.24.110 (Utilities). 68. The applicant shall obtain the approval of the City Engineer for the location of all utility lines within any right-of-way, and all above-ground utility structures including, but not limited to, traffic signal cabinets, electric vaults, water valves, and telephone stands, to ensure optimum placement for practical and aesthetic purposes. 69. Existing overhead utility lines within, or adjacent to the proposed development, and all proposed utilities shall be installed underground. The 92 KV transmission power poles and all existing utility lines attached to joint use 92 KV transmission power poles are exempt from the requirement to be placed underground. 70. Underground utilities shall be installed prior to overlying hardscape. For installation of utilities in existing improved streets, the applicant shall comply with trench restoration requirements maintained, or required by the City Engineer. The applicant shall provide certified reports of all utility trench compaction for approval by the City Engineer. Additionally, grease traps and the maintenance thereof shall be located as to not conflict with access aisles/entrances. CONSTRUCTION 71. The City will conduct final inspections of habitable buildings only when the buildings have improved street and (if required) sidewalk access to publicly-maintained streets. The improvements shall include required traffic control devices, pavement markings and street name signs. LANDSCAPE AND IRRIGATION 72. The applicant shall comply with LQMC Sections 13.24.130 (Landscaping Setbacks) & 13.24.140 (Landscaping Plans). 73. Landscape and irrigation plans for landscaped lots and setbacks, medians, retention basins, and parks shall be signed and stamped by a licensed landscape architect. 354 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 21 of 27 74. All new and modified landscape areas shall have landscaping and permanent irrigation improvements in compliance with the City’s Water Efficient Landscape regulations contained in LQMC Section 8.13 (Water Efficient Landscape). 75. Lighting plans shall be submitted with the final landscaping plans for a recommendation to the Planning Commission for their approval. Exterior lighting shall be consistent with LQMC Sections 9.100.150 (Outdoor Lighting) and 9.150.080 (Parking Facility Design Standards). All freestanding lighting shall not exceed 20 feet in height and shall be shielded to minimize trespass of light off the property. Security lighting along the west elevation of the anchor building shall be installed below 20 ft. in height and shall be shielded to minimize trespass of light off the property and not shine directly onto neighboring residences. Any illuminated carports shall be included in the photometric study as part of the final lighting plan submittal. 76. All water features shall be designed to minimize “splash”, and use high efficiency pumps and lighting to the satisfaction of the Planning Manager. They shall be included in the landscape plan water efficiency calculations per Municipal Code Chapter 8.13. 77. All rooftop mechanical equipment shall be completely screened from view. Utility transformers or other ground mounted mechanical equipment shall be fully screened with a screening wall or landscaping and painted to match the adjacent buildings. 78. The applicant shall submit the final landscape plans for review, processing and approval to the Design and Development Department, in accordance with the Final Landscape Plan application process. Planning Commission approval of the final landscape plans is required prior to issuance of the first building permit. NOTE: Plans are not approved for construction until signed by the appropriate City official, including the Planning Manager and/or City Engineer. 79. The applicant or his agent has the responsibility for proper sight distance requirements per guidelines in the AASHTO “A Policy on Geometric Design of Highways and Streets, 5th Edition” or latest, in the design and/or installation of all landscaping and appurtenances abutting and within the private and public street right-of-way. 355 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 22 of 27 80. The final design of the perimeter landscaping, particularly the perimeter wall, shall be included with the Final Landscape Plan submittal. 81. Applicant/Developer shall install paving patterns, such as stamped concrete or decorative colored pavers, to delineate and differentiate pedestrian-oriented areas throughout the project from the vehicular circulation, parking areas, ingress and egress, to minimize conflicts between pedestrian and vehicle traffic. Paving patterns shall be approved with the final landscape plans by the Planning Commission prior to construction. PUBLIC SERVICES 82. The applicant shall provide public transit improvements if required by SunLine Transit Agency and approved by the City Engineer. MAINTENANCE 83. The applicant shall comply with the provisions of LQMC Section 13.24.160 (Maintenance). 84. The applicant shall make provisions for the continuous and perpetual maintenance of perimeter landscaping up to the curb, common areas, access drives, sidewalks, and stormwater BMPs. FEES AND DEPOSITS 85. The applicant shall comply with the provisions of LQMC Section 13.24.180 (Fees and Deposits). These fees include all deposits and fees required by the City for plan checking and construction inspection. Deposits and fee amounts shall be those in effect when the applicant makes application for plan check and permits. FIRE DEPARTMENT 86. Fire Hydrants and Fire Flow: Applicant and/or developer shall separately provide one copy of off-site water system plans detailing existing/proposed fire hydrant(s) and main(s) capable of delivering the minimum fire flow, per CFC Appendix B Table B105.1, within 400 feet to all portions around the proposed structure(s). Minimum fire hydrant location and spacing shall comply with the CFC and NFPA 24. Reference current California Fire Code (CFC) 507.5.1. Plans must be signed by a 356 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 23 of 27 registered Civil Engineer and/or water purveyor prior to Fire Marshal review and approval. Mylar will be signed by the Fire Marshal after review and approval. A. Transportation hydrants shall be added to Jefferson and Avenue 50 in compliance with CFC Appendix C Table C102.1 for the frontage of the project. 87. Fire Department Access: Provide a site plan for fire apparatus access roads and signage. Access roads shall be provided to within 150 feet to all portions of all buildings and shall have an unobstructed width of not less than 24 feet. The construction of the access roads shall be all weather and capable of sustaining 60,000 lbs. over two axels for commercial developments. Ref. CFC 503.1.1 and 503.2.1 as amended by the City of La Quinta. 88. Requests for installation of traffic calming designs/devices on fire apparatus access roads shall be submitted and approved by the Office of the Fire Marshal. Ref. CFC 503.4.1 89. Grading Permit Fire Department Review: Submittal to the Office of the Fire Marshal for Precise Grading Permit will be required. 90. Construction Permits Fire Department Review: Submittal of construction plans to the Office of the Fire Marshal for development, construction, installation and operational use permitting will be required. Final fire and life safety conditions will be addressed when the Office of the Fire Marshal reviews these plans. These conditions will be based on occupancy, use, California Building Code (CBC), California Fire Code, and related codes, which are in effect at the time of building plan submittal. 91. Phased Construction Access: If construction is phased, each phase shall provide approved access for fire protection prior to any construction. Ref. CFC 503.1 92. Fire Sprinkler System: All new commercial structures 3,600 square feet or larger will be required to install a fire sprinkler system. Ref. CFC 903.2 as amended by the City of La Quinta. 93. Fire Alarm and Detection System: A water flow monitoring system and/or fire alarm system may be required and determined at time of building plan review. Ref. CFC 903.4, CFC 907.2 and NFPA 72 357 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 24 of 27 94. Knox Box and Gate Access: Buildings shall be provided with a Knox Box. The Knox Box shall be installed in an accessible location approved by the Office of the Fire Marshal. All electronically operated gates shall be provided with Knox key switches and automatic sensors for access. Ref. CFC 506.1 95. Addressing: All commercial buildings shall display street numbers in a prominent location on the address side and additional locations as required. Ref. CFC 505.1 and County of Riverside Office of the Fire Marshal Standard #07-01 96. Landscape clearances: A minimum 3-feet radius clear of vegetation shall be maintained around fire protection equipment, valves and services requiring access. This includes Backflow Valves, Post-Indicator Valves, Fire Department Connections, Fire Hydrants, etc. 97. Emergency Responder Radio Coverage Systems: Projects that do not meet the exceptions set forth by the Riverside County Office of the Fire Marshal shall provide plans for an emergency responder radio coverage system. Ref. CFC 510.1 and Riverside County Office of the Fire Marshal Technical Policy #TP19-002 BUILDING DIVISION 98. Building Plans prepared for permitting shall meet applicable California Building Codes effective at the time of submittal. 99. Any building, structure, facility, complex or improved area, or portions thereof, which are used by the general public shall be provided barrier free design to ensure that these improvements are accessible to and usable by persons with disabilities. Plans shall fully detail how the proposed facility complies with the California Accessibility Standards defined in Title 24 Chapter 11B and Federal ADA Regulations. MISCELLANEOUS 100. Representatives from tribes within the project vicinity commented and have requested the following considerations: A. The presence of an approved Agua Caliente Native American Cultural Resource Monitor(s) shall be onsite during any ground disturbing activities (including archaeological testing and surveys). 358 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 25 of 27 B. Should buried cultural deposits be encountered, the Monitor may request that destructive construction halt and the Monitor shall notify a Qualified Archaeologist (Secretary of the Interior’s Standards and Guidelines) to investigate and, if necessary, prepare a mitigation plan for submission to the State Historic Preservation Officer and the Agua Caliente Tribal Historic Preservation Office. 101. The County Coroner shall be contacted if human remains are identified during earthmoving activities. If the remains are determined to be of Native American origin, the Native American Heritage Commission (NAHC) shall be contacted. The NAHC will make a determination of the Most Likely Descendent (MLD). The City and the landowner will work with the designated MLD to determine the final disposition of the remains. 102. No signage is permitted with this approval. A separate permit from the Design and Development Department is required for any temporary or permanent signs. 103. The applicant shall submit exhibits to the Planning Manager and City Engineer that demonstrate vehicles can turn into approved drive aisles for drive through facilities in one continuous movement prior to precise grading plan approval. The applicant shall modify drive aisle entries for drive through facilities on precise grading and building construction plans if the Planning Manager and City Engineer determine such modifications are necessary to accommodate vehicles turning into drive aisles. 104. The applicant shall install a transition for the eastbound Avenue 50 to northbound Jefferson Street left turn lane that separates the turn lane from the left turn lane into the shopping center from eastbound Avenue 50. This transition will keep the left turn queue for Jefferson Street from backing up into the median break for the shopping center full turn movement. 105. Applicant/Developer shall add metal louvres as a decorative element to the fuel center canopy consistent with the architecture of the convenience store building. The metal louvres shall be reviewed and approved during building plan check. 106. The size of Building 7 shall be no larger than 825 square feet and shall not include the sale of alcoholic beverages. 359 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 26 of 27 107. Public Art shall be dedicated on the project site or the Applicant/Developer shall pay a development fee pursuant to the requirements of Municipal Code Chapter 2.65 Art in Public Places. 108. All vacant pads shall be planted with drought tolerant landscaping and decomposed granite and shall include fencing as appropriate so long as they are vacant. The installation of all landscaping and decomposed granite, and fencing as appropriate, shall be completed prior to the issuance of Certificate of Occupancy of the Pavilions store. Any landscaping on vacant pads shall be irrigated and maintained regularly. The final landscape plan for the project shall include plans for fencing, landscaping, irrigation (as applicable), and maintenance for vacant pads. The final landscape plan must be reviewed and approved by the Planning Commission at a public hearing prior to construction. 109. The applicant shall add shade features and seating to the interior corner plaza areas and shall be approved with the final landscape plans by the Planning Commission prior to construction. 110. The project sign program shall be reviewed and approved by the Planning Commission at a public hearing prior to construction. 111. The height of parking lot lighting shall not exceed 20 feet and shall be approved with the final landscape plans by the Planning Commission prior to construction. 112. The applicant shall install a minimum of 12 electric vehicle charging facilities in the anchor tenant’s parking lot on an accessible route per CBC 11B-228.3. Any future electric vehicle charging facilities in addition to these 12 shall be designed on an accessible route to facilitate compliance once they are installed. 113. The landscape architect shall identify standards for planting, irrigation and maintenance in the final landscape plan and the standards shall be included in Covenants, Conditions, and Restrictions (CC&Rs) which shall be recorded on the Property and shall be reviewed and approved by the City. 114. Prior to issuance of Certificate of Occupancy for the Pavilions store, applicant shall record Conditions, Covenants, and Restrictions (CC&Rs) on the Property. The CC&Rs shall (1) require minimum covenants for satisfactory, perpetual maintenance obligations on the Property; (2) 360 CITY COUNCIL RESOLUTION 2019- CONDITIONS OF APPROVAL - RECOMMENDED SITE DEVELOPMENT PERMIT 2017-0009 PAVILION PALMS SHOPPING CENTER ADOPTED: Page 27 of 27 name the City of La Quinta as an express third party beneficiary; (3) be reviewed and approved by the City Attorney’s Office prior to recordation; and (4) state that the CC&Rs cannot be amended without prior written consent of the City. 115. Prior to issuance of Certificate of Occupancy for the Pavilions store, applicant shall execute and record a maintenance agreement with the Renaissance HOA and the Palmilla HOA. The agreement shall (1) be imposed as an equitable servitude on the Property (2) require satisfactory, perpetual maintenance of the Property, (3) name the City as an express third party beneficiary; (4) be reviewed and approved by the City Attorney’s Office prior to recordation; and (5) state that the maintenance agreement cannot be amended without prior written consent of the City. If the applicant shows substantial evidence that the Renaissance and Palmilla HOA’s are not negotiating in good faith, the applicant may provide the evidence to the Design and Development Department and request removal of this condition. 361 362 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 1 of 22 GENERAL 1. The applicant agrees to defend, indemnify and hold harmless the City of La Quinta (“City”), its agents, officers and employees from any claim, action or proceeding to attack, set aside, void, or annul the approval of this Tentative Parcel Map, or any Final Map recorded thereunder. The City shall have sole discretion in selecting its defense counsel. The City shall promptly notify the applicant of any claim, action or proceeding and shall cooperate fully in the defense. 2. This Tentative Parcel Map, and any Final Map recorded thereunder, shall comply with the requirements and standards of Government Code §§ 66410 through 66499.58 (the “Subdivision Map Act”), and Chapter 13 of the La Quinta Municipal Code (“LQMC”). 3. Prior to the issuance of any grading, construction, or building permit by the City, the applicant shall obtain any necessary clearances and/or permits from the following agencies, if required: x Riverside County Fire Marshal x La Quinta Development Services Division (Grading Permit, Green Sheet (Public Works Clearance) for Building Permits, Water Quality Management Plan(WQMP) Exemption Form – Whitewater River Region, Improvement Permit) x La Quinta Planning Division x Riverside Co. Environmental Health Department x Desert Sands Unified School District (DSUSD) x Coachella Valley Water District (CVWD) x Imperial Irrigation District (IID) x California Regional Water Quality Control Board (CRWQCB) x State Water Resources Control Board x SunLine Transit Agency (SunLine) x South Coast Air Quality Management District Coachella Valley (SCAQMD) The applicant is responsible for all requirements of the permits and/or clearances from the above listed agencies. When these requirements include approval of improvement plans, the applicant shall furnish proof of such approvals when submitting those improvements plans for City approval. 363 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 2 of 22 4. Coverage under the State of California General Construction Permit must be obtained by the applicant; who then shall submit a copy of the Regional Water Quality Control Board’s (“RWQCB”) acknowledgment of the applicant’s Notice of Intent (“NOI”) and Waste Discharger Identification (WDID) number to the City prior to the issuance of a grading or building permit. 5. The applicant shall comply with applicable provisions of the City’s NPDES stormwater discharge permit, LQMC Sections 8.70.010 et seq. (Stormwater Management and Discharge Controls), and 13.24.170 (Clean Air/Clean Water); Riverside County Ordinance No. 457; the California Regional Water Quality Control Board – Colorado River Basin Region Board Order No. R7-2013-0011 and the State Water Resources Control Board’s Order No. 2012-0006-DWQ. A. For construction activities including clearing, grading or excavation of land that disturbs one (1) acre or more of land, or that disturbs less than one (1) acre of land, but which is a part of a construction project that encompasses more than one (1) acre of land, the Permitee shall be required to submit a Storm Water Pollution Protection Plan (“SWPPP”) to the State Water Resources Control Board. The applicant or design professional can obtain the California Stormwater Quality Association SWPPP template at www.cabmphandbooks.com for use in their SWPPP preparation. B. The applicant shall ensure that the required SWPPP is available for inspection at the project site at all times through and including acceptance of all improvements by the City. C. The applicant’s SWPPP shall include provisions for all of the following Best Management Practices (“BMPs”) (LQMC Section 8.70.020 (Definitions)): 1) Temporary Soil Stabilization (erosion control). 2) Temporary Sediment Control. 3) Wind Erosion Control. 4) Tracking Control. 5) Non-Storm Water Management. 6) Waste Management and Materials Pollution Control. 364 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 3 of 22 D. The SWPPP and BMPs shall remain in effect for the entire duration of project construction until all improvements are completed and accepted by the City Council. E. The inclusion in the Conditions, Covenants, and Restrictions (CC&Rs), a requirement for the perpetual maintenance and operation of all post-construction BMPs as required. 6. Permits issued under this approval shall be subject to the provisions of the Development Impact Fee and Transportation Uniform Mitigation Fee programs in effect at the time of issuance of building permit(s). 7. Developer shall reimburse the City, within thirty (30) days of presentment of the invoice, all costs and actual attorney’s fees incurred by the City Attorney to review, negotiate and/or modify any documents or instruments required by these conditions, if Developer requests that the City modify or revise any documents or instruments prepared initially by the City to effect these conditions. This obligation shall be paid in the time noted above without deduction or offset and Developer’s failure to make such payment shall be a material breach of the Conditions of Approval. 8. Developer shall reimburse the City, within thirty (30) days of presentment of the invoice, all costs and actual consultant’s fees incurred by the City for engineering and/or surveying consultants to review and/or modify any documents or instruments required by this project. This obligation shall be paid in the time noted above without deduction or offset and Developer’s failure to make such payment shall be a material breach of the Conditions of Approval. PROPERTY RIGHTS 9. Prior to issuance of any permit(s), the applicant shall acquire or confer easements and other property rights necessary for the construction or proper functioning of the proposed development. Conferred rights shall include irrevocable offers to dedicate or grant access easements to the City for emergency services and for maintenance, construction and reconstruction of essential improvements. Said conferred rights shall also include grant of access easement to the City of La Quinta for the purpose of graffiti removal by City staff or assigned agent in perpetuity and agreement to the method to remove graffiti and to paint over to best match existing. The applicant shall establish the aforementioned 365 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 4 of 22 requirements in the CC&R’s for the development or other agreements as approved by the City Engineer. Pursuant to the aforementioned, the applicant shall submit and execute an “AUTHORIZATION TO REMOVE GRAFFITI FROM PRIVATE PROPERTY” form located at the Public Works Department Counter prior to Certificate of Occupancy. 10. Pursuant to the aforementioned condition, conferred rights shall include approvals from the master developer over easements and other property rights necessary for construction and proper functioning of the proposed development not limited to access rights over proposed and/or existing private streets that access public streets and open space/drainage facilities of the master development. 11. The applicant shall offer for dedication all public street rights-of-way in conformance with the City's General Plan, Municipal Code, applicable specific plans, and/or as required by the City Engineer. 12. The public street right-of-way offers for dedication required for this development include: A. PUBLIC STREETS 1) Jefferson Street (Major Arterial) – 64 feet from the centerline of Jefferson Street for a total 128-foot ultimate developed right of way except additional variable right of way dedication to accommodate improvements conditioned under STREET AND TRAFFIC IMPROVEMENTS. 2) Avenue 50 (Primary Arterial) – 54 feet from the centerline of Avenue 50 for a total 108-foot ultimate developed right of way except additional variable right of way dedication to accommodate improvements conditioned under STREET AND TRAFFIC IMPROVEMENTS. 13. Dedications shall include additional widths as necessary for dedicated right and left turn lanes, bus turnouts, and other features contained in the approved construction plans. Pursuant to this requirement, the Applicant shall include in the submittal packet containing the draft final map submitted for map checking, an offsite street geometric layout, drawn at 1” equals 40 feet, detailing the following design aspects: median curb line, outside curb line, lane line 366 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 5 of 22 alignment including lane widths, left turn lanes, deceleration lane(s) and bus stop turnout(s). The geometric layout shall be accompanied with sufficient professional engineering studies to confirm the appropriate length of all proposed turn pockets and auxiliary lanes that may impact the right of way dedication required of the project and the associated landscape setback requirement. 14. When the City Engineer determines that access rights to the proposed street rights-of-way shown on the approved Tentative Parcel Map are necessary prior to approval of the Final Map dedicating such rights-of- way, the applicant shall grant the necessary rights-of-way within 60 days of a written request by the City. 15. The applicant shall create minimum perimeter landscaping setbacks along all public rights-of-way as follows: A. Jefferson Street - 18-foot from the R/W-P/L. B. Avenue 50 - 18-foot from the R/W-P/L. The listed setback depth shall be the average depth where a meandering wall design is approved. The setback requirements shall apply to all frontages including, but not limited to, remainder parcels and sites dedicated for utility purposes. Where public facilities (e.g., sidewalks) are placed on privately-owned setbacks, the applicant shall offer for dedication blanket easements for those purposes on the Final Map. 16. The applicant shall offer for dedication those easements necessary for the placement of, and access to, utility lines and structures, drainage basins, mailbox clusters, park lands, and common areas on the Final Map. 17. Direct vehicular access to Jefferson Street and Avenue 50 is restricted, except for those access points identified on the tentative parcel map, or as otherwise conditioned in these conditions of approval. The vehicular access restriction shall be shown on the recorded final parcel map. 18. The applicant shall furnish proof of easements, or written permission, as appropriate, from those owners of all abutting properties on which grading, retaining wall construction, permanent slopes, or other 367 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 6 of 22 encroachments will occur. 19. The applicant shall cause no easement to be granted, or recorded, over any portion of the subject property between the date of approval of the Tentative Parcel Map and the date of recording of any Final Map, unless such easement is approved by the City Engineer. STREET AND TRAFFIC IMPROVEMENTS 20. The applicant shall comply with the provisions of LQMC Sections 13.24.060 (Street Improvements), 13.24.070 (Street Design - Generally) & 13.24.100 (Access for Individual Properties and Development) for public streets. 21. Streets shall have vertical curbs or other approved curb configurations that will convey water without ponding, and provide lateral containment of dust and residue during street sweeping operations. Unused curb cuts on any lot shall be restored to standard curb height prior to final inspection of permanent building(s) on the lot. 22. The applicant shall construct the following street improvements to conform with the General Plan (street type noted in parentheses.) A. OFF-SITE STREETS 1) Jefferson Street (Major Arterial) a. Widen the west side of the street along frontage as necessary in order to accommodate deceleration/right turn only lanes serving the two entrances to the project. b. Reconstruct the existing landscaped median to provide the left turn in with physical left turn out restriction and restore the median landscaping. c. Class II bike lane as approved by the City Engineer d. Reconstruct sidewalk improvements as needed and applicant to reimburse City for sidewalk improvements made to applicant’s frontage through the City’s Capital 368 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 7 of 22 Improvement Program. 2) Avenue 50 (Primary Arterial) a. Widen the north side of the street along all frontage to the project boundary to its ultimate width on the north side as specified in the General Plan and the requirements of these conditions. Street widening improvements shall include all appurtenant components such as, but not limited to curb, gutter, traffic control striping, legends, and signs. b. A deceleration/right turn only lane serving the entrances to the project as approved by the City Engineer c. 12-foot wide landscaped median along the entire boundary of the project plus variable width as needed to accommodate for a left turn lane into the easterly Avenue 50 project entry and for a left turn lane for eastbound Avenue 50 traffic at the intersection of Avenue 50 and Jefferson Street as approved by the City Engineer. d. Class II bike lane as approved by the City Engineer e. 6-foot wide sidewalk—The applicant shall revise the site plan and landscape plan to include a non-curb adjacent 6-foot wide sidewalk along Avenue 50 at a minimum distance of 4 feet from the street curb. The site plan and landscape plan shall be reviewed and approved by the City Engineer and Planning Manager prior to construction. f. The applicant is responsible for the cost to design and install dual eastbound left turn lanes to northbound Jefferson Street when determined by the City Engineer and a traffic study prepared for the applicant per Engineering Bulletin #06-13 that the left-turn volumes cannot be adequately served by the single left-turn 369 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 8 of 22 lane. Applicant shall enter into a SIA to post separate security for the cost to design and install the dual eastbound left turn lanes. This obligation will remain in effect for 10 years after recordation of the final map unless otherwise approved by the City Engineer. 3) Jefferson Street/Avenue 50 Intersection: All necessary traffic signal modifications in the northwest quadrant of the intersection and any other modifications warranted by the timing and traffic generation of this development. 4) Other required improvements in the right-of-way and/or adjacent landscape setback area include: all appurtenant components such as, but not limited to: curb, gutter, traffic control striping, legends, and signs. The applicant is responsible for construction of all improvements mentioned above. The applicant shall extend improvements beyond the project boundaries to ensure they safely integrate with existing improvements (e.g., grading; traffic control devices and transitions in alignment, elevation or dimensions of streets and sidewalks). 23. General access points and turning movements of traffic are limited to the following: Jefferson Street (northerly): Right turn in, right turn out, and left turn in movements are permitted. Left turn out movements are prohibited. Jefferson Street (southerly): Right turn in and right turn out movements are permitted. Left turn in and left turn out movements are prohibited. Avenue 50 (westerly): Right turn in and right turn out movements are permitted. Left turn in and left turn out movements are prohibited. Avenue 50 (easterly): Full turn movements in and out are allowed. 24. Standard knuckles and corner cut-backs shall conform to Riverside County Standard Drawings #801 and #805, respectively, unless otherwise approved by the City Engineer. 25. The applicant shall install a transition for the eastbound Avenue 50 to 370 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 9 of 22 northbound Jefferson Street left turn lane that separates the turn lane from the left turn lane into the shopping center from eastbound Avenue 50. This transition will keep the left turn queue for Jefferson Street from backing up into the median break for the shopping center full turn movement. FINAL MAPS 26. Prior to the City’s approval of a Final Map, the applicant shall furnish accurate mylars of the Final Map. The Final Map shall be 1” = 40’ scale. PARKING and ACCESS POINTS 27. The design of parking facilities shall conform to LQMC Chapter 9.150 and in particular the following: A. The parking stall and aisle widths and the double hairpin stripe parking stall design shall conform to LQMC Chapter 9.150. B. Cross slopes should be a maximum of 2% where ADA accessibility is required including accessibility routes between buildings. C. Building access points shall be shown on the Precise Grading Plans to evaluate ADA accessibility issues can be evaluated. D. Accessibility routes to public streets and adjacent development shall be shown on the Precise Grading Plan. E. Parking stall lengths shall be according to LQMC Chapter 9.150 and be a minimum of 17 feet in length with a 2-foot overhang for standard parking stalls and 18 feet with a 2-foot overhang for handicapped parking stall or as approved by the City Engineer. One van accessible handicapped parking stall is required per 8 handicapped parking stalls. F. Drive aisles between parking stalls shall be a minimum of 26 feet with access drive aisles to Public Streets a minimum of 30 feet or as approved by the City Engineer. Entry drives, main interior circulation routes, corner cutbacks, bus turnouts, dedicated turn lanes, ADA accessibility route to public streets and other features shown on the approved construction plans, may 371 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 10 of 22 require additional street widths and other improvements as may be determined by the City Engineer. 28. The applicant shall design street pavement sections using CalTrans' design procedure for 20-year life pavement, and the site-specific data for soil strength and anticipated traffic loading (including construction traffic). Minimum structural sections shall be as follows: Parking Lot & Aisles (Low Traffic) 3.0" a.c./4.5" c.a.b. Parking Lot & Aisles (High Traffic) 4.5" a.c /5.5" c.a.b. Loading Areas 6” P.C.C./4” c.a.b. or the approved equivalents of alternate materials per the City Engineer. 29. The applicant shall submit current mix designs (less than two years old at the time of construction) for base, asphalt concrete and Portland cement concrete. The submittal shall include test results for all specimens used in the mix design procedure. For mix designs over six months old, the submittal shall include recent (less than six months old at the time of construction) aggregate gradation test results confirming that design gradations can be achieved in current production. The applicant shall not schedule construction operations until mix designs are approved. 30. Improvements shall include appurtenances such as traffic control signs, markings and other devices, raised medians if required, street name signs and sidewalks. Mid-block street lighting is not required. 31. Improvements shall be designed and constructed in accordance with City adopted standards, supplemental drawings and specifications, or as approved by the City Engineer. Improvement plans for streets, access gates and parking areas shall be stamped and signed by engineers registered in California. IMPROVEMENT PLANS As used throughout these Conditions of Approval, professional titles such as “engineer,” “surveyor,” and “architect,” refer to persons currently certified or licensed to practice their respective professions in the State of California. 32. Improvement plans shall be prepared by or under the direct supervision of qualified engineers and/or architects, as appropriate, and shall comply 372 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 11 of 22 with the provisions of LQMC Section 13.24.040 (Improvement Plans). 33. The following improvement plans shall be prepared and submitted for review and approval by the Development Services Division. A separate set of plans for each line item specified below shall be prepared. The plans shall utilize the minimum scale specified, unless otherwise authorized by the City Engineer in writing. Plans may be prepared at a larger scale if additional detail or plan clarity is desired. Note, the applicant may be required to prepare other improvement plans not listed here pursuant to improvements required by other agencies and utility purveyors. A. On-Site Rough Grading Plan 1" = 40' Horizontal B. PM10 Plan 1” = 40’ Horizontal C. Erosion Control Plan 1” = 40’ Horizontal D. WQMP (Plan submitted in Report Form) NOTE: A through D to be submitted concurrently. E. Off-Site Street Improvement/Storm Drain Plan 1" = 40' Horizontal, 1" = 4' Vertical F. Off-Site Signing & Striping Plan 1” = 40’ Horizontal The Off-Site street improvement plans shall have separate plan sheet(s) (drawn at 20 scale) that show the meandering sidewalk, mounding, and berming design in the combined parkway and landscape setback area. G. On Site Sewer and Water Improvement Plan 1" = 40' Horizontal H. On-Site Street Improvements/Signing & Striping/Storm Drain Plan 1" = 40' Horizontal, 1"= 4' Vertical I. On-Site Precise Grading Plan 1” = 30’ Horizontal (Separate Storm Drain Plans if applicable) 373 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 12 of 22 Other engineered improvement plans prepared for City approval that are not listed above shall be prepared in formats approved by the City Engineer prior to commencing plan preparation. All Off-Site Plan & Profile Street Plans and Signing & Striping Plans shall show all existing improvements for a distance of at least 200-feet beyond the project limits, or a distance sufficient to show any required design transitions. All On-Site Signing & Striping Plans shall show, at a minimum; Stop Signs, Limit Lines and Legends, No Parking Signs, Raised Pavement Markers (including Blue RPMs at fire hydrants) and Street Name Signs per Public Works Standard Plans and/or as approved by the Engineering Department. “Rough Grading” plans shall normally include perimeter walls with Top Of Wall & Top Of Footing elevations shown. All footings shall have a minimum of 1-foot of cover, or sufficient cover to clear any adjacent obstructions. The applicant shall prepare an accessibility assessment on a marked up print of the building floor plan identifying every building egress and notes the 2016 California Building Code accessibility requirements associated with each door. The assessment must comply with submittal requirements of the Building & Safety Division. “On-Site Precise Grading” plans shall normally include all on-site surface improvements including but not limited to finish grades for curbs & gutters, building floor elevations, wall elevations, parking lot improvements and ADA requirements. 34. The City maintains standard plans, detail sheets and/or construction notes for elements of construction which can be accessed via the “Plans, Notes and Design Guidance” section of the Design and Development Department at the City website (www.la-quinta.org). Please navigate to the Design and Development Department home page and look for the Standard Drawings hyperlink. 35. The applicant shall furnish a complete set of all approved improvement plans on a storage media acceptable to the City Engineer (currently mylars). 374 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 13 of 22 36. Upon completion of construction, and prior to final acceptance of the improvements by the City, the applicant shall furnish the City with reproducible record drawings of all improvement plans which were approved by the City. Each sheet shall be clearly marked "Record Drawing" and shall be stamped and signed by the engineer or surveyor certifying to the accuracy and completeness of the drawings. The applicant shall have all approved mylars previously submitted to the City, revised to reflect the as-built conditions. The applicant shall employ or retain the Engineer Of Record during the construction phase of the project so that the EOR can make site visits in support of preparing "Record Drawing". However, if subsequent approved revisions have been approved by the City Engineer and reflect said "Record Drawing" conditions, the Engineer Of Record may submit a letter attesting to said fact to the City Engineer in lieu of mylar submittal. IMPROVEMENT SECURITY AGREEMENTS 37. Prior to approval of any Final Map, the applicant shall construct all on and off-site improvements and satisfy its obligations for same, or shall furnish a fully secured and executed Subdivision Improvement Agreement (“SIA”) guaranteeing the construction of such improvements and the satisfaction of its obligations for same, or shall agree to any combination thereof, as may be required by the City. 38. Any Subdivision Improvement Agreement (“SIA”) entered into by and between the applicant and the City of La Quinta, for the purpose of guaranteeing the completion of any improvements related to this Tentative Parcel Map, shall comply with the provisions of LQMC Chapter 13.28 (Improvement Security). 39. Prior to constructing any off-site improvements, the applicant shall deposit securities equivalent to both a Performance and Labor & Material Bonds each valued at 100% of the cost of the off-site improvements, or as approved by the City Engineer. 40. Improvements to be made, or agreed to be made, shall include the removal of any existing structures or other obstructions which are not a part of the proposed improvements; and shall provide for the setting of the final survey monumentation. 41. When improvements are phased through a “Phasing Plan,” or an administrative approval (e.g., Site Development Permits), all off-site 375 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 14 of 22 improvements and common on-site improvements (e.g., backbone utilities, retention basins, perimeter walls, landscaping and gates) shall be constructed, or secured, prior to the issuance of any permits in the first phase of the development, or as otherwise approved by the City Engineer. Improvements and obligations required of each subsequent phase shall either be completed, or secured, prior to the completion of homes or the occupancy of permanent buildings within such latter phase, or as otherwise approved by the City Engineer. In the event the applicant fails to construct the improvements for the development, or fails to satisfy its obligations for the development in a timely manner, pursuant to the approved phasing plan, the City shall have the right to halt issuance of all permits, and/or final inspections, withhold other approvals related to the development of the project, or call upon the surety to complete the improvements. 42. Depending on the timing of the development of this Tentative Parcel Map, and the status of the off-site improvements at the time, the applicant may be required to: A. Construct certain off-site improvements. B. Construct additional off-site improvements, subject to the reimbursement of its costs by others. C. Reimburse others for those improvements previously constructed that are considered to be an obligation of this Tentative Parcel Map. D. Secure the costs for future improvements that are to be made by others. E. To agree to any combination of these actions, as the City may require. Off-Site Improvements should be completed on a first priority basis. The applicant shall complete Off-Site Improvements in the first phase of construction or by the issuance of the 20% Building Permit. In the event that any of the improvements required for this development are constructed by the City, the applicant shall, prior to the approval of 376 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 15 of 22 the Final Map, or the issuance of any permit related thereto, reimburse the City for the costs of such improvements. 43. If the applicant elects to utilize the secured agreement alternative, the applicant shall submit detailed construction cost estimates for all proposed on-site and off-site improvements, including an estimate for the final survey monumentation, for checking and approval by the City Engineer. Such estimates shall conform to the unit cost schedule as approved by the City Engineer. Estimates for improvements under the jurisdiction of other agencies shall be approved by those agencies and submitted to the City along with the applicant’s detailed cost estimates. Security will not be required for telephone, natural gas, or Cable T.V. improvements. 44. Should the applicant fail to construct the improvements for the development, or fail to satisfy its obligations for the development in a timely manner, the City shall have the right to halt issuance of building permits, and/or final building inspections, withhold other approvals related to the development of the project, or call upon the surety to complete the improvements. GRADING 45. The applicant shall comply with the provisions of LQMC Section 13.24.050 (Grading Improvements). 46. Prior to occupancy of the project site for any construction, or other purposes, the applicant shall obtain a grading permit approved by the City Engineer. 47. To obtain an approved grading permit, the applicant shall submit and obtain approval of all of the following: A. A grading plan prepared by a civil engineer registered in the State of California, B. A preliminary geotechnical (“soils”) report prepared by an engineer registered in the State of California, C. A Fugitive Dust Control Plan prepared in accordance with LQMC Chapter 6.16, (Fugitive Dust Control), and 377 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 16 of 22 D. A Best Management Practices report prepared in accordance with LQMC Sections 8.70.010 and 13.24.170 (NPDES Stormwater Discharge Permit and Storm Management and Discharge Controls). E. A WQMP prepared by an appropriate professional registered in the State of California. All grading shall conform with the recommendations contained in the Preliminary Soils Report, and shall be certified as being adequate by soils engineer, or engineering geologist registered in the State of California. The applicant shall furnish security, in a form acceptable to the City, and in an amount sufficient to guarantee compliance with the approved Fugitive Dust Control Plan provisions as submitted with its application for a grading permit. Additionally, the applicant shall replenish said security if expended by the City of La Quinta to comply with the Plan as required by the City Engineer. 48. The applicant shall maintain all open graded, undeveloped land in order to prevent wind and/or water erosion of such land. All open graded, undeveloped land shall either be planted with interim landscaping, or stabilized with such other erosion control measures, as were approved in the Fugitive Dust Control Plan. 49. Grading within the perimeter setback and parkway areas shall have undulating terrain and shall conform with the requirements of LQMC Section 9.60.240(F) except as otherwise modified by this condition. The maximum slope shall not exceed 3:1 anywhere in the landscape setback area, except for the backslope (i.e. the slope at the back of the landscape lot) which shall not exceed 2:1 if fully planted with ground cover. The maximum slope in the first six (6) feet adjacent to the curb shall not exceed 4:1 when the nearest edge of sidewalk is within six feet (6’) of the curb, otherwise the maximum slope within the right of way shall not exceed 3:1. All unpaved parkway areas adjacent to the curb shall be depressed one and one-half inches (1.5") in the first eighteen inches (18") behind the curb. 50. Building pad elevations on the rough grading plan submitted for City Engineer’s approval shall conform with pad elevations shown on the tentative map, unless the pad elevations have other requirements imposed elsewhere in these Conditions of Approval, or as approved by the City Engineer. 378 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 17 of 22 51. Building pad elevations of perimeter lots shall not differ by more that one foot higher from the building pads in adjacent developments. 52. The applicant shall minimize the differences in elevation between the adjoining properties and the lots within this development. 53. Prior to any site grading or regrading that will raise or lower any portion of the site by more than plus or minus half of a foot (0.5’) from the elevations shown on the approved Tentative Parcel Map, the applicant shall submit the proposed grading changes to the City Engineer for a substantial conformance review. 54. Prior to the issuance of a building permit for any building lot, the applicant shall provide a lot pad certification stamped and signed by a qualified engineer or surveyor with applicable compaction tests and over excavation documentation. Each pad certification shall list the pad elevation as shown on the approved grading plan, the actual pad elevation and the difference between the two, if any. Such pad certification shall also list the relative compaction of the pad soil. The data shall be organized by lot number, and listed cumulatively if submitted at different times. DRAINAGE 55. Stormwater handling shall conform with the approved hydrology and drainage report for the Pavilions Plaza Commercial Development project (TPM37370 and SDP2017-0009), or as approved by the City Engineer. Nuisance water shall be disposed of in an approved manner. Nuisance water shall be retained onsite and disposed of via an underground percolation improvement approved by the City Engineer. 56. The applicant shall comply with the provisions of LQMC Section 13.24.120 (Drainage), Retention Basin Design Criteria, Engineering Bulletin No. 06- 16 – Hydrology Report with Preliminary Hydraulic Report Criteria for Storm Drain Systems and Engineering Bulletin No. 06-015 - Underground Retention Basin Design Requirements. More specifically, stormwater falling on site during the 100 year storm shall be retained within the development, unless otherwise approved by the City Engineer. The design storm shall be the 1 hour, 3 hour, 6 hour or 24 hour event producing the greatest total run off. 379 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 18 of 22 57. Nuisance water shall be retained on site. Nuisance water shall be disposed of per approved methods contained in Engineering Bulletin No. 06-16 – Hydrology Report with Preliminary Hydraulic Report Criteria for Storm Drain Systems and Engineering Bulletin No. 06-015 - Underground Retention Basin Design Requirements. 58. In design of retention facilities, the maximum percolation rate shall be two inches per hour. The percolation rate will be considered to be zero unless the applicant provides site specific data indicating otherwise and as approved by the City Engineer. 59. The project shall be designed to accommodate purging and blowoff water (through underground piping and/or retention facilities) from any on-site or adjacent well sites granted or dedicated to the local water utility authority as a requirement for development of this property. 60. No fence or wall shall be constructed around any retention basin unless approved by the Planning Manager and the City Engineer. 61. For on-site above ground common retention basins, retention depth shall be according to Engineering Bulletin No. 06-16 – Hydrology Report with Preliminary Hydraulic Report Criteria for Storm Drain Systems. Side slopes shall not exceed 3:1 and shall be planted with maintenance free ground cover. Additionally, retention basin widths shall be not less than 20 feet at the bottom of the basin. 62. Stormwater may not be retained in landscaped parkways or landscaped setback lots. Only incidental storm water (precipitation which directly falls onto the setback) will be permitted to be retained in the landscape setback areas. The perimeter setback and parkway areas in the street right-of-way shall be shaped with berms and mounds, pursuant to LQMC Section 9.100.040(B)(7). 63. The design of the development shall not cause any increase in flood boundaries and levels in any area outside the development. 64. The development shall be graded to permit storm flow in excess of retention capacity to flow out of the development through a designated overflow and into the historic drainage relief route. 65. Storm drainage historically received from adjoining property shall be received and retained or passed through into the historic downstream 380 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 19 of 22 drainage relief route. 66. The applicant shall comply with applicable provisions for post construction runoff per the City’s NPDES stormwater discharge permit, LQMC Sections 8.70.010 et seq. (Stormwater Management and Discharge Controls), and 13.24.170 (Clean Air/Clean Water); Riverside County Ordinance No. 457; and the California Regional Water Quality Control Board – Colorado River Basin (CRWQCB-CRB) Region Board Order No. R7-2013-0011. A. For post-construction urban runoff from New Development and Redevelopments Projects, the applicant shall implement requirements of the NPDES permit for the design, construction and perpetual operation and maintenance of BMPs per the approved Water Quality Management Plan (WQMP) for the project as required by the California Regional Water Quality Control Board – Colorado River Basin (CRWQCB-CRB) Region Board Order No. R7- 2013-0011. B. The applicant shall implement the WQMP Design Standards per (CRWQCB-CRB) Region Board Order No. R7-2013-0011 utilizing BMPs approved by the City Engineer. A project specific WQMP shall be provided which incorporates Site Design and Treatment BMPs utilizing first flush infiltration as a preferred method of NPDES Permit Compliance for Whitewater River receiving water, as applicable. C. The developer shall execute and record a Stormwater Management/BMP Facilities Agreement that provides for the perpetual maintenance and operation of stormwater BMPs. UTILITIES 67. The applicant shall comply with the provisions of LQMC Section 13.24.110 (Utilities). 68. The applicant shall obtain the approval of the City Engineer for the location of all utility lines within any right-of-way, and all above-ground utility structures including, but not limited to, traffic signal cabinets, electric vaults, water valves, and telephone stands, to ensure optimum placement for practical and aesthetic purposes. 69. Existing overhead utility lines within, or adjacent to the proposed 381 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 20 of 22 development, and all proposed utilities shall be installed underground. The 92 KV transmission power poles and all existing utility lines attached to joint use 92 KV transmission power poles are exempt from the requirement to be placed underground. 70. Underground utilities shall be installed prior to overlying hardscape. For installation of utilities in existing improved streets, the applicant shall comply with trench restoration requirements maintained, or required by the City Engineer. The applicant shall provide certified reports of all utility trench compaction for approval by the City Engineer. Additionally, grease traps and the maintenance thereof shall be located as to not conflict with access aisles/entrances. CONSTRUCTION 71. The City will conduct final inspections of habitable buildings only when the buildings have improved street and (if required) sidewalk access to publicly-maintained streets. The improvements shall include required traffic control devices, pavement markings and street name signs. LANDSCAPE AND IRRIGATION 72. The applicant shall comply with LQMC Sections 13.24.130 (Landscaping Setbacks) & 13.24.140 (Landscaping Plans). 73. Landscape and irrigation plans for landscaped lots and setbacks, medians, retention basins, and parks shall be signed and stamped by a licensed landscape architect. 74. All new and modified landscape areas shall have landscaping and permanent irrigation improvements in compliance with the City’s Water Efficient Landscape regulations contained in LQMC Section 8.13 (Water Efficient Landscape). 75. Lighting plans shall be submitted with the final landscaping plans for a recommendation to the Planning Commission for their approval. Exterior lighting shall be consistent with LQMC Section 9.100.150 (Outdoor Lighting) and 9.150.080 (Parking Facility Design Standards). All freestanding lighting shall not exceed 20 feet in height and shall be 382 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 21 of 22 shielded to minimize trespass of ligh t off the property. Security lighting along the west elevation of the anchor building shall be installed below 20 ft. in height and shall be shielded to minimize trespass of light off the property and not shine directly onto neighboring residences. Any illuminated carports shall be included in the photometric study as part of the final lighting plan submittal. 76. All water features shall be designed to minimize “splash”, and use high efficiency pumps and lighting to the satisfaction of the Planning Manager. They shall be included in the landscape plan water efficiency calculations per Municipal Code Chapter 8.13. 77. All rooftop mechanical equipment shall be completely screened from view. Utility transformers or other ground mounted mechanical equipment shall be fully screened with a screening wall or landscaping and painted to match the adjacent buildings. 78. The applicant shall submit the final landscape plans for review, processing and approval to the Design and Development Department, in accordance with the Final Landscape Plan application process. Planning Commission approval of the final landscape plans is required prior to issuance of the first building permit. NOTE: Plans are not approved for construction until signed by the appropriate City official, including the Planning Manager and/or City Engineer. 79. The applicant or his agent has the responsibility for proper sight distance requirements per guidelines in the AASHTO “A Policy on Geometric Design of Highways and Streets, 5th Edition” or latest, in the design and/or installation of all landscaping and appurtenances abutting and within the private and public street right-of-way. 80. The final design of the perimeter landscaping, particularly the perimeter wall, shall be included with the Final Landscape Plan submittal. 81. All vacant pads shall be planted with drought tolerant landscaping and decomposed granite and shall include fencing as appropriate so long as they are vacant. The installation of all landscaping and decomposed granite, and fencing as appropriate, shall be completed prior to the issuance of Certificate of Occupancy of the Pavilions store. Any landscaping on vacant pads shall be irrigated and maintained regularly. 383 CITY COUNCIL RESOLUTION 2020- CONDITIONS OF APPROVAL - RECOMMENDED TENTATIVE PARCEL MAP 2017-0003 (TPM 37370) PAVILION PALMS SHOPPING CENTER ADOPTED: Page 22 of 22 The final landscape plan for the project shall include plans for fencing, landscaping, irrigation (as applicable), and maintenance for vacant pads. The final landscape plan must be reviewed and approved by the Planning Commission at a public hearing prior to construction. PUBLIC SERVICES 82. The applicant shall provide public transit improvements if required by SunLine Transit Agency and approved by the City Engineer. MAINTENANCE 83. The applicant shall comply with the provisions of LQMC Section 13.24.160 (Maintenance). 84. The applicant shall make provisions for the continuous and perpetual maintenance of perimeter landscaping up to the curb, common areas, access drives, sidewalks, and stormwater BMPs. FEES AND DEPOSITS 85. The applicant shall comply with the provisions of LQMC Section 13.24.180 (Fees and Deposits). These fees include all deposits and fees required by the City for plan checking and construction inspection. Deposits and fee amounts shall be those in effect when the applicant makes application for plan check and permits. 384 $77$&+0(17 385 Fairway Plaza Shopping Center Specific Plan Amendment #2 La Quinta, CA Original Approval: Specific Plan No. 98-034 La Quinta City Council Resolution 99-63, Adopted May 18, 1999 Amendment No. 1 - 98-034 Amended Adopted September 19, 2002 Amendment No. 2 Adopted _______ Applicant Lundin Development Company 16400 Pacific Coast Highway, Suite 207 Huntington Beach, California 92649 Preparer: Jericho Systems, Inc. 47 N. First Street, 1st Street Redlands, CA 92373 (909) 307-5633 Amendment #2 Prepared March 2018 386 TABLE OF CONTENTS 1 SUMMARY ............................................................................................................................ 1 1.1 Purpose ....................................................................................................................... 2 1.1.1 Relationship to the General Plan....................................................................2 1.1.2 Relationship to Zoning ................................................................................... 3 1.2 Specific Plan Summary .............................................................................................. 4 1.2.1 Project Summary ............................................................................................ 4 1.2.2 Project Objectives .......................................................................................... 4 1.2.3 Project Characteristics ................................................................................... 4 1.2.4 Master Design Theme .................................................................................... 5 2 MASTER PLAN .................................................................................................................... 6 2.1 Project Description.....................................................................................................6 2.2 Grading ...................................................................................................................... 6 2.2.1 Undeveloped Land ......................................................................................... 6 2.2.2 Flood Protection ............................................................................................. 7 2.3 Drainage ..................................................................................................................... 7 2.3.1 Drainage Plan Description ............................................................................. 7 2.4 Water ........................................................................................................................ 12 2.4.1 Water Service Description ........................................................................... 12 2.5 Sewage Disposal ...................................................................................................... 12 2.5.1 Sewer Service Description ........................................................................... 12 2.6 Utilities ..................................................................................................................... 12 2.6.1 Existing Utilities .......................................................................................... 12 2.6.2 Underground Utilities .................................................................................. 13 2.7 Circulation................................................................................................................13 2.7.1 Project Area Background ............................................................................. 13 2.7.2 Circulation Description ................................................................................ 13 2.7.3 Public Transportation ................................................................................... 14 2.7.4 Street and Traffic Improvements ................................................................. 14 2.7.5 On-Site Traffic Circulation Plan ................................................................. 16 2.7.6 Construction/Financing of Improvements ͒ ................................................ 17 2.8 Signage ..................................................................................................................... 17 2.9 Landscape Concept .................................................................................................. 18 2.9.1 Development Standards ............................................................................... 18 2.10 Maintenance of the Shopping Center ....................................................................... 20 3 SPECIFIC PLAN ................................................................................................................ 21 3.1 Land Use .................................................................................................................. 21 3.2 Cultural/Archaeology ............................................................................................... 21 3.2.1 Tribal Consultation, SB18 and AB52 .......................................................... 21 3.3 Paleontology ............................................................................................................ 22 3.4 Environmental .......................................................................................................... 23 3.4.1 Air Quality ................................................................................................... 23 3.4.2 Greenhouse Gas ........................................................................................... 23 3.4.3 Noise ............................................................................................................ 24 3.4.4 Trash Recycling ........................................................................................... 24 3.5 Zoning ...................................................................................................................... 25 387 3.5.1 Zoning Standards ......................................................................................... 25 3.5.2 Deviations from Zoning Code ..................................................................... 25 3.5.3 Permitted Uses ............................................................................................. 28 3.6 Specific Design Features..........................................................................................29 3.6.1 Screen Wall .................................................................................................. 29 3.6.2 Screening of Rooftop Equipment................................................................. 29 3.6.3 Utility Enclosures.........................................................................................29 3.6.4 Cart Storage ................................................................................................. 29 3.6.5 Exterior Lighting .......................................................................................... 30 3.7 Property Rights ........................................................................................................ 30 3.8 Administration ......................................................................................................... 31 FIGURES Figure 1 Site Plan ATTACHMENTS Attachment 1 Lighting Plan Attachment 2 Preliminary Landscape Plans Attachment 3 Preliminary Grading Plans Attachment 4 Conditions of Approval Fairway Shopping Center Specific Plan 388 Fairway Plaza Shopping Center Specific Plan Amendment No. 2 Pavilion Palms Shopping Center (Project renamed) CITY OF LA QUINTA City of La Quinta, PO Box 1504, La Quinta, CA 92253-1504 City Council Linda Evans, Mayor Kathleen Fitzpatrick, Mayor Pro Tem John Peña, Council Member Robert Radi, Council Member Steve Sanchez, Council Member Planning Commission Mary Caldwell (Chair) Michael Proctor (Vice Chair) Stephen Nieto, Commissioner Kevin McCune, Commissioner Taylor Libolt Varner, Commissioner Philip Bettencourt, Commissioner Loretta Currie, Commissioner City Staff Jon Millen, City Manager Danny Castro, Design and Development Director 389 Insert site planFigure 1Site PlanInsert site planFigurerereeererereeererereerereererereeeererereeereeererereeeeeeeeeereeeeeereeeeeeeeeereereeerre 11111111111111111111111111111111111111111111111111SSSiSSSiiSiSSSiSiStePPPPPllanEXHIBIT REPLACED IN AMENDMENT NO. 2390 391 392 393 1 SUMMARY In May 1999, the City of La Quinta approved the Rancho Cielo Shopping Center Specific Plan and associated parcel map, proposed by Lundin Development. The Specific Plan identified the development of 111,000 square feet of a supermarket-anchored shopping center with an associated fuel center and adjacent pads for retail and restaurant uses on 12.5 acres at the northwest corner of Jefferson Street and 50th Avenue. The parcel is designated and zoned for Community Commercial (CC) use. The Specific Plan approval included the adoption of a Mitigated Negative Declaration under the California Environmental Quality Act (CEQA). In 2002, an amendment to the Specific Plan (renamed to Fairway Plaza Shopping Center) was adopted that identified approximately 100,460 square feet of grocery store/pharmacy with fuel center and adjacent retail and restaurant uses. To date, Lundin Development has yet to construct the Project. On February 19. 2013, the City of La Quinta adopted the Environmental Impact Report (EIR) for its 2035 General Plan (SCH# 2010111094) which included the impacts of adding to commercial uses within the City, including the approved Fairway Plaza Shopping Center Specific Plan. A Statement of Overriding Considerations was also adopted for environmental impacts that could not be mitigated to a level below significance for: Air Quality, Greenhouse Gas, and Traffic (Resolution 2013-009). In 2018, the Lundin Development is requesting Amendment No. 2 to the Fairway Plaza Shopping Center Specific Plan to construct 125,800 square feet of grocery store/pharmacy with fuel center and adjacent retail and restaurant uses. In 2019, the Project was reduced to 119,195 square feet. The Project under Amendment 2 will occur on the same 12.5-acre site at the corner of Jefferson Street and 50th Avenue, within the same area of the previously-approved Specific Plan, with uses similar to that which were already identified. Highlights of Amendment No. 2 include the following: x Renames “The Fairway Plaza Shopping Center” to the “The Pavilion Palms Shopping Center” x Adds 18,735 square feet of retail and ancillary uses similar to that which was previously approved. x The supermarket anchor tenant has changed from Albertsons to Pavilions x Eliminates references to components of the Project that have already been constructed between 1999 to date (i.e., such as the retaining wall between the commercial parcel and residential area and the requirement for a retention basin for residential area, both of which have been constructed) x Identifies changes in ingress/egress (i.e., two driveways in Avenue 50 instead of one, and the elimination of the access from Derek Alan Drive) x Stormwater will be managed by an underground system, instead of open retention basins. x The architectural components have been revised from Spanish/Mediterranean to Contemporary. 394 1.1 Purpose The purpose of this Specific Plan Amendment No. 2 is to provide an overview and analysis of the proposed Project for the property located at the northwest corner of Avenue 50 and Jefferson Street. The subject site in this report shall be referred to as the "Fairway Plaza Shopping Center." Additionally, this document augments the City's Zoning Code in terms of establishing permitted uses and setting forth particular design guidelines and development standards that are unique to the developer and anchor tenant..It should be noted that where this document is silent on any matter, the City's Zoning Code shall apply. The Conditions of Approval as approved for the original Specific Plan by the City of La Quinta are contained within Appendix "A" and as approved development standards, are incorporated by reference. 1.1.1 Relationship to the General Plan The development of the Fairway PlazaPavilion Palms Shopping Center will be implemented to carry out the goals and policies contained in the General Plan. All development within this Project will be consistent with the provisions of the CC ("Community GC ("General Commercial") General Plan designation. Among the important provisions of the General Plan, which will be implemented upon the development of this Project, are the following: Land Use The proposed Project is consistent with the CCGC General Plan designation for this site. The Project represents approximately 0.22 FAR ([Floor Area Ratio] gross floor area ratio ("FAR"), which describesof all buildings divided by the average building floor area to net site area, is 0.187,), or 18.72%. The shopping center will be comprised primarily of retail businesses to serve the needs22 percent, which is consistent with the CC Zoning designation of a multiple neighborhood area.0.30 Maximum FAR.Tenants will include a grocery supermarket, drug store with pharmacy and associated fuel center, retail shops, drive-thruand restaurants, professional services and office uses, and an automobile with drive-through service station. These uses are consistent with those outlined for the CommunityGeneral Commercial designation. Additionally, walking, bicycling, and public transit will be encouraged by the design features of this Project. Circulation The Circulation Element of the General Plan outlines the design and location of required street improvements to complete the transportation system in the City of La Quinta. The Fairway PlazaPavilion Palms Shopping Center will widen and/or improve adjacent portions of both Jefferson Street, a major arterial, and Avenue 50, a primary arterial, according to General Plan standards. 395 Roadway Image Corridors In addition to roadway improvements, the Project will implement special roadway corridor improvements consistent with the unique character that the City of La Quinta requires. Improvements will include pedestrian walks, street name signs, and landscaping consistent with the themes suggested by the General Plan. 50th Avenue 50, being a secondary image corridor, will incorporate the appearance of low profile, indigenous canopyscreening type trees, limiting palm trees to node areas and shrubs (i.e., main entries and street intersections).oleanders). Jefferson Street and Avenue 50, being image corridors, will incorporate the appearance of screening type trees and shrubs. Water Quantity and Quality This Specific Plan outlines the use of drought tolerant planting and irrigation techniques, and incorporates a grading concept designed to retain storm water on-site as required by the City of La Quinta as per Condition No. 23 of the original Conditions of Approval of this Specific Plan. The Project is subject to regional and local regulations, including the need for an SWPPP under the NPDES General Permit for Storm Water Discharges Associated with Construction Activity (Construction General Permit) (Order No. 2009-0009-DWQ, NPDES No. CAR000002). In addition, the City requires a grading permit for all developments that would require grading. Compliance with SWRCB’s General Construction Activity Stormwater Permit regulations requiring a SWPPP, and the grading permit required by the City would ensure water quality standards are not exceeded. The Project will create an impermeable surface over much of the entire site when complete. This can increase the potential for pollutants to occur in surface water primarily be from cars parked in the parking lot leaking fluids. However, the Project includes an underground system to collect all of the stormwater runoff from the Project site. A Water Quality Management Plan (WQMP) is proposed to be developed for the Project that will identify Best Management Practices for maintenance of the system. 1.1.2 Relationship to Zoning The development of this Project will be consistent with the purpose and intent of the Community Commercial zone. As stated above, this document augments the City's Zoning Code in establishing permitted uses and setting forth particular design guidelines and development standards that are unique to the developer and anchor tenant..It should be noted that where this document is silent on any matter, the City's Zoning Code shall apply. As noted above in Section 1.1, the original Conditions of Approval as approved for this Specific Plan are contained within Appendix "A" and are incorporated by reference. For further discussion of zoning see Section 3.5 of this Specific Plan. 396 1.2 Specific Plan Summary 1.2.1 Project Summary The proposed Fairway PlazaPavilion Palms Shopping Center Project is a 12.5 -acre site located at the northwest corner of Avenue 50 and Jefferson Street. This site is immediately adjacent to the City limits of the City of Indio and will provide approximately 100,460 119,195 square feet of retailmixed-use commercial space with accommodating parking and landscaping areas. The Pavilion Palms Shopping Center will widen and/or improve adjacent portions of both Jefferson Street, a major arterial, and Avenue 50, a primary arterial, according to General Plan standards. The Project will implement special roadway corridor improvements consistent with the unique character that the City of La Quinta requires. Improvements will include pedestrian walks, street name signs, and landscaping consistent with the themes suggested by the General Plan. Avenue 50, being a secondary image corridor, will incorporate the appearance of screening type trees and shrubs (i.e., oleanders). Jefferson Street and Avenue 50, being image corridors, will incorporate the appearance of screening type trees and shrubs. 1.2.2 Project Objectives This Project has been developed to provide retail and commercial space that will be easily available to the majority of people in the eastern and central Coachella Valley. The Project will provide additional retail shopping facilities, drive-thru restaurants, and a service station that in addition to accommodating La Quinta residents, will also serve the needs of residents from Palm Desert, Bermuda Dunes, Indian Wells, La Quinta, Indio, and beyond. 1.2.3 Project Characteristics Based on additional preliminary studies of the Fairway PlazaPavilion Palms Shopping Center Project, the following conclusions have been drawn: • The site has unencumbered direct access via Jefferson Street, from Interstate 1Oto10 to Avenue 50. • The subject parcel, located on a corner, draws special advantages with direct access to both Avenue 50 and Jefferson Street as arterials.͒Both the required zoning and general plan designation allow for this development on this site.. x Both the required zoning and general plan designation allow for this development on this site. • This Project will place a commercial development of a viable size which could be absorbed by the area market located near the perimeters of the City of La Quinta, thus providing the City the opportunity to additionally draw from the greater Indio market area with its concentration of stable, year-round resident families. 397 1.2.4 Master Design Theme La Quinta includes a mixture of building types built over various time periods, and with a variety of architectural styles. Development includes structures built in the early twentieth century, and new master-planned communities built within the last decade. Architectural styles include those typical of Spanish Colonial, Mediterranean, Tuscan, and Modern styles. Spanish Colonial architecture is the most prevalent style used in La Quinta, and examples include the La Quinta Resort & Spa and Old Towne in the Village. The Fairway PlazaPavilion Palms Shopping Center is designed in a traditional Spanish Mediterranean architectural style using arched colonnades with tile roofsContemporary that will generally utilize traditional materials such as glass, wood, brick, and various metals. Additional architectural elements such as textured finishes, roundels, accent tile and raised trellises will be used to provide further details and interest, thus further enhancing the individual buildings and the quality appearance of the shopping center in general. The landscaped setbacks along Avenue 50 and Jefferson Street will incorporate meandering sidewalks with Americans with Disabilities Act (ADA) access as well as landscaping that will include a variety of trees, shrubs and flowers, which accompanied by the parking lot landscaping, should provide an inviting atmosphere to draw shoppers to the center. 398 2 MASTER PLAN 2.1 Project Description The Fairway PlazaPavilion Palms Shopping Center will provide approximately 100,460 119,195 square feet of restaurant, /retail commercial space when complete. The Project consists of one combinationwill be anchored by Pavilions grocery store/ with a pharmacy, "Albertsons-Sav-On", as the major anchor, with 57,560 that will occupy 63,000 square feet.Albertsons will combine the sale of groceries with the off-sale of beer, wine and hard liquor, and a drive thru pharmacy. There are also sevenAdditionally, 11 other proposed retail buildings, each ranging from 2,2003,000 to 8,50011,700 square feet each. These will contain a variety of retail uses including two drive-thru, will be occupied by restaurants and an automobile service station and possibly a car wash. (The developer understands that a Conditional Use Permit will be necessary for the automobile service station)., banks, and retail units, as well as a fuel center/convenience market that is associated with the Pavilions. Parking for at least 474 cars, includingincludes 546 stalls, which includes compact and handicap spaces and shall include a minimum of 12 electric vehicle charging stations. will be provided.. 2.2 Grading The grading plan will conform to the recommendations of the soilsgeotechnical report and prepared for the site in 1998 and updated in 2017 (Landmark Geo-Engineers and Geologists, August 25, 2017). The site is relatively flat and contains sparse desert scrub. Soil balancing will be certified as adequate by a soils engineerused during grading so that there will be no soil import or engineering geologistexport. The desert scrub brush on site will be removed or buried depending on size and type. 2.2.1 Undeveloped Land Graded, undeveloped portions of the site anticipating future construction will be maintained to prevent dust and blows and nuisances. These undeveloped portions of the site shall be planted with interim landscaping or provided with other wind and water erosion control measures approved by the Design and Development DepartmentCommunity Development and Public Works Departments. As per Condition No. 22 of the original Conditions of Approval for this Specific Plan, (Attachment 4), prior to occupation of the Project site for construction purposes, the applicant will provide for City approval a fugitive dust control plan prepared in accordance with Chapter 6.16 of the La Quinta Municipal Code, and the applicant will furnish security to the City in a form deemed acceptable to the City, in an amount sufficient to guarantee compliance with the provisions of the permit. Vacant undeveloped pads shall be planted with drought tolerant landscaping and/or decomposed granite and shall include fencing as appropriate so long as they are vacant. Landscaping on vacant pads shall be irrigated and maintained regularly. The final landscape plan for the project shall include plans for fencing, landscaping, irrigation, and maintenance for vacant pads. The final landscape plan must be reviewed and approved by the Planning Commission at a public hearing prior to construction. 399 2.2.2 Flood Protection According to the August 19, 1991 Flood Insurance Rate Map published by the Federal Emergency Management Agency ("FEMA"), this Project site is not located within a designated flood hazard zone. 2.3 Drainage 2.3.1 Drainage Plan Description Project site is situated on the north side of Avenue 50 and west of Jefferson Street. The southeast portionentire parcel is generally flat with the remainder of the parcel consisting of natural and man- made, graded dunes. The topography is, slightly irregular,with a general gradient sloping to the south and the east. The storm water runoff from the parking area will generally sheet flow to the east and the southeast. The points of flow concentration will be picked up in the future underground storm drain system that will terminate in an on-site retention basins.,.underground storage system.The design of the development shall not cause any increase in flood levels or frequencies in any area outside the development. Storm water falling on site during the peak 24-hour period of a 100-year storm (the design storm) shall be retained within the development unless otherwise approved by the City Engineer. The tributary drainage area shall extend to the right-of-way of the adjacent public streets. Flows in excess capacity shall be routed through a designated, unimpeded overflow outlet to the historic drainage relief route. 400 401 Slopes shall not exceed 3:1 within the basin or the landscape area unless otherwise approved by the City Engineer. Retention facility design was based on an extensive drainage study performed by Warner Engineering. The purpose of this study was to model the 100-year, 1, 3, 6, and 24-hour events, then route the flows to retention basins using the City's required percolation rate. The event generating the greatest water volume was used as the design for onsite retention basins. Criteria for the study was based on the Hydrology Manual of the Riverside County Flood Control and Water Conservation District manual and the City of La Quinta standards. 2.3.2 Conceptual Grading and Drainage Plan (see accompanying exhibit) 2.3.3 Typical Section of Retention Basin (see accompanying exhibit) 402 (;+,%,75(029(',1$0(1'0(1712403 404 2.4 Water 2.4.1 Water Service Description Based on preliminary discussions with the Coachella Valley Water District ("CVWD"), this development will take water service from an 18-inch water main located in Avenue 50. The water main comes through Tract No. 29858 and terminates in Avenue 50 approximately 250-300 feet west of Jefferson Street. Water service will be provided by CVWD has required that via an 18-inch water main be constructed in Avenue 50 along the project frontage. Installation of and a 24-inch main in Jefferson Street along. The CVWD reviewed the Project and identified that it could serve the Project frontage will also be required, terminating at with the north boundaryexisting water and entitlements (CVWD, October 5, 2017). The CVWD identified that the Project lies within the study area of the 2010 Water Management Plan Update. The CVWD identified that the groundwater basin in the Coachella Valley is in a state of the site. The timingoverdraft, and each new development contributes incrementally to the overdraft. CVWD identified that its Water Management Plan is in place to reduce overdraft and identifies specific actions for completion of this 24-inch water system for Jefferson Street will depend upon future developments as they are proposed, and will provide a backup water supply for this project at that time.reducing overdraft. The CVWD identified that the Project must comply with elements and actions described in the plan. 2.5 Sewage Disposal 2.5.1 Sewer Service Description Based on discussions with CVWD, this development will connect to a proposed sewer main in Avenue 50. If that main is not yet available when this development is constructed, the developer will construct or participate in the construction of a temporary connection to an existing sewer main located in the Citrus development, approximately one quarter mile south of Avenue 50.trunk line that runs through the site. 2.6 Utilities 2.6.1 Existing Utilities To ensure optimum placement for aesthetic, as well as, practical purposes, the developer shall obtain the approval of the City Engineer for the location of all above-ground utility structures, including, but not limited to, traffic signal cabinets, electric vaults, water valves and telephone stands. 405 2.6.2 Underground Utilities In areas where hardscape surface improvements are planned, underground utilities shall be installed prior to construction of surface improvements. The developer shall provide certified reports of utility trench compaction tests for approval of the Public Works Director. 2.7 Circulation 2.7.1 Project Area Background Being located at the northwest corner of the Avenue 50 and Jefferson Street intersection, the Project site serves a central location as an important link, via Jefferson, from Interstate 10 to southwest Indio and the City of La Quinta. The Coachella Valley Association of Governments ("CVAG") in conjunction with the City of La Quinta is currently in the process of redesigning Jefferson Street to the ultimate 120-foot wide right-of-way. Widening work is anticipated to precede the development of the Fairway Plaza Shopping Center. 2.7.2 Circulation Description In accordance with the City of La Quinta design policies, and as shown on the Off-Site Traffic Circulation Plan Exhibit, the Fairway Plaza Shopping Center is proposing the following circulation pattern: Major customer traffic access will be via two primaryThe previously approved Fairway Specific Plan identified four access points located : two from Jefferson Street, one from Avenue 50 and one from Derek Alan Drive. This Specific Plan amendment revises the site access plan to four driveways: three limited-access (no left-turns out) driveways and one full-access unsignalized driveway on Avenue 50, approximately 610440 feet to the west of the intersection at Avenue SO/Jefferson Street on Avenue 50, and 620 feet to the north of the Avenue SO/center line of the Jefferson Street intersection on signalized intersection. The access from Derek Alan Drive has been eliminated in this current plan. Stop signs will be provided within the interior parking lanes at the intersections with the major through lanes and at the driveway intersections with Avenue 50 and Jefferson Street. An additional driveway allowing only right turn-in and right tum-out movementsThis will alsoensure inbound traffic has a continuous, uninterrupted flow into the parking lot. It should be provided on both Jefferson Street and Avenue 50. In addition tonoted that the above access directlyone driveway into the shopping center, the entry off of Jefferson Street into the future residential subdivision, which will be to the north and west of the commercial center, will also allow for entry from Derek Alan Drive, as previously identified on the previously-approved Fairway Specific Plan, has been removed with this current proposed Amendment No. 2. The 406 previously-approved Fairway Plaza Specific Plan had included a driveway from Derek Alan Drive to the shopping center. as a convenience to the residents in the residential development. However, due to resident concerns regarding unwanted traffic in the neighborhood after the residential development was constructed, the driveway access from Derek Alan Drive has been eliminated from the “Pavilion Palms” Project as amended. For all driveways leading from streets, the adjacent perpendicular drive aisle closest to the street shall be provided with stop signs. Additionally, the driveways leading to the street shall be provided with stop signs which will insure inbound traffic a continuous, uninterrupted flow into the parking lot. Two (2) additional approaches have been added as part of this Specific Plan Amendment. The revised building layout reflects the addition of two approaches on the Avenue 50 frontage, one to serve Parcels 1 and 2 directly (with a deceleration lane, right turn in and right turn out) and a one- way exit (right turn out only) located on the far west side of Parcel 1 for emergency vehicles only. The previous layout would have relied excessively on the approach situated immediately east of Parcel 2. The revised layout helps relieve this problem by reducing the concentration of traffic from the single driveway. This arrangement also accommodates the concerns of the Fire Department by creating an exit- only drive to accommodate oversized fire vehicles. Furthermore, the previous layout had insufficient turning radii, which would have obstructed the ability of responding fire vehicles to maneuver on the site, especially when exiting the parking lot. 2.7.3 Public Transportation Bus waiting shelters shall be provided as required when street improvements are installed, as approved by Sunline Transit and the Public Works Director. The SunLine transit agency provides bus service in the region. However, SunLine currently provides no service within proximity to the Project site, and the closest bus stop is located approximately 1.5 miles from the Project, at Washington and Avenue 50. The Project includes non-meandering sidewalks along the perimeter, and interior sidewalks offer ADA-compliant access to the perimeter sidewalks. Therefore, the Project can accommodate transit, pedestrian and bicycle facilities in the future. 2.7.4 Street and Traffic Improvements 2.7.4.1 Minimum Street Improvements The developer will be responsible for the following street improvements: x Jefferson Street - Major Arterial: 51 feet of southbound travel improvements accommodating half of a raised landscaped median, three traffic lanes with widths of 12, 13, and 14 feet, a 5-foot bike lane, and a sidewalk. 407 x Jefferson Street – a sidewalk and minor relocation of the existing “pork chop” left turn median that serves the existing Ralph’s shopping center east of Jefferson Street as well as the Pavilions Palms Shopping Center. x Avenue 50 - Primary Arterial: 38 feet of westbound improvements accommodating half of a raised landscaped median, two through traffic lanes,left turn stacking and a 5'deceleration lane, a 5-foot bike lane and a sidewalk. x Traffic Signals: Jefferson Street Uat Avenue 50 - All necessary traffic signal modifications in the northwest quadrant of the intersection and any other modifications warranted by the timing and traffic generation of this development. x Bus turnouts, acceleration/deceleration lanes, and/or other features contained in the approved construction plans may warrant additional street widths, raised medians or other mitigation measures as determined by the Public Works Director. The Public Works Director may require improvements extending beyond development boundaries such as, but not limited to, pavement elevation transitions, street width transitions, or other incidental work which will ensure that newly constructed improvements are safely integrated with existing improvements and conform with the City's standards and practices. 2.7.4.2 Access Points Access points and turning movements of traffic shall be restricted as follows: x The eastern driveway on Avenue 50 - One 30-foot wide right-in/right-out drive centered, approximately 4406 feet west of the centerlinecenter line of the Jefferson Street and one 40-foot wide right-in/right-out drive, which also allows a left turn into the project, centeredintersection, will allow for full movement of both left and right turns onto Avenue 50 thereby providing users access to points east of the Project. Shared left-turn and right- turn markings are specifically outlined in Chapter 3 of the California Manual on Uniform Traffic Control Devices (CAMUTCD) and such movements are generally allowed at many corner gas stations throughout Southern California. x The westerly driveway on Avenue 50,approximately 610745 feet west of the centerlinecenter line of the Jefferson Street, or as approved by the City Engineer. In addition to these two entries, a third 30-foot wide right-in/right out drive has been added to provide entry to serve Parcels 1 and 2 directly and thereby relieving excessive traffic exiting and entering for the main shopping center. An emergency exit intersection, will be restricted to right turns only drive has been added to accommodate the concerns of the Fire. 408 Department by creating an exit-only drive and also providing sufficient turning radii for oversized fire vehicles. x Jefferson Street - One 30-foot wide right-in/right-out drive centered approximately 41O350 feet north of the centerline of Avenue 50, and one 4026-foot wide right-in/right-out drive, which also allows a left turn into the Project site centered approximately 6240 feet north of the centerline of Avenue 50, or as approved by the City Engineer.. x Entry street to the residential subdivision, north of commercial center - one 30-foot wide left-right-in/left-right-out drive centered approximately 230 feet from the centerline of JeffersonStreet. 2.7.4.3 Access Drive Aisles The main traffic drive aisle leading into the shopping center from Avenue 50 will provide an access way of 146 feet. The second drive aisle from Avenue 50 has been designed to provide an access way that is approximately 50 feet in length. Because Section 9.150.080 of the Zoning Code, requires a length of 90 feet, this is obtained by adding and additional right turn lane or referred to as a deceleration lane which will be provided. The third drive aisle will further relieve traffic flowing in and out of the shopping center. A deceleration lane will also be provided to adequately mitigate any ill effects of the shorter access way lengths. The easterly drive aisle from Avenue 50 has been designed to provide a 130-foot throated curb along its west side and a 50-foot throated curb along its east side. A dedicated 90-foot deceleration lane is provided along the incoming approach east of this drive. 2.7.4.4 Improvement Appurtenances Improvements shall include all appurtenances such as traffic signs, channelization markings and devices and street name signs. 1.1.1.1 Off-Site Traffic Circulation Plan (See accompanying exhibit) 2.7.5 On-Site Traffic Circulation Plan (See accompanying exhibit) 1.1.1.2 Construction/Financing ofImprovements Depending on the timing of development of this Specific Plan area and the status of the off-site improvements at that time, the developer may be required to construct the improvements, to reimburse the City or others for the cost of the improvements, to secure the cost of the improvements for the construction by others at a later date, or a combination of these methods. Site access is provided by to two Primary driveways, one each off Jefferson and Ave 50. The Primary driveway on Avenue 50 offers full turning movements and aligns with the main 409 north/south traffic lane along the front of the Pavilions that distributes traffic to the drive isles within the main field of parking. The secondary driveway on Avenue 50 is right turn in, right turn out only, and provides secondary ingress and egress. The Primary driveway from Jefferson restricts left turn exits, and allows right turns in and right turns out, along with left turns into the site. This Primary driveway intersects the two main north/south internal traffic lanes that distributes traffic to the drive isles within the main field of parking along with the out-parcel parking areas. The secondary driveway on Jefferson is right turn in and right turn out only and provides for secondary ingress and egress. Figure 1 also identifies the on-site truck circulation. 2.7.6 Construction/Financing of Improvements ͒͒ If the developer is required to construct improvements for which this document only obligates a share of the cost, the developer may seek reimbursement of the remaining cost from the City or from adjacent developments, as appropriate, under the City's reimbursement policy. 2.8 2.8 Signage A required sign program, as required per Resolution No. 99-63, was will be submitted and approved by the Design and Development DepartmentCommunity Development Director in April of 2001. 2.8.1 2.8.1 Signage Locations (See accompanying exhibit) 1.1.1.3 2.8.2.1 Building Sign Locations (See accompanying exhibit) 2.8.2 Major Tenant Sign Details (See accompanying exhibit) 2.8.3 Shop Sign Details x priorPurpose: To identify tenant x Quantity: One per lease area frontage Size: One(1) square foot perlineal foot leasefrontage to a maximum of 50 square feet,with the size proportional to the facade of the building on which it is mounted.construction. x Design: Letter style and color to be determined bytenant, and approved by the City of La Quinta. x Ancillary signs: Maximum of three (3) information signs on the Albertsons building without further approval for additional signs. AsperSpecific Plan Condition No. 5 of the Final Conditions of Approval approved as per Council Resolution No. 99-63 410 (;+,%,75(029(',1(;+,%,7411 [this page left intentionally blank] 412 (;+,%,75(029(',1(;+,%,7413 [this page left intentionally blank] 414 (;+%,75(029(',1$0(1'0(1712415 (;+,%,75(029(',1$0(1'01(712416 (;+,%,75(029(',1$0(1'0(1712417 &;+,%,750(29(',1$0(1'0(1712418 419 420 421 422 423 [this page left intentionally blank] 424 (;+,%,75(029(',1$0(1'0(1712425 (;+,%,75(029(',1$0(1'0(1712426 "Ancillary signs shall be defined as those identifying products not typical of a food store, such as a bank or one-hour photo." 2.8.4 Monument Sign (See accompanying exhibit) 2.8.5 Store Identity Sign (See accompanying exhibit) 2.9 Landscape Concept The Fairway PlazaPavilion Palms Shopping Center will be landscaped following an agrarian theme which will emphasize the use of both palm trees and citrus in groupings. This project lies within a predominately agricultural area which consisted mainly of citrus groves and date orchards in the past. The goal of this design theme is to blend with the surrounding plant palette. Plant material selection will be based on this theme, as well as appearance, low maintenance requirements, climatic suitability and tolerance to local conditions. Palm trees will be used for accenting project features limited to node areas of main entries and street intersections, and canopy trees will be used in parking areasevenly spaced to provide shade. As per Condition No. 37 of the original Conditions of Approval approved for this Specific Plan, upon submission of the first site development permit or conditional use permit, whichever comes first,a dramatic street view statement along with 50 percent shading within the field of parking. A preliminary landscape plan will beis submitted for City as part of this Amendment which is attached (see Attachment 2, which was revised per the Planning Commission ). Planning Commission review and approval. The plans include the entire perimeter of the center, retention basin, parking lot area, and the area immediately around the buildings proposed under the permit. The sizes of the proposed trees are included wi thin the plans approved by the City Planning Department, by caliper sizes per accepted industry standards. The plans include the location of permanent cart return corrals proposed for use. 2.9.1 Development Standards Landscaping for the Fairway PlazaPavilion Palms Shopping Center shall comply with the zoning code requirements and the "General Landscaping Guidelines and Irrigation System Design Criteria" by the Coachella Valley Water District. As per original Condition of Approval No. 35 of this Specific Plan, the landscape plans as developed for the shopping center, were reviewed and approved by the Community Development Department in April of 2001.a landscape plan is provided as part of this amendment. As per Condition No. 21 of the original Conditions of Approval for this Specific Plan, efforts will be employed to minimize differences in elevations at abutting properties and between separate lots within the shopping center. Building pad elevations on contiguous lots shall not differ by more 427 than three feet except for lots within a tract or parcel map, but not sharing common street frontage where the differential will not exceed five feet. Alternatively, if compliance with this requirement is not feasible, the City of La Quinta will consider and may approve viable options intended to minimize safety concerns, maintenance difficulties, and neighboring-owner dissatisfaction with the grade differentials. 2.9.1.1 Landscape Shading Requirements for Parking Lots The shade trees in the parking areas will be a variety that will provide shade coverage over 50 percent of the parking area within 15 to 20 years from installation. 2.9.1.2 Landscape Maintenance Responsibility for the maintenance of the common landscape areas within the development shall be stipulated in the conditions, covenants, and restrictions ("CC&R's") developed for the shopping center, or other enforceable mechanism satisfactory to the City of La Quinta. Landscape materials shall be maintained as planted in perpetuity. Any dead or missing trees shall be replaced within 30 days. 2.9.1.3 Landscape Development Standards Landscaping shall be provided within the landscape setback and retention basins along Jefferson Street and the setback area along Avenue 50. The following standards shall be utilized within the landscaped areas of the Project site: x Slopes: Slopes shall not exceed 5:1 within public rights-of-way and 3:1 in landscape areas outside the right-of-way unless otherwise approved by the City Engineer. x Finger Islands: A minimum of six feet wide x Tree Size: All 24-inch box trees shall be a minimum orof 4-inch in diameter as measured 12-inch from grade. All 24-inch box trees shall be a minimum of 2-12 to 3-inch in diameter as measured 6-inch from grade. Approved landscape plans will include caliper sizes per accepted industry standards..͒ x Irrigation: Landscape areas shall have a permanent irrigation system meeting the requirements of the City Engineer, with no lawn or spray irrigation within 18 inches of curbs along public streets. x Lawn Areas: Use of lawn areas will be minimized..͒ x Coordination: The developer shall ensure that landscaping plans and utility plans are coordinated to provide visual screening of aboveground utility structures. x Line of Sight: Plant materials within the clear sight triangle of each entrance shall not exceed 30-inches in height..͒ x As per Condition No. 39 of the original Conditions of Approval for this Specific Plan, if the Project is phased, undeveloped pads shall be turfed or landscaped and 428 irrigated with a groundcover as approved by the City of La Quinta for dust control purposes, and to enhance the appearance of the Project. x Asper Condition No. 40 of the original Conditions of Approval forthisSpecificPlan, landscaping will be provided in the area in front of the Albertsons/Savon building, as approved in the applicable Site Development Permit application. x The final landscape plan for the project shall include plans for fencing, landscaping and irrigation for vacant pads. The final landscape plan must be reviewed and approved by the Planning Comission. 2.9.1.4 Landscape Screening The drive-thru restaurants shall provide screening of the cars using the drive-thru facilities by a combination of walls and/or landscaping. Screening of the parking lot surface from the adjacent streets shall be provided through berming, landscaping and/or short decorative walls. 1.1.1.4 Preliminary Landscape Plan (see accompanying exhibit) 1.1.1.5 Proposed Plant Palette (Table 1) 2.10 Maintenance of the Shopping Center As per Condition No. 45 of the original Conditions of Approval approved for this Specific Plan, the applicant will make provisions for the continuous, perpetual maintenance of all required improvements unless and until expressly released from said responsibility by the City of La Quinta. This will include formation of an association or other arrangement acceptable to the City for the maintenance of the retention basins, common areas, and perimeter walls and landscaping. The retention basins are no longer part of this Specific Plan, as stormwater will be directed to underground stormwater system. Therefore, the applicant will make provisions for the continuous, perpetual maintenance of the underground stormwater system. Applicant shall record Conditions, Covenants, and Restrictions (CC&Rs) on the Property. The CC&Rs shall (1) require minimum covenants for satisfactory, perpetual maintenance obligations on the Property; (2) name the City of La Quinta as an express third party beneficiary; (3) be reviewed and approved by the City Attorney’s Office prior to redecoration; and (4) state that the CC&Rs cannot be amended without prior written consent of the City. 429 (;+,%,75(9,6(',1$0(1'0(1712430 /,675(9,6(',1$0(1'0(1712 431 3 SPECIFIC PLAN 3.1 Land Use The Project site and surrounding properties are is currently vacant land. To the north a golf course and west exists the residential tract are planned.subdivision, Renaissance. An approximate 3-acre stormwater retention basin and a Coachella Valley Water District (CVWD) well site buffers most of the subdivision from the Project site.Across Avenue 50, to the south,is a newthe Palmilla residential development Tract 29858 andneighborhood. Across Jefferson Street to the east and is an existing Ralphs shopping center. To the southeast, the land is mostly vacant with a few scattered residences. The adjoining properties have been studied in conjunction with projected development and have not called attention to any adverse or extraordinary circumstances surrounding the area across Jefferson Street are additional residential subdivisions. This Project will be developed in accordance with ordinances and/or circumstances stipulated by the City of La Quinta. 3.2 Cultural/Archaeology A cultural resources survey was undertaken by CRM TECH to identify and assess cultural resources on the subject site. For complete study see Cultural Resources Report dated December 14, 1998. CRM Tech prepared two studies for the Project site. The first consisted of Phase I and Phase II cultural assessments conducted in 1998 and 1995 for approximate 50 acres of undeveloped land as part of Tentative Parcel Map No. 29052 and Tentative Tract Map No. 29053, which included a residential development and the current commercial Project site. The study was part of the environmental impact review process for the proposed subdivision and development of the property, as required by the City of La Quinta, Lead Agency for the Project, in compliance with the California Environmental Quality Act (CEQA; PRC §21000, et seq.). The second study was conducted in June 2017 and consisted of a historical/archaeological resources records search, historical background review, and an archaeological field inspection of the approximately 12-acre Project site (CRM Tech, June 5, 2017). Prior to issuance of any grading or building permits, or ground disturbance, mitigation measures as recommended by the archaeological assessment for the site shall be completed at the developer's expense. 3.2.1 Tribal Consultation, SB18 and AB52 California Senate Bill 18 requires a 90-day consultation period between a lead agency and California Native American Tribes when an application for a General Plan Amendment, Specific 432 Plan, or Specific Plan Amendment is submitted. The City of La Quinta initiated the SB18 consultation process on January 10, 2018 and the process will end April 10, 2018. The outcome of consultation is anticipated to result in Native American Monitoring during ground-disturbing activities. California Assembly Bill 52 (AB52) went into effect on July 1, 2015, which established and requires a consultation process with all recognized California Native American Tribes to consider any tribal or cultural values when determining a specific Project impact/mitigation. The City of La Quinta initiated AB52 process began October 3, 2017. Letters were sent to tribes on the list received from the Native American Heritage Commission. Responses were received from Cabazon Band of Mission Indians (Cabazon), Agua Caliente Band of Cahuilla Indians (ACBCI) and Twenty-Nine Palms Band of Mission Indians (Twenty-Nine Palms). The Cultural Study from CRM Tech was sent to ACBCI and Twenty-Nine Palms as requested. Both ACBCI and Twenty-Nine Palms asked for approved Native American Monitors from the ACBCI and Twenty-Nine Palms to be present during ground disturbing activities of the Project construction. Mitigation measures have been implemented into the environmental study to have a Native American Monitor present from either tribe. 3.3 Paleontology A paleontologic assessment of the Project site was conducted by the Paleontologic Resource Assessment Program of the Section of Paleontology, San Bernardino County Museum in November, 1998. It was and on May 2, 2017. Both studies concluded in the report that sediments found at the site have the potential to contain significant nonrenewable paleontologic resources which may be negatively impacted by any grading or excavation. A review of relevant paleontologic literature indicates that significant fossil remains have been recovered from properties in the same vicinity as the Project site, thus contributing to the interpretation of high paleontologic sensitivity. Due to the above considerations, a program to mitigate the impact on nonrenewable resources is recommended. This program should include, but not be limited to, the monitoring of any excavation of the site, preparation of the recovered specimens, identification and curation of specimens and the preparation of a final report, and inventory, of the findings. The mitigation program will be complete when the final report is submitted to the lead agency, the City of La Quinta. 433 3.4 Environmental 3.4.1 Air Quality The potential of1998 air quality report prepared for the original Specific Plan identified that the Project construction and subsequent operations of the Fairway Plaza Shopping Center toProject would result in air quality emissions that would exceed the daily criteria, as recommended by the South Coast Air Quality Management District, willbut would be mitigated to the extent that they are reasonably feasible by measures as recommended by Synectecology in their air quality report of November 5, 1998. Mitigation measures recommended include, but are not limited to, maintaining all construction equipment in good condition so as to reduce operational emissions, the use of low emission construction equipment whenever feasible and the use of low VOC paints, primers and coatings. In addition, long term mitigation will be aided by the availability of public transportation facilities along with direct vehicular and pedestrian access points to the adjacent residential subdivision, and the provision of bicycle facilities within the development. Although residual emissions would be expected to remain in excess of recommended threshold values for CO, NOx, ROG and the impact iswas expected to remain significant, Synectecology found this Project to be consistent with the policies and goals of the Air Quality Management Plan and that it will result in less intensive commercial development at the site than that allowed under the existing General Plan, thereby reducing potential emissions. In 2013, the City of La Quinta adopted its General Plan, which assessed the environmental impacts of current and future projects based on the zoning designations or approved specific plans. The Fairway Plaza Specific Plan, which included 100,460 square feet of retail space with accommodating parking and landscape area, had been approved prior to the assessment of environmental impacts of the City’s General Plan. On February 19, 2013, the City adopted a Statement of Overriding Considerations for significant and unavoidable air quality impacts identified in the updated General Plan EIR. In 2018, a revised air quality assessment was prepared to address the net increase of approximately 21,920 square-feet of new uses not previously reviewed or approved in the 1999 Specific Plan and subsequent 2012 Updated General Plan. The study found that the net increase would not exceed thresholds of significance for air quality impacts. Further, that the additional uses would not cumulatively generate a considerable net increase of any criteria pollutant nor violate any air quality standard during construction and operation of the proposed Project. The site zoning is Community Commercial, which allows for a 0.30 Maximum Floor Area Ratio ([FAR] gross floor area of all buildings divided by the building site area). The proposed Project represents approximately 0.22 FAR. Therefore, the Project proposes less intensity than allowed under the zoning. 3.4.2 Greenhouse Gas The City of La Quinta adopted a Greenhouse Gas Reduction Plan (Plan) on February 13, 2013. The Plan provides reduction strategies and reduction measures that can reduce greenhouse gas emissions at their source and at the end use by improving operating efficiency, increasing reliance 434 on renewable source for energy production, developing new technologies, and through conservation. These reduction measures are listed in Table 28 of the Plan and can be implemented as needed during the design phase. The Project will comply with the strategies of the City’s Greenhouse Gas Reduction Plan. 3.4.23.4.3 Noise A noise study, dated November 5, 1998, was provided by Synectecology for this Project. Recommendations made to ensure that any construction noise impacts will be reduced to less than significant levels include the following: all construction will be performed between the hours of 7:00 A.M. and 7:00 P.M., Monday through Saturday; all internal combustion equipment will be fitted with properly operating mufflers and air intake silencers; and, all pieces of stationary equipment will be located as far as practical from adjacent residences. Operational noise will be reduced by limiting on-site deliveries to the hours of 7:00 A.M. to 10:00 P.M. and erecting a wall by an existing soundwall that varies in height from six (6) feet to eight (8) feet in height behind the north and west commercial center. This measure will reduce any potentially significant impacts to a level that is less than significant and no further mitigation will be warranted parcel perimeter. Noise studies for the Project were prepared in 2002 as part of the Specific Plan Amendment approval and in 2017 and in 2018 to serve as an update. A 2002 study identified that both Jefferson Street and 50th Avenue were impacted, and exceed 60 dBA CNEL. The study identified that all new development is required to mitigate to the City's standards for noise, as required in the General Plan (Table EH-1, Warner Engineering, February 19, 2002). The 2017 noise study also concluded that areas along Jefferson Street and 50th Avenue were impacted and exceeded the 60dBA criteria. Ambient noise measured along various locations along the north and west perimeter of the site, nearest to the residences, measured between 53.9 and 60 dBA. The study determined that the main sources of noise across the site are noise from road traffic on 50th Avenue and Jefferson street, other noise sources included HVAC systems serving the houses to the north, west and south of the site and from HVAC serving the commercial buildings to the east, across Jefferson Street. There was also minor noise from distant aircraft and birdsong. Noise is also anticipated from the speakers of the drive-through eating establishments, as well as vehicle doors closing in the parking lot. The Project is proposed approximately 150 feet between the closest development building and the residences to the south. The residences to the south already have a concrete masonry boundary wall. 3.4.33.4.4 Trash Recycling Prior to the issuance of a certificate of occupancy, a plan for adequate trash recycling provisions shall be approved by the CommunityDesign and Development Department. The plan is to be reviewed for acceptability by applicable trash company prior to City review. 435 3.5 Zoning The subject property has a CC ("Community Commercial") designation in place and is identified within the General Plan use designation as CommunityGeneral Commercial. The specific uses and requirements of the CC zone relevant to this Project are outlined in Section 3.5.3 of this Specific Plan. 3.5.1 Zoning Standards The Fairway PlazaPavilion Palms Shopping Center will be developed following the framework of the general zoning requirements of the CC zone of the City of La Quinta. 3.5.2 Deviations from Zoning Code The following development standards are proposed as deviations from the City of La Quinta Zoning Code. A brief justification for each request is included.and identifies if previous deviations are still applicable. 3.5.2.1 Number of Parking Stalls Provided The parking stall deviation requested in the previously-approved Specific Plan no longer applies. The site has been redesigned to accommodate the required parking for the shopping center is 474of 579546 stalls, and the applicant shall install a minimum of 12 electric charging facilities in the anchor tenant’s parking lot. and has been provided in the design. . The percentage of landscaping proposed, both in the parking areas and near the buildings exceeds the required percentage by 30 percent. 3.5.2.2 Reduction in Landscape Setback Jefferson Street and Avenue 50 are considered arterial roadways in the City’s General Plan. The municipal code requires a 20-ft. landscape setback along arterial roadways. The Specific Plan will change the standard for the site to 18 ft., which is a 10 percent reduction to the setback. 3.5.2.23.5.2.3 Retail Store over 50,000 Square Feet of Floor Area The AlbertsonsPavilions grocery store will have approximately 57,56063,000 square feet of floor area which exceeds the permitted retail store size of 50,000 square feet maximum. This retail store, however, will actually combine several allowed uses under one roof. Included within the grocery store will be a full service pharmacy with a drive-thru window, as well as a liquor department which will sell beer, wine and hard liquor. 436 1.1.1.6 Automobile Service Station 3.5.2.4 Fuel Center/Convenience Store The site has been designed to accommodate the option of an automobile service stationa fuel center with a convenience store that would be located on the building pad located atjust west of the southeast corner of the site.In the event that the developer wishes to develop it for this purpose, the service station use will need to be approved by This fuel center/convenience store is an adjunct to the grocery store/pharmacy anchor tenant. The proposed operation will consist of one 825 square-foot convenience market, a 100-foot by 50- foot fueling canopy over three sets of double fuel islands with 12 fueling stations and a monument sign for required pricing and identification. The specific location and design of the monument sign will be part of the overall sign program for the Specific Plan that will be submitted at a future date. The fuel center operation will include dispensing of motor vehicle fuel, an automobile-related air/water unit, and a 825 square-foot convenience market that will offer the sale of convenience dry goods and general merchandise, lottery tickets, refrigerated dairy/deli products and prepared food and drinks., including the sale of beer, wine and alcohol, for off-premised consumption. As provided for in the Specific Plan landscape plan, the operation will be heavily screened from Avenue 50 with densely spaced 36-inch box Yellow Oleander planted at 10 feet on center within the landscape set back planting area along Ave 50. Yellow Oleander spreads approximately 8 to 20 feet and develops quickly into a dense medium to large evergreen shrub to 8 feet high, or higher as a small tree to 25 feet, and will be trimmed to effectively screen the operation from Avenue 50 and areas south. The hours of operation of the convenience store/fuel center will be 7:00 AM to 10 PM, unless otherwise approved by the Planning Commission or the Director/Manager of the Design and Development Department. The convenience store/fuel center will be staffed by 156 employees. The anchor tenant Pavilions is responsible for obtaining and maintaining all State, federal and local permits associated with the fuel operations and convenience store. Primary fuel center equipment will include air and water dispensers, two-10,000 gallon and one 20,000-gallon underground tanks along with necessary underground compressors and pumping components. Primary equipment for the convenience store will include refrigerated cases for display and storage of dairy/deli and beverage products, together with related compressors and refrigeration systems. The convenience store will include twoone restrooms and a manager’s office. During the operation, typical material such as solvents, paints, lubricants, metals, industrial-grade cleaners, refrigerants, petroleum products and other automotive-related hazardous materials will 437 be utilized. These materials will be handled in accordance with all applicable rules and regulations with respect to hazardous materials. Parking lot lighting, access and customer and truck circulation will be integrated as part of the Specific Plan. Final exterior building design will be subject to future Planning Commission underapproval, but will follow the Contemporary architecture theme as established with Specific Plan. The fuel center and convenience store is currently planned to be associated with the supermarket tenant and will be considered a permitted use in the Specific Plan with an anchor tenant. However, if the fuel center and convenience store will not be developed by the associated supermarket tenant, and rather an unassociated entity, the City will require approval of a Conditional Use Permit. The fuel center and convenience store is currently planned to be associated with the supermarket tenant. The anchor supermarket tenant and fuel center (with or without a convenience store) are permitted uses as long as both uses are developed in tandem and both uses continue to operate. However, if one use continues and the other is discontinued, approval of a Conditional Use Permit will be required. 3.5.2.33.5.2.5 Depth of Entry Access Ways The lengths of threethe east side of the access wayseasterly most Ave 50 drive into the commercial development areis less than the 90 feet as required by the Zoning Code, Section 9.150.080. Due to the fact that this shopping center and parking lot are located diagonally to the adjacent streets, entryways of shorter lengths will allow for greater efficiency in traffic flow in to and through the parking areas. A As a mitigating measure, a dedicated 90-foot deceleration lane will also be provided at each of the shorter entries intended to mitigate any traffic flow problems off of the adjacent public streets.has been provided along its easterly approach. 3.5.2.43.5.2.6 Retention Basin An extensive drainage study was performed to address the retention on the project. Even though the Zoning Code, Section 9.60.240 states that no retention of storm waters is allowed within the setback area other than incidental storm water that falls on the setback, certain areas used for the above gr ound retention fall into the setback area in several sections of the landscape area due to the meandering of the designated landscape area. Areas will be used with catch basins and drywalls, or combinations thereof, to collect water that eventually flow into the proposed above ground retention areas utilizing the landscape area for capacity. A determination has been made that the proposed retention basin and drainage system will meet or exceed the criteria of the Riverside County Flood Control, Water Conservation District, and the City of La Quinta standards.\ A retention basin was approved for stormwater retention in the previous Specific Plan. This Amendment removes the basin and replaces it with an underground stormwater system. This is consistent with City codes, and no deviation is necessary. 438 3.5.3 Permitted Uses Community Commercial: • Retail stores under 10,000 square feet floor area per business •Retail stores under 10,000 to 50,000 square feet floor area •Retail stores under 50,000 to 75,000 square feet floor area · • Food, liquor and convenience stores under 10,000 square feet floor area, open less than 18 hours/day • Automobile service stations, with or without minimart, with anchor tenant. (For this development, the fuel center and convenience store are planned to be associated with the supermarket tenant. The anchor supermarket tenant and fuel center [with or without a convenience store] are permitted uses so long as both uses are developed in tandem and both uses continue to operate. However, if one use continues and the other one is discontinued, approval of a Conditional Use Permit will be required. •Showroom/catalog stores, without substantial onsite inventory •Barber shops, beauty, nail and tanning salons and similar uses •Miscellaneous services such as travel services, photo developing, videotape rentals, shoe repair, appliance repair, and similar uses • Laundromats and dry cleaners except central cleaning plants ͒ • Printing, blueprinting and copy services ͒ • Pet grooming without overnight boarding ͒ • Banks ͒ • General and professional offices •Medical offices - physicians, dentists, optometrists, chiropractors, and similar practitioners • Medical centers - four or more offices in one building ͒ • Surgical and medical clinics • Restaurants, other than drive-thru • Restaurants, drive-thru ͒ • Restaurants, counter take-out with ancillary seating, such as yogurt, ice cream, pastry shops and similar • Commercial recreational ͒ • Museum or gallery displaying sculpture, artwork or crafts, including schools for the above͒ • Parks, unlighted playfields, and open space ͒ • Bicycle, equestrian and hiking trails ͒ • Fire stations ͒ • Government offices and police stations ͒ • Public flood control facilities and devices ͒ • Emergency shelters ͒ • Auto parts stores, with no repair or parts installation on the premises ͒ * Notes: 439 1. Other than convenience stores. Items sold may include clothing, groceries, meat, drugs, jewelry, sundries, office supplies, pets, furniture, appliances, hardware, building materials (except lumber yards), and similar retail items. 2. With no consumption of alcohol on the premises. 3.5.4 3.5.4 Permitted Uses with a Conditional Use Permit Automobile service stations are permitted use within the Community Commercial zoning designation upon approval of a Conditional Use Permit. 3.6 Specific Design Features 3.6.1 Screen Wall In order to mitigate noise and light generated from the shopping center, a solid eight-foot high masonry screen wall that varies in height from 6 feet to 8 feet has been constructed to the City of La Quinta standards between thise commercial Project site and the plannedexisting residential development to the north and west will be constructed to City of La Quinta standards. 3.6.2 Screening of Rooftop Equipment Consistent with the ZoningCode, the design of the buildings will architecturally integrate or screen from view the location of all rooftop and wall mounted mechanical equipment by means of a parapet wall. 3.6.3 Utility Enclosures Unless located underground, any utility enclosures including pallet enclosures, propane/generator enclosures shall consist of masonry materials sufficient in height to screen all storage with solid painted gates provided, with the design, colors, and materials architecturally integrated with that of the shopping center subject to approval of the CommunityDesign and Development Department prior to issuance of a building permit. 3.6.4 Cart Storage Cart storage areas will be provided as required by the City of La Quinta with the design and location subject to approval by the Design and Development DepartmentCommunity Development Director, prior to issuance of a building permit. 440 3.6.5 Exterior Lighting Exterior lighting for the Project will be designed to comply with the City's "Dark Sky"outdoor lighting ordinance, (Section 9.100.150 of the Municipal Code)and shall be subject to approval by the CommunityDesign and Development Department prior to issuance of building permits. All exterior lighting will incorporate directional lenses and/or will architecturally incorporate shield lighting elements intended to minimize ambient light from illuminating adjacent streets and residential properties to the satisfaction of the CommunityDesign and Development Department. Parking lot light standards shall be a maximum 25 20 feet in height with light elements that will similarly be shielded,and shall provide a uniform minimum average of one (1) candle foot illumination within the parking lot areas. 3.7 Property Rights Prior to the issuance of a grading permit or approval of a final map, the property owner will acquire or confer easements and other property rights required by this Specific Plan or any tentative maps or site development permits necessary in the development of the Specific Plan area. The property owner will also dedicate or grant public and private street right-of- ways and utility easements in conformance with the City's General Plan, Municipal Code, applicable specific plans, and as required by the City Engineer. Right-of-way dedications required of this development will include the following: x Jefferson Street-:60-foot half of a 120-foot right-of-way. In addition, the owner shall make an irrevocable offer to grant an additional 17 feet of right-of-way, (not to exceed 250 feet in length), for future southbound turn lanes at the Avenue 50 intersection. x Avenue 50 - SO: 50-foot half of a 100-foot right-of-way Dedications will also include additional widths, as necessary for corner cutbacks, bus turnouts and other features contained in the approved construction plans and as per the representations made within this Specific Plan. If the City Engineer determines that access rights to the proposed Jefferson Street and Avenue 50 rights-of- way are necessary prior to development of the commercial area or approval of the final map for the residential subdivision, the developer shall grant easements or permanent right-of-way over those areas within 60 days of written request by the City. The property owner shall create perimeter setbacks along public rights-of-way as follows (listed setback depth is the average depth if meandering wall design is approved): x Jefferson Street - 20: 18 feet (34 feet in areas where deceleration lanes are provided and 37 feet in the area of the future turn lane widening)minimum 441 x Avenue 50 - 20: 18 feet minimum The setback requirement applies to all frontage including, but not limited to, remainder parcels and sites dedicated for utility purposes. Where public facilities (e.g., sidewalks) are placed on privately owned setbacks, the property owner shall dedicate blanket easements for those purposes. The property owner will vacate abutter's rights of access to Jefferson Street and Avenue 50 from all frontage along streets except access points conforming to the General Plan and approved by the City Engineer. The developer will furnish to the City of La Quinta proof of easements or written permission, as appropriate as obtained from owners of any abutting properties on which grading, retaining wall construction, permanent slopes or other encroachments are to occur. 3.8 Administration In accordance with General Plan Programs LU 2.2b and 2.2c, if the need for any changes to the Specific Plan arise, the Design and Development Director will have the authority to waive the need for a Specific Plan amendment under the following circumstances: x When changes to the land use allocation are less than 5%; x :KHQWKHRIIဨVLWHFLUFXODWLRQSDWWHUQDQGWXUQLQJPRYHPHQWVZLOOQRWEHDOWHUHGE\WKH proposed change; x When the change is considered minor in nature and does not conflict with the purpose and intent of the Specific Plan; x When no new land use is proposed. Additionally, the Design and Development Director will determine substantial conformance in approved Specific Plans. 442 Attachment 1 Lighting Plan 443 Attachment 2 Preliminary Landscape Plans 444 Attachment 3 Preliminary Grading Plans 445 Attachment 4 Conditions of Approval Fairway Shopping Center Specific Plan Resolution 99-63 Conditions of Approval – Final Specific Plan 98-034 Lundin Development May 18, 1999 446 484ATTACHMENT 3ATTACHMENT 3 0$5.(7,1*48$57(5/<5(3257 $SULO-XQH 7UDGLWLRQDO0DUNHWLQJ 3ULQW$GV$OO3ULQW$GV6WRSSHG,PPHGLDWHO\'XHWR&29,' 6WD\+RPH6DYH/LYHV )ODWWHQWKH&XUYH &OHDQ8S0DVNV *ORYHV *HW7HVWHGIRU&29,' 5DGLR&DPSDLJQV&29,' 'LJLWDO%LOOERDUGV&29,' DEPARTMENTAL REPORT ITEM NO. 1 485 7RXULVP'LJLWDO$GV,PPHGLDWHO\6WRSSHG'XHWR&29,' )DFHERRN7ZLWWHU1H[W'RRU,QVWDJUDP &29,'7HVWLQJ6LWHV &29,'6HQLRU6HUYLFHV &29,'&RYHU\RXU)DFH &29,'%XVLQHVV5HVRXUFHV &29,'0LFURVLWH &29,'5HVLGHQW5HVRXUFHV &29,'1L[OH &29,'+RWOLQH(PDLO &29,'83'$7(6([HFXWLYH 2UGHUV(PHUJHQF\5HVROXWLRQV &29,'/4$SS4XLFN/LQNV 5LY&R3XEOLF+HDOWK8SGDWHV &LW\+DOO2QOLQH6HUYLFHV /LYH9LUWXDO&LW\&RXQFLO0HHWLQJ &2'(&29,'9LRODWLRQV /460%XVLQHVV/RDQ3URJUDP /4*UDGXDWLQJ&ODVVRI 'LJLWDO0DUNHWLQJ 6RFLDO0HGLD&DPSDLJQ /29(/46XSSRUWIRU/RFDO %XVLQHVVHV'XULQJ&29,' /4DW+RPH+LJKOLJKWLQJ5HVLGHQWVDW KRPHIDPLO\OLIHLQTXDUDQWLQH 0XVHXP'LJLWDO6HUYLFHV /LEUDU\&UHDWLRQ6WDWLRQ6HUYLFHV )LWQHVV&RXUW$W+RPH 6&5$3*DOOHU\ &(1686 &,33URMHFWV 3URWHFW<RXUVHOI'RQ W/LWWHU &29,'(PRWLRQDO:HOOQHVV 3DUNV 7UDLOV6WDWXV8SGDWH 9LOODJH&RPSOHWH6WUHHWV $UW&URVVZDONV 6SULQJ+DUYHVW&HOHEUDWLRQ /LIH6WUHDP%ORRG'ULYH 'LJLWDO$GV&29,' /RYH/4 /RYH/4 /RYH/4 486 &29,'0LFURVLWH &29,'6HQLRU6HUYLFHV &29,'1L[OH &29,'&RYHU<RXU)DFH &29,'7UDLOV3DUNLQJ/RW &29,'(PDLO+RWOLQH &29,'6WD\+RPH2UGHU &29,')LQG)RRG%DQN %RRVWHG&DPSDLJQV &DO7UDYHO&29,'7DVN)RUFH:HHNO\WUDLQLQJVXSGDWHV &29,',QVLJKW6HULHV1DYLJDWLQJ8QFKDUWHG7HUULWRU\$GDUD &29,',QVLJKW6HULHV$GDUD &DOLIRUQLD7RXULVP&29,'0DUNHWLQJ5HVSRQVH7UDLQLQJ0DGGHQ0HGLD $GDSWLQJWR1HZ7RXULVP'\QDPLF3RVW&29,'&DO7UDYHO 3URWHFWLQJ<RXUVHOI$JDLQVW&29,'$QG2WKHU&RQWDJLRXV,OOQHVVHV 7UROOVDQG7KHLU7ROORQ6RFLDO0HGLD&RPPXQLFDWRUV$UFKLYH6RFLDO &29,'6SHFLILF7UDLQLQJV 6WDII7UDLQLQJ 487 488 PLANNING COMMISSION MINUTES 1 MAY 26, 2020 PLANNING COMMISSION MINUTES TUESDAY, MAY 26, 2020 CALL TO ORDER A regular meeting of the La Quinta Planning Commission was called to order at 6:00 p.m. by Chairperson Caldwell. This meeting was held by teleconference pursuant to Executive Orders N-25-20, N- 29-20, N-33-20, and N-35-20, executed by the Governor of California in response to the state of emergency relating to novel coronavirus disease 2019 (COVID-19) and enabling teleconferencing accommodations by suspending or waiving specified provisions of the Ralph M. Brown Act (Government Code § 54950 et seq.). PRESENT: Commissioners Bettencourt, Currie, McCune, Nieto, Proctor and Chairperson Caldwell ABSENT: Commissioner Libolt Varner STAFF PRESENT: Design & Development Director Danny Castro, Planning Manager Cheri L. Flores, Senior Planner Carlos Flores, Associate Planner Siji Fernandez, Consulting Planner Nicole Sauviat Criste, Public Works Director/City Engineer Bryan McKinney, Building Official Anthony Ortega and Commission Secretary Wanda Wise-Latta PLEDGE OF ALLEGIANCE Chairperson Caldwell led the Planning Commission (Commission) in the Pledge of Allegiance. PUBLIC COMMENT ON MATTERS NOT ON THE AGENDA There were no requests to speak under the ‘Public Comment on Matters Not on the Agenda’ section of the meeting and Staff will continue to monitor emails should written comments or requests for verbal comments be received. CONFIRMATION OF AGENDA MOTION – A motion was made and seconded by Commissioners Bettencourt/Proctor to approve the Consent Calendar as submitted. AYES: Commissioners Bettencourt, Currie, McCune, Nieto, Proctor and Chairperson Caldwell. NOES: None. ABSENT: Commissioner Libolt Varner. ABSTAIN: None. Motion passed. 489 REPORTS AND INFORAMTIONAL ITEM NO. 28 PLANNING COMMISSION MINUTES 2 MAY 26, 2020 ANNOUNCEMENTS, PRESENTATIONS AND WRITTEN COMMUNICATION 1. SILVERROCK MODIFICATIONS BY APPLICANT (MBA2020-0005 AND -0006) Consulting Planner Criste presented the staff report which is on file in the Design and Development Department. Staff responded to the Commission’s inquiries and comments regarding the number of modifications by applicant allowed under the Municipal Code; and shared factors that might result in plan changes. Commissioners shared their thoughts regarding the substance of the modifications and felt those modifications were significant. PUBLIC SPEAKER: Mr. John Gamlin, The Robert Green Company – introduced himself and continued the presentation. Commissioners thanked Mr. Gamlin for the presentation and shared their comments and inquiries regarding the project. Mr. Gamlin and staff clarified for the Commission that the red-line drawings on the attachments were the SDP-approved profile; explained the rooftop elements on the Pendry elevations; and spoke about the height of Pendry and its visibility from Jefferson Street or from Avenue 52. Mr. Gamlin appreciated a Commissioner’s comments about the site’s condition particularly regarding the perimeter fencing and weed control. Commissioners shared their thoughts regarding staff’s administrative authority in making their determination given the documentation that was provided; the pool re-design; and the legibility of the staff report attachments. Staff noted that should the Commission desire additional information regarding an item on a Commission agenda, staff would be happy to provide the information. CONSENT CALENDAR 1. APPROVAL OF MINUTES DATED MAY 12, 2020 MOTION – A motion was made and seconded by Commissioners Currie/Bettencourt to approve the Consent Calendar as submitted. AYES: Commissioners Bettencourt, Currie, McCune, Nieto, Proctor and Chairperson Caldwell. NOES: None. ABSENT: Commissioner Libolt Varner. ABSTAIN: None. Motion passed. BUSINESS SESSION – None 490 PLANNING COMMISSION MINUTES 3 MAY 26, 2020 STUDY SESSION 1. REVIEW OF RECREATIONAL VEHICLE PARKING IN COVE RESIDENTIAL DISTRICT Senior Planner Flores presented the staff report which is on file in the Design and Development Department. Staff responded to Commission inquiries and comments regarding recreational vehicle (RV) parking in front yards and its impact on aesthetic quality of neighborhood; references to RV parking in the Municipal Code; giving consideration to requiring a permit to park an RV in front yard so as to assure that the RV belongs to the homeowner/resident; protecting and enhancing neighborhood values; if RV parking is restricted consider grandfathering but limit to current RV; multiple RVs parked at a residence; side yard RV parking and setbacks; impacts on street parking; code compliance and enforcement; and how best to obtain community input. Staff stated that most complaints received by Code Compliance are related to 72- hour parking violations; noted that Planning staff had not received other complaints about RV parking in the Cove but did receive correspondence about relaxing RV parking in front yards in another area of the City. Commission and staff discussed options for obtaining community input with the assurance that all residents and property owners in the Cove Residential District would have the opportunity to provide their input. PUBLIC HEARINGS – None REPORTS AND INFORMATIONAL ITEMS - None COMMISSIONERS’ ITEMS Commissioner Bettencourt stated that he hoped staff would be able to provide meeting materials in a user-friendly, three-ring binder format for ease of review by the Commission especially when staff reports and attachments are voluminous; suggested Commissioners visit the Montage Cabo San Lucas website to view the photo gallery; and inquired if there are regulatory measures that the City needs to address to facilitate the transition to normal business operations especially with regards to curbside pickup. Director Castro updated the Commission regarding the City’s Al Fresco Dining program. Chairperson Caldwell inquired if Planning staff is still attending Vista Santa Rosa meetings. Senior Planner Flores confirmed that he will be attending the next Vista Santa Rosa Community meeting. 491 PLANNING COMMISSION MINUTES 4 MAY 26, 2020 STAFF ITEMS 1. UPCOMING PROJECTS UPDATE Planning Manager Flores presented the staff report which is on file in the Design and Development Department. Staff advised the Commission that the Travertine project held a scoping meeting in 2018 and no further scoping meeting was required; and noted that the applicant is planning to coordinate community meetings in the future. A Commissioner asked if staff could provide an update on the SilverRock Venue Site and the La Quinta Auto Center at the next Planning Commission meeting. ADJOURNMENT There being no further business, it was moved and seconded by Commissioners Bettencourt/Proctor to adjourn at 6:55 p.m. Motion passed. Respectfully submitted, WANDA WISE-LATTA, Commission Secretary City of La Quinta, California 492 POWER POINTS CITY COUNCIL MEETING -8/<, 2020 ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϭ City Council Meeting July 7, 2020 City Council Meeting July 7, 2020 Closed Session In Progress ϭ Ϯ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ Ϯ City Council Meeting July 7, 2020 P2 – Coachella Valley Mosquito and Vector Control District Update Protecting Public Health Since 1928Protecting Public Health Since 1928 ŽĂĐŚĞůůĂsĂůůĞLJDŽƐƋƵŝƚŽĂŶĚ sĞĐƚŽƌŽŶƚƌŽůŝƐƚƌŝĐƚ DŽƐƋƵŝƚŽŽŶƚƌŽůŝŶ>ĂYƵŝŶƚĂ^ƵŵŵĞƌϮϬϮϬ dĂŵŵLJ'ŽƌĚŽŶ͕D͘͘ WƵďůŝĐ/ŶĨŽƌŵĂƚŝŽŶKĨĨŝĐĞƌ :ƵůLJϳ͕ϮϬϮϬ ϯ ϰ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϯ Protecting Public Health Since 1928Protecting Public Health Since 1928 2XWOLQH :KDWPRVTXLWRHVDUHLQ/D4XLQWD" $VVHVVLQJULVN $UHDVRIFRQFHUQ 6XPPHUDSSOLFDWLRQSODQQLQJ :KDWFDQUHVLGHQWVGRWRUHGXFHPRVTXLWRHVDWKRPH" :KDWFDQWKH&LW\GRWRUHGXFHPRVTXLWRHV" Protecting Public Health Since 1928Protecting Public Health Since 1928 DŽƐƋƵŝƚŽĞƐŝŶƚŚĞŽĂĐŚĞůůĂsĂůůĞLJ dŚĞƵůĞdžŵŽƐƋƵŝƚŽ ±ŽŵŵŽŶŝŶƚŚĞsĂůůĞLJŚĂǀĞƚŚĞƉŽƚĞŶƚŝĂů ƚŽĐĂƌƌLJŵŽƐƋƵŝƚŽͲďŽƌŶĞǀŝƌƵƐĞƐ o tĞƐƚEŝůĞsŝƌƵƐ;tEsͿ o ^ƚ͘>ŽƵŝƐŶĐĞƉŚĂůŝƚŝƐ;^>sͿ ±ƌĞĞĚŝŶƐƚĂŐŶĂŶƚǁĂƚĞƌƐŽƵƌĐĞƐ o ŽŵŵŽŶŝŶĂŐƌŝĐƵůƚƵƌĞĂƌĞĂƐ͕ ŶĞŐůĞĐƚĞĚƉŽŽůƐ͕ďƌŽŬĞŶĨŽƵŶƚĂŝŶƐ͕ĞƚĐ͘ ΎWĞŽƉůĞŽǀĞƌƚŚĞĂŐĞŽĨϱϬĂŶĚͬŽƌĂƌĞŝŵŵƵŶĞ ĐŽŵƉƌŽŵŝƐĞĚĂƌĞĂƚŵŽƌĞƌŝƐŬĨŽƌƐĞƌŝŽƵƐŝůůŶĞƐƐ ϱ ϲ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϰ Protecting Public Health Since 1928Protecting Public Health Since 1928 ĞĚĞƐ ĂĞŐLJƉƚŝ /ŶǀĂƐŝǀĞƐƉĞĐŝĞƐĚĞƚĞĐƚĞĚŝŶƚŚĞ sĂůůĞLJŝŶϮϬϭϲ &ŽƵŶĚŝŶ>ĂYƵŝŶƚĂƵŐƵƐƚϮϬϭϳ ±EĞĂƌDŝůĞƐǀĞĂŶĚĚĂŵƐ^ƚ <ŶŽǁŶĨŽƌƚĂŬŝŶŐŵĂŶLJƉĂŝŶĨƵů ďŝƚĞƐĨƌŽŵŚŽƐƚƐ͕ĂŶŬůĞĂŶĚ ĞůďŽǁƐ ^ŚŽƌƚĨůLJŝŶŐĚŝƐƚĂŶĐĞ͕ƐŽƵƌĐĞĐůŽƐĞ ďLJ ĂŶƚƌĂŶƐŵŝƚĚŝƐĞĂƐĞƐďƵƚEK ĚŝƐĞĂƐĞƐĂƌĞĐƵƌƌĞŶƚůLJďĞŝŶŐ ƚƌĂŶƐŵŝƚƚĞĚŝŶĂůŝĨŽƌŶŝĂ Protecting Public Health Since 1928Protecting Public Health Since 1928 Ks/Ͳϭϵ/ŵƉĂĐƚƐƚŽŝƐƚƌŝĐƚKƉĞƌĂƚŝŽŶƐ ZĞĚƵĐĞĚ&ŝĞůĚKƉĞƌĂƚŝŽŶƐŽĨĨƵůůƚŝŵĞǁŽƌŬĨŽƌĐĞ ±ŝƐƚƌŝĐƚĐůŽƐƵƌĞƐĚƵĞKs/Ͳϭϵ͕dŽƚĂůϯǁĞĞŬƐ͘ ±>ŽƐƐŽĨĞŵƉůŽLJĞĞĂŶĚKs/ϭϵƉŽƐŝƚŝǀĞƐƚĂĨĨ ZĞĚƵĐĞĚĂŶĚĞůĂLJĞĚ^ĞĂƐŽŶĂůǁŽƌŬĨŽƌĐĞ ±ŽƵƌƚĐůŽƐƵƌĞƐƚŚƌŽƵŐŚŽƵƚƐƚĂƚĞƉƌĞǀĞŶƚĞĚďĂĐŬŐƌŽƵŶĚĐŚĞĐŬƐ ±^ůŽǁĞĚŚŝƌŝŶŐŽĨŽƵƌƐĞĂƐŽŶĂůǁŽƌŬĞƌƐƚŚĂƚƐƵƉƉŽƌƚŽƵƌ/ŶǀĂƐŝǀĞĞĚĞƐĂŶĚZ/& ƉƌŽŐƌĂŵƐ͘ ĞƐƉŝƚĞƚŚŝƐ͕ƐƚĂĨĨŚĂǀĞĐŽŶƚŝŶƵĞĚƵŶĚĞƌŶŽŶͲŝĚĞĂůĐŝƌĐƵŵƐƚĂŶĐĞƐƚŽ ĨƵůĨŝůůŝƐƚƌŝĐƚŵŝƐƐŝŽŶ͘ ϳ ϴ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϱ Protecting Public Health Since 1928Protecting Public Health Since 1928 5HVSRQVH3ODQ 5LVN0RGHO 3RVLWLYHPRVTXLWR VDPSOHV $EXQGDQFHRIPRVTXLWRHV 7HPSHUDWXUH 3RVLWLYHGHDGELUGV +XPDQFDVHV EŽƌŵĂů ^ĞĂƐŽŶ ϭ͘Ϭ ʹ Ϯ͘ϱ ŵĞƌŐĞŶĐLJWůĂŶŶŝŶŐ Ϯ͘ϲʹ ϰ͘Ϭ ƉŝĚĞŵŝĐ ŽŶĚŝƚŝŽŶƐ ϰ͘ϭʹ ϱ͘Ϭ &XUUHQW8UEDQ5LVN$VVHVVPHQW (PHUJHQF\3ODQQLQJ Protecting Public Health Since 1928Protecting Public Health Since 1928 &ĂůůϮϬϭϵ /ŶĐƌĞĂƐĞĚĐĂůůƐĨŽƌƐĞƌǀŝĐĞŝŶƚŚĞ>ĂYƵŝŶƚĂŽǀĞ /ŶǀĂƐŝǀĞĞĚĞƐ͊ ĞŐĂŶƚĂƌŐĞƚĞĚĞĚƵĐĂƚŝŽŶĂŶĚŽƵƚƌĞĂĐŚƉƌŽŐƌĂŵŝŶƚŚĞŽǀĞ ±DŽƌĞƚƌĂƉƉŝŶŐ ±ǀĞƌLJtĞĚŶĞƐĚĂLJĨŽƌϲǁĞĞŬƐĚŽŽƌͲƚŽͲĚŽŽƌ ϵ ϭϬ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϲ Protecting Public Health Since 1928Protecting Public Health Since 1928 ĞĚĞƐ ďLJƚŚĞŶƵŵďĞƌƐ Protecting Public Health Since 1928Protecting Public Health Since 1928 ϮϬϮϬWůĂŶŶĞĚƉƉůŝĐĂƚŝŽŶ tŝĚĞƌĞĂ>ĂƌǀĂĐŝĚĞ DŽƐƋƵŝƚŽŽŶƚƌŽů ƉƉůŝĐĂƚŝŽŶƐ tĞĞŬůLJ:ƵůLJϭϴͲƵŐƵƐƚϴ͕ ƚŚĞŶďŝͲǁĞĞŬůLJƚŚƌŽƵŐŚ ^ĞƉƚĞŵďĞƌϭϮ ŚƚƚƉƐ͗ͬͬďŝƚ͘ůLJͬ>YŽǀĞĞĚĞƐ ƉƉůŝĐĂƚŝŽŶdŝŵŝŶŐ ϭϭ ϭϮ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϳ Protecting Public Health Since 1928Protecting Public Health Since 1928 DŽƐƋƵŝƚŽͲďŽƌŶĞǀŝƌƵƐ DŽƐƋƵŝƚŽͲďŽƌŶĞǀŝƌƵƐĚĞƚĞĐƚĞĚŝŶ>ĂYƵŝŶƚĂDĂLJϮϴ͕ϮϬϮϬ Protecting Public Health Since 1928Protecting Public Health Since 1928 >ĂYƵŝŶƚĂWŽƐŝƚŝǀĞƐĂŵƉůĞƐ EĞĂƌdƌŝůŽŐLJ EŽŶĞŝŶƚŚĞŽǀĞ ϭϯ ϭϰ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϴ Protecting Public Health Since 1928Protecting Public Health Since 1928 ŝƚLJŽĨ>ĂYƵŝŶƚĂͲ dƌŝůŽŐLJ ,ŝŐŚƉƌŝŽƌŝƚLJƚŽƉƌŽƚĞĐƚƉĞŽƉůĞĨƌŽŵŵŽƐƋƵŝƚŽͲďŽƌŶĞǀŝƌƵƐ :ƵŶĞϭͲϯ DƵůƚŝƉůĞǀŝƌƵƐƉŽƐŝƚŝǀĞ ƐĂŵƉůĞƐ sƵůŶĞƌĂďůĞƉŽƉƵůĂƚŝŽŶ ĐŽŵŵƵŶŝƚLJ;ϱϬнͿ Protecting Public Health Since 1928Protecting Public Health Since 1928 ŝƚLJŽĨ>ĂYƵŝŶƚĂͲ dƌŝůŽŐLJ EŽĂĚĚŝƚŝŽŶĂůǀŝƌƵƐĚĞƚĞĐƚĞĚƵŶƚŝů:ƵůLJϭ͕ĂŐĂŝŶŽŶ:ƵůLJϮ͘ ĚĚŝƚŝŽŶĂůďĂƌƌŝĞƌƚƌĞĂƚŵĞŶƚƐĐŽŵƉůĞƚĞĚ:ƵůLJϲ͘ ϭϱ ϭϲ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϵ Protecting Public Health Since 1928Protecting Public Health Since 1928 tŚĂƚĐĂŶƌĞƐŝĚĞŶƚƐĚŽ͍ WƌĞǀĞŶƚďŝƚĞƐ ŽŶ͛ƚŐŽŽƵƚƐŝĚĞĂƌŽƵŶĚĚĂǁŶĂŶĚĚƵƐŬ͘ tĞĂƌďƵŐƐƉƌĂLJ͘ ŽǀĞƌƵƉ͘ WƌĞǀĞŶƚŵŽƐƋƵŝƚŽďƌĞĞĚŝŶŐ ŚĞĐŬĚƌĂŝŶƐĨŽƌǁĂƚĞƌĂŶĚĚĞďƌŝƐ͘ ZĞĨƌĞƐŚ ĂŶĚĐůĞĂŶƉĞƚĚŝƐŚĞƐŽƌǁĂƚĞƌĨĞĂƚƵƌĞƐǁĞĞŬůLJ͘ ^ǁŝŵŵŝŶŐƉŽŽůƐ͕ŽƌŶĂŵĞŶƚĂůƉŽŶĚƐ͕ĂŶĚĨŽƵŶƚĂŝŶƐ ƌĞƋƵŝƌĞǁŽƌŬŝŶŐƉƵŵƉƐĂŶĚƌĞŐƵůĂƌŵĂŝŶƚĞŶĂŶĐĞ͘ Protecting Public Health Since 1928Protecting Public Health Since 1928 tŚĂƚĐĂŶƚŚĞŝƚLJĚŽ͍ WƌĞǀĞŶƚŵŽƐƋƵŝƚŽďƌĞĞĚŝŶŐ ŚĞĐŬƐƚƌĞĞƚŐƵƚƚĞƌƐ͕ĐĂƚĐŚďĂƐŝŶƐ͕ĂŶĚĚƌĂŝŶƐ ±ůĞĂƌĚĞďƌŝƐ͕ĐůĞĂŶƌĞŐƵůĂƌůLJ ŚĞĐŬůĂŶĚƐĐĂƉŝŶŐĨŽƌŽǀĞƌǁĂƚĞƌŝŶŐ KƌŶĂŵĞŶƚĂůƉŽŶĚƐĂŶĚĨŽƵŶƚĂŝŶƐƌĞƋƵŝƌĞǁŽƌŬŝŶŐ ƉƵŵƉƐĂŶĚƌĞŐƵůĂƌŵĂŝŶƚĞŶĂŶĐĞ ±ZĞƉŽƌƚŶĞŐůĞĐƚĞĚŽƌĂďĂŶĚŽŶĞĚƐǁŝŵŵŝŶŐƉŽŽůƐ ϭϳ ϭϴ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϭϬ Protecting Public Health Since 1928Protecting Public Health Since 1928 tŚĂƚĐĂŶĞǀĞƌLJŽŶĞĚŽ͍ ^ŝŐŶƵƉĨŽƌŶŽƚŝĨŝĐĂƚŝŽŶǁǁǁ͘ĐǀŵŽƐƋƵŝƚŽ͘ŽƌŐ Protecting Public Health Since 1928Protecting Public Health Since 1928 dŚĂŶŬLJŽƵ͊ &ŝŐŚƚƚŚĞŝƚĞ͊dŽŐĞƚŚĞƌ sŵŽƐƋƵŝƚŽ͘ŽƌŐ ϳϲϬͲϯϰϮͲϴϮϴϳ ĐǀŵŽƐƋƵŝƚŽΛĐǀŵǀĐĚ͘ŽƌŐ dĂŵŵLJ'ŽƌĚŽŶƚŐŽƌĚŽŶΛĐǀŵǀĐĚ͘ŽƌŐ ϭϵ ϮϬ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϭϭ City Council Meeting July 7, 2020 P3 – Ironman 70.3 Triathlon Update Ϯϭ ϮϮ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϭϮ Ironman Update 2019 Economic Impact Report 2020 Ironman’s Safety Guidelines Ϯϯ Ϯϰ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϭϯ MARKETS: San Diego and Los Angeles/Orange County EVENT BILLBOARD IMPRESSIONS 6.7M WEBSITE EVENT –Ironman 70.3 Indian Wells La Quinta 2,863 Pageviews 6:06 minutes Average Time on Page January 1, 2019 - December 9, 2019 Ϯϱ Ϯϲ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϭϰ DIGITAL - CONTENT • 12 Months of Greater Palm Springs 505 pageviews BLOG POSTS 3 Posts 1,142 Total Pageviews • On the Run: 5Ks and More in Greater Palm Springs (2019-2020 Season) 381 pageviews January 1, 2019 - December 9, 2019 • This Week in Greater Palm Springs: Dec. 3-9 256 pageviews SOCIAL MEDIA 3 Posts Total |70 Engagements Total | 5,976 Impressions Total Ϯϳ Ϯϴ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϭϱ PUBLIC RELATIONS IPW – Anaheim Visit California UK and Ireland Mission Visit California Canada Media Mission Visit California Korea and Japan Los Angeles Media Event San Francisco Media Event Visit California Atlanta Boot Camp CVB Media Events ECONOMIC IMPACT – Tourism Economics Attendance •2,455 day attendees •4,985 overnight attendees 1.8M Lodging 1.3M Recreation $800- $900K Transportatio n / F&B Overnight Impact •estimated room demand: 8,902 • spent an average of $1,135 • stayed 3.75 days • ADR of $206.00 •1.8M total lodging spend •1.3 M total recreation spend •$800-900K total transportation/F&B/retail spend Total Spend Generated $6,352,908 in direct business sales Ϯϵ ϯϬ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϭϲ ECONOMIC IMPACT – Tourism Economics Total Jobs Supported •total 6,319 jobs • equivalent to 80 annual full-time employees Taxes • federal taxes: $890,094 • total state taxes: $422,290 • total bed tax: $210,883 • local sales taxes: $70,441 • property taxes: $128,081 1.8M Lodging 1.3M Recreation $800- $900K Transportatio n / F&B TOTAL EVENT ECONOMIC IMPACT $9,918,422 in total business sales to local economy THANK YOU! ϯϭ ϯϮ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϭϳ ϯϯ ϯϰ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϭϴ ϯϱ ϯϲ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϭϵ City Council Meeting Wanda and Anna Proclamations ϯϳ ϯϴ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϮϬ ϯϵ ϰϬ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ Ϯϭ City Council Meeting July 7, 2020 B2 – Round IV COVID-19 Small Business Relief Program Relief Program Overview Rounds 1 and 2 – Loan Program Round 3 – Rebate Program Approx. $555,000 awarded and 55 businesses helped ϰϭ ϰϮ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ ϮϮ Rebate Program Currently 7 Businesses have successfully applied Approx. $17,000 awarded Safety equipment and sanitation products purchased Proposed Changes Additional Rebate Program options for restaurants ±Rent/Mortgage ±Meals for the Community New Round 4 Program ϰϯ ϰϰ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬ Ϯϯ ϰϱ ŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐ :ƵůLJϳ͕ϮϬϮϬdƵĞƐĚĂLJ ,ŽŶŽƌĂďůĞDĂLJŽƌŽĨ>ĂYƵŝŶƚĂ͕ŝƚLJŽƵŶĐŝůDĞŵďĞƌƐ͕ 'ŽŽĚĨƚĞƌŶŽŽŶ͘DLJŶĂŵĞŝƐDĂƌŝĂ>͘WƵĞŶƚĞ͘/ĂŵĂƌĞƐŝĚĞŶƚŽĨ>Y͘/ŚĂǀĞůŝǀĞĚŝŶ>YĨŽƌϯϬLJĞĂƌƐ͘/ǁĂƐ Ă,ŝƐƚŽƌŝĐĂůWƌĞƐĞƌǀĂƚŝŽŶŽŵŵŝƐƐŝŽŶĞƌǁŚĞŶƚŚĞĐŝƚLJĐƌĞĂƚĞĚƚŚĂƚĐŽŵŵŝƐƐŝŽŶŝŶϭϵϵϰ͘/ĂŵĂƚĞĂĐŚĞƌĂƚ >Y,^ĂŶĚĂŶĚũƵŶĐƚWƌŽĨĞƐƐŽƌĂƚŽůůĞŐĞŽĨƚŚĞĞƐĞƌƚ͘ /ŽǁŶĂŚŽƵƐĞŝŶEŽƌƚŚ>ĂYƵŝŶƚĂ͕ŝŶƚŚĞĐĂĐŝĂ,ŽŵĞƐ͘/ŚĂǀĞďĞĞŶĞŶũŽLJŝŶŐŵLJƉƌŽƉĞƌƚLJƉĞĂĐĞĨƵůůLJ͕ĂƐ ŵLJŚŽŵĞŝƐƚŚĞƉůĂĐĞǁŚĞƌĞ/ĐŽŵĞďĂĐŬĨŽƌƉĞĂĐĞ͕ƌĞƐƚĂŶĚƚŽƌĞĐƵƉĞƌĂƚĞĨƌŽŵƚŚĞƐƚƌĞƐƐĂƚǁŽƌŬ͘DLJ ƉƌŽƉĞƌƚLJŝƐƚŚĞƉůĂĐĞǁŚĞƌĞ/ĨŝŶĚƚŚĞƐŽůĂĐĞƚŽƌĞĐŚĂƌŐĞĞŵŽƚŝŽŶĂůůLJ͕/ǁĂƚĞƌŵLJƉůĂŶƚƐ͕ŐĂƌĚĞŶ͕ĨĞĞĚ ĂŶĚůŝƐƚĞŶƚŽƚŚĞďŝƌĚƐ͕ƐŝƚŝŶŵLJƉĂƚŝŽƚŽƉĂƵƐĞĂŶĚƌĞĨůĞĐƚĨƌŽŵŽƵƌďƵƐLJ͕ĨƌĂŶƚŝĐĂŶĚƐƚƌĞƐƐĨƵůůŝĨĞ͘ Ɛ/ŚĂǀĞƐĂŝĚ͕/ŚĂǀĞĞŶũŽLJĞĚŵLJƉƌŽƉĞƌƚLJĨŽƌŵĂŶLJLJĞĂƌƐ͙ƵŶƚŝůƚŚŝƐƉĂƐƚLJĞĂƌ͘ /ŶEŽƌƚŚ>ĂYƵŝŶƚĂ͕ĂƚϳϴͲϲϭϱ^ĂŶŝƚĂƌŝǀĞ͕ŝŶ>ĂYƵŝŶƚĂĚĞůZĞLJ͕ƚŚĞƌĞŝƐĂŶŝŶĨĂŵŽƵƐĂŶĚƵŶďĞĂƌĂďůĞ ^dZsƉƌŽƉĞƌƚLJůŽĐĂƚĞĚũƵƐƚĚŝƌĞĐƚůLJďĞŚŝŶĚŵLJďĂĐŬLJĂƌĚ͘dŚĞƉƌĞǀŝŽƵƐŽǁŶĞƌƐƌĞƚŝƌĞĚĂŶĚƐŽůĚƚŚĞ ƉƌŽƉĞƌƚLJŝŶ:ƵŶĞϮϬϭϵ͕ĂŶĚƐŝŶĐĞƚŚĞŶŝƚŚĂƐďĞĞŶŚĞůůŽŶĞĂƌƚŚĨŽƌŵĞ͘dŚĞŶĞǁŽǁŶĞƌĐŽŶǀĞƌƚĞĚƚŚĂƚ ƉƌŽƉĞƌƚLJŝŶƚŽĂƐŚŽƌƚƚĞƌŵƌĞŶƚĂů͘dŚĞLJƌĞŶƚĞǀĞƌLJĚĂLJŽĨƚŚĞǁĞĞŬĂŶĚĚƵƌŝŶŐƚŚĞǁĞĞŬĞŶĚĂƐǁĞůů͘/ƚ ŚĂƐďĞĐŽŵĞĂƚƌƵĞŵĂĚŚŽƵƐĞ͘ǀĞƌLJƚŚƌĞĞĚĂLJƐ/ĚƌĞĂĚƚŽƐĞĞǁŚŽĂƌĞƚŚĞŶĞdžƚƉĞŽƉůĞĐŽŵŝŶŐ͘/ŶĞǀĞƌ ŐĞƚĂďƌĞĂŬƚŽĞŶũŽLJƉĞĂĐĞĂŶĚƋƵŝĞƚĂŶĚƚŽƌĞƐƚŝŶŵLJŽǁŶƉƌŽƉĞƌƚLJ͘/ƚƐĞĞŵƐƚŚĂƚĞǀĞƌLJǁĞĞŬƚŚĞ ƐĂŵĞǀŝĐŝŽƵƐĐLJĐůĞƌĞƉĞĂƚƐ͘dŚŝƐŝƐŶŽƚƋƵĂůŝƚLJŽĨůŝĨĞĂƚĂůů͘ dŚĞƌĞŶƚĞƌƐĂƌĞŽƵƚŽĨĐŽŶƚƌŽů͘dŚĞLJƉůĂLJƌĞĂůůLJůŽƵĚŵƵƐŝĐǁŝƚŚŵŝĐƌŽƉŚŽŶĞƐĂŶĚƐƉĞĂŬĞƌƐ;ŝƚĞdžĐĞĞĚƐ ƉĞƌŵŝƚƚĞĚĚĞĐŝďĞůƐͿĚƵƌŝŶŐƚŚĞĚĂLJĂŶĚĂƚŶŝŐŚƚ;ƉĂƐƚϭϬƉŵ͕ǁŚĞŶƚŚĞLJƐƚĂƌƚƚŚĞŝƌƉĂƌƚŝĞƐͿ͕ƚŚĞLJŚĂǀĞ ŬĂƌĂŽŬĞƐĞƐƐŝŽŶƐǁŝƚŚŵŝĐƌŽƉŚŽŶĞƐƚŽŵĂŬĞŝƚĞǀĞƌůŽƵĚĞƌ͕ƚŚĞLJƐĐƌĞĂŵĨƌŽŵƚŚĞƚŽƉŽĨƚŚĞŝƌůƵŶŐƐ͕ƚŚĞLJ ũƵŵƉŝŶƚŚĞƉŽŽůŵĂŬŝŶŐĂďŝŐƐƉůĂƐŚ͕ĂŶĚĐƌĞĂƚĞĂƚƌƵĞĐĂůĂŵŝƚLJĞŶǀŝƌŽŶŵĞŶƚĨŽƌƚŚĞŶĞŝŐŚďŽƌƐ͘ dŚĞƌĞŶƚĞƌƐŚĂǀĞŶŽƌĞƐƉĞĐƚŽƌĐŽŶƐŝĚĞƌĂƚŝŽŶĨŽƌƋƵŝĞƚƚŝŵĞƐŽƌƚŽƚŚĞŶĞŝŐŚďŽƌŚŽŽĚ͘dŚĞƌĞŝƐƚƌĂƐŚĂůů ŽǀĞƌƚŚĞƐŝĚĞǁĂůŬĂŶĚŵĂŶLJĐĂƌƐƉĂƌŬĞĚĂŶĚďůŽĐŬŝŶŐƚƌĂƐŚĐŽůůĞĐƚŝŽŶ͘dŚĞŽŶůLJƚŚŝŶŐǁĂŝƚŝŶŐƚŽ ŚĂƉƉĞŶŝƐĂƐŚŽŽƚŝŶŐŽƌĂĨŝƌĞŝŶƚŚĂƚƉƌŽƉĞƌƚLJ͕'ŽĚĨŽƌďŝĚ͕ĂŶĚĨŽƌƚŚĞƌĞŶƚĞƌƐƚŽũƵŵƉƚŚĞĨĞŶĐĞĂŶĚĚŽ ƐŽŵĞƚŚŝŶŐƚŽŵĞ͘/ĨĞĂƌĨŽƌŵLJƉĞƌƐŽŶĂůƐĂĨĞƚLJ͘dŚĞLJƐŵŽŬĞŵĂƌŝŚƵĂŶĂĂŶĚƚŚĞŽĚŽƌĐŽŵĞƐƚŽŵLJ ŚŽƵƐĞ͘tŚLJĚŽ/ŶĞĞĚƚŽƐŵĞůůͬďƌĞĂƚŚĞƚŚĞƐĞĐŽŶĚŚĂŶĚŵĂƌŝŚƵĂŶĂǁŚŝůĞƚƌLJŝŶŐƚŽƐŝƚĂŶĚĞŶũŽLJŵLJ ďĂĐŬLJĂƌĚ͍ DLJŵĂƐƚĞƌƌŽŽŵĨĂĐĞƐĚŝƌĞĐƚůLJƚŽƚŚĞŝƌƐǁŝŵŵŝŶŐƉŽŽů͘/ĐĂŶ͛ƚŚĞůƉďƵƚƚŽŚĞĂƌĂŶĚƌĞĐĞŝǀĞĂůůƚŚĞ ĂĐŽƵƐƚŝĐǁĂǀĞĂŶĚďĂŶŐƐĨƌŽŵƚŚĞůŽƵĚŵƵƐŝĐĂŶĚƐĐƌĞĂŵŝŶŐĚƵƌŝŶŐƚŚĞĚĂLJĂŶĚĚƵƌŝŶŐƚŚĞŶŝŐŚƚ͘DLJ ŚŽƵƐĞǁĂƐďƵŝůƚǁŝƚŚƐƚĂŶĚĂƌĚŝŶƐƵůĂƚŝŽŶ͕ŶŽƚƐŽŶŝĐƐŽƵŶĚƉƌŽŽĨ͘tŚLJĚŽĞƐĐŝƚLJŽĨ>ĂYƵŝŶƚĂĂůůŽǁƚŚŝƐ ƐƵĨĨĞƌŝŶŐŽĨƵŶƐŽůŝĐŝƚĞĚŵĂĚďĞŚĂǀŝŽƌƚŽŐŽŽŶĂƚƚŚĞĞdžƉĞŶƐĞŽĨƚŚĞƉŽŽƌĞŶĚƵƌŝŶŐŶĞŝŐŚďŽƌƐ͍͍ DLJŶĞŝŐŚďŽƌŚŽŽĚǁĂƐĚĞƐŝŐŶĞĚ͕ďƵŝůƚ͕ĂĚǀĞƌƚŝƐĞĚĂŶĚƐŽůĚĂƐĂƌĞƐŝĚĞŶƚŝĂůŶĞŝŐŚďŽƌŚŽŽĚ͘dŚĂƚŵĞĂŶƐ ƐƚĞĂĚLJĂŶĚĞƐƚĂďůŝƐŚĞĚƉĞŽƉůĞůŝǀĞƚŚĞƌĞ͕ŐŽƚŽǁŽƌŬĂŶĚĐŽŵĞďĂĐŬƚŽƚŚĞŝƌŚŽŵĞƐƚŽƌĞƐƚĂŶĚĞŶũŽLJ ƚŚĞƚƌĂŶƋƵŝůŝƚLJŽĨƚŚĞŝƌŚŽŵĞƐ͘ DLJŚŽƵƐĞŝƐůŽĐĂƚĞĚŝŶĂƌĞƐŝĚĞŶƚŝĂůŶĞŝŐŚďŽƌŚŽŽĚ͕ŶŽƚŝŶĂŵŽƚĞůƌŽǁ͕ƉĂƌƚLJƐƚƌĞĞƚ͕ŽŶŐŽŝŶŐŽĂĐŚĞůůĂ &ĞƐƚ͕^ƵŵŵĞƌŶĞǀĞƌŶĚŝŶŐ>ŽǀĞ,ŽƵƐĞ͕tŝůĚWĂƌƚLJƐƋƵĂƌĞĂŶĚĂŚŽƵƐĞŽĨƋƵĞƐƚŝŽŶĂďůĞƌĞƉƵƚĂƚŝŽŶ ǁŚĞƌĞĐŽŶƐƚĂŶƚƚƌĂŶƐŝĞŶƚLJŽƵŶŐƉĞŽƉůĞĂƌĞŝŶĂŶĚŽƵƚ͕ĂĐƚŝŶŐůŝŬĞĂƉĂĐŬŽĨǁŽůǀĞƐ͘ŶĚďLJƚŚĞǁĂLJ͕ CITY COUNCIL MEETIN G- JULY 7, 2020 - PUBLIC COMMENTS BY RESIDENT MARIA PUENTE PUBLIC COMMENT ON MATTERS NOT ON THE AGENDA - RELATED TO STVR ŶĞǀĞƌŽďƐĞƌǀŝŶŐĂŶLJƐŽĐŝĂůĚŝƐƚĂŶĐŝŶŐŽƌǁŚĂƚƐŽĞǀĞƌ͕ĞŶĚĂŶŐĞƌŝŶŐƚŚĞƐĂĨĞƚLJĂŶĚŚĞĂůƚŚŽĨƚŚŽƐĞĂƌŽƵŶĚ ĂŶĚŶĞĂƌďLJ͘ dŚĂƚŝƐŶŽƚƚŚĞƋƵĂůŝƚLJŽĨůŝĨĞ/ǁĂƐƐŽůĚĂŶĚ/ďŽƵŐŚƚǁŚĞŶ/ŝŶǀĞƐƚĞĚŝŶŵLJŚŽƵƐĞ͘dŚŝƐŝƐĂĨĨĞĐƚŝŶŐƚŚĞ ǀĂůƵĞŽĨŵLJƉƌŽƉĞƌƚLJ͕ŵLJƉĞĂĐĞŽĨŵŝŶĚ͕ŵLJƉĞƌƐŽŶĂůƐĂĨĞƚLJĂŶĚƉƌŽĚƵĐŝŶŐĂŶdžŝĞƚLJĂŶĚĐŽƵŶƚůĞƐƐ ƐůĞĞƉůĞƐƐŶŝŐŚƚƐ͘ &ŽƌƚŚĞůĂƐƚϭϭŵŽŶƚŚƐ/ŚĂǀĞŬĞƉƚĂůŽŐŽĨĂƚůĞĂƐƚϲϬƉŚŽŶĞĐĂůůƐ;ĂŶĚĐŽƵŶƚŝŶŐͿƉůĂĐĞĚƚŽƚŚĞ,ŽƚůŝŶĞ͕ WŽůŝĐĞĂŶĚŝƚLJ,Ăůů͕ǁŚŝĐŚŝƐƚŚĞƉƌŽĐĞĚƵƌĞƉƵƚŝŶƉůĂĐĞďLJŝƚLJŽĨ>ĂYƵŝŶƚĂĨŽƌŶĞŝŐŚďŽƌƐƚŽĐŽŵƉůĂŝŶ ĂďŽƵƚĂŶLJĚŝƐƚƵƌďĂŶĐĞďLJ^dsZƐ͘dŚĂƚĚŽĞƐŶŽƚǁŽƌŬ͘dŚĞƉƌŽƉĞƌƚLJǀŝŽůĂƚĞƐƌƵůĞƐĞǀĞƌLJǁĞĞŬ͕ĂŶĚLJĞƚ͕ ƚŚĞLJŬĞĞƉƌĞŶƚŝŶŐƚŚĞƉůĂĐĞĂŶĚŶŽƚŚŝŶŐŚĂƐŚĂƉƉĞŶĞĚLJĞƚƚŽƐŽůǀĞƚŚĞŽŶŐŽŝŶŐƉƌŽďůĞŵ͘tŚĂƚĂďŽƵƚ ƚŚĞƚŚƌĞĞƐƚƌŝŬĞƐĂŶĚLJŽƵƌƉĞƌŵŝƚŝƐƌĞǀŽŬĞĚ͍ dŚĞŚŽƚůŝŶĞƉĞƌƐŽŶƐĂLJƐƚŚĂƚŝĨŝŶϰϱŵŝŶƵƚĞƐƚŚĞŶŽŝƐĞŚĂƐŶŽƚĐĞĂƐĞĚ͕ƉůĞĂƐĞĐĂůůĂŐĂŝŶ͘KŬ͕ƐŽĂƚϮĂŵ/ ĂŵƐƵƉƉŽƐĞĚƚŽďĞĐŽƵŶƚŝŶŐƚŚĞŵŝŶƵƚĞƐĂŶĚƚŚĞĐĂůůĂŐĂŝŶ͍͍tŚĞŶ/ĐĂůůƚŚĞƉŽůŝĐĞƚŚĞLJƚĞůůŵĞƚŚĞLJ ǁŝůůƐĞŶĚĂĚĞƉƵƚLJǁŚĞŶŚĞͬƐŚĞŝƐŝŶƚŚĞĂƌĞĂĂŶĚĂǀĂŝůĂďůĞďĞĐĂƵƐĞƚŚĞLJŚĂǀĞŵŽƌĞƉƌĞƐƐŝŶŐƐŝƚƵĂƚŝŽŶƐ ƚŽƚĂŬĞĐĂƌĞŽĨ͖ďLJƚŚĞƚŝŵĞƚŚĞLJĐŽŵĞƚŚĞƌĞŶƚĞƌƐĂƌĞƉĂƐƐĞĚŽƵƚĨƌŽŵŽǀĞƌĚƌŝŶŬŝŶŐĂŶĚďĞŝŶŐŚŝŐŚĨƌŽŵ ĚƌƵŐƐ͘dŚŝƐŝƐĂŵŽƐƚĨƌƵƐƚƌĂƚŝŶŐƐŝƚƵĂƚŝŽŶ͘ǀĞŶƚƵĂůůLJ͕ŝĨƚŚĞĐŝƚLJĨŝŶĞƐƚŚĞŽǁŶĞƌ͕ƚŚĞĐŝƚLJĐŽůůĞĐƚƐƚŚĞ ŵŽŶĞLJ͖ŚŽǁĞǀĞƌ͕ƚŚĞŶĞŝŐŚďŽƌĚŽŝŶŐƚŚĞƌĞƉŽƌƚŝŶŐ͕ƚŚĞĐĂůůŝŶŐĂŶĚƚŚĞĞŶĚƵƌŝŶŐŽĨƚŚĞǀŝŽůĂƚŝŽŶŐĞƚƐ ŶŽƚŚŝŶŐ͕ŶŽƌĞƐŽůƵƚŝŽŶ͕ŶŽƐĂƚŝƐĨĂĐƚŝŽŶ͘dŚŝƐŝƐŶŽƚǁŽƌŬŝŶŐ͘ /ŚĂǀĞĂůƐŽĞǀĞŶďĞĞŶƚŽůĚŽŶĐĞƚŽŐĞƚŵLJƐĞůĨĂƐĞƚŽĨŚĞĂĚƉŚŽŶĞƐƚŽŶŽƚŚĞĂƌƚŚĞŶŽŝƐĞ͕ŝŶŵLJŽǁŶ ŚŽƵƐĞ͍͍͊͊dŚĂƚŝƐƐŽĚŝƐƌĞƐƉĞĐƚĨƵůĂŶĚŝŶƐĞŶƐŝƚŝǀĞ͘/ƐŚŽƵůĚŶŽƚďĞŝŶŵLJŽǁŶŚŽƵƐĞǁĞĂƌŝŶŐĂƐĞƚŽĨ ŚĞĂĚƉŚŽŶĞƐƚŽďůŽĐŬƚŚĞůŽƵĚŵƵƐŝĐĨƌŽŵǁŝůĚƉĞŽƉůĞƉĂƌƚLJŝŶŐ͘ WĂůŵĞƐĞƌƚĚŽĞƐŶŽƚĂůůŽǁ^dsZƐĂŶĚƚŚĂƚĂƚŚĞĚƌĂůŝƚLJŝƐŝŶƚŚĞƉƌŽĐĞƐƐŽĨďĂŶŶŝŶŐƚŚĞŵ͘'ĂƚĞĚ ĐŽŵŵƵŶŝƚŝĞƐƚŚƌŽƵŐŚŽƵƚ>ĂYƵŝŶƚĂĚŽŶŽƚĂůůŽǁĂŶLJƐŚŽƌƚƚĞƌŵƌĞŶƚĂůƐĂƚĂůů͖ƚŚĞLJŽŶůLJĂůůŽǁƌĞŶƚĂůƐŽĨ ĂƚůĞĂƐƚŽŶĞŵŽŶƚŚ͘dŚĞĐŝƚLJŽĨ>YŝƐĂůůŽǁŝŶŐĂůůƚŚŽƐĞƉĂĐŬŽĨǁŽůǀĞƐĚĞƐƚƌŽLJŝŶŐƚŚĞŶŽŶŐĂƚĞĚ ŶĞŝŐŚďŽƌŚŽŽĚƐ͘dŚĂƚŝƐĂƚLJƉĞŽĨĚŝƐĐƌŝŵŝŶĂƚŝŽŶƚŽǁĂƌĚƐƚŚĞƉĞŽƉůĞǁŚŽĐĂŶ͛ƚĂĨĨŽƌĚƚŽůŝǀĞŝŶĂŐĂƚĞĚ ĐŽŵŵƵŶŝƚLJ͘'ŽŽĚƉĞŽƉůĞĂƌĞŐŽŝŶŐƚŽŚĂǀĞƚŽŵŽǀĞŽƵƚďĞĐĂƵƐĞƚŚĞƌĞŝƐŶŽǁĂLJƚŽůŝǀĞŝŶƚŚĞƐĞ ĐŽŶĚŝƚŝŽŶƐ͘tĞŝŶƚŚĞĚĞƐĞƌƚǁĂŶƚĂŶĚŶĞĞĚƉĞĂĐĞĂŶĚƐĞƌĞŶŝƚLJ͕ŶŽƚĐŽŶƐƚĂŶƚĚŝƐƚƵƌďĂŶĐĞƐ͘/ĚŽŶŽƚ ǁĂŶƚƚŽŵŽǀĞ͕/ŚĂǀĞŝŶǀĞƐƚĞĚŵLJĐĂƌĞĞƌĂŶĚŵLJůŝĨĞŝŶ>Y͘/ǁĂŶƚƚŽƐƚĂLJŚĞƌĞ͘ tŚĂƚĞůƐĞŝƐƚŚĞƌĞĨŽƌŵĞƚŽĚŽ͍tŚĂƚĞůƐĞĚŽĞƐĐŝƚLJŽĨ>ĂYƵŝŶƚĂĞdžƉĞĐƚŵĞƚŽĚŽ͍dŚŝƐĐĂŶ͛ƚŐŽŽŶ ĂŶLJůŽŶŐĞƌ͘dŚĞƐŝƚƵĂƚŝŽŶŝƐƌĞĂůůLJĚŝƐƚƵƌďŝŶŐ͘EŽďŽĚLJĐĂŶůŝǀĞůŝĨĞůŝŬĞƚŚŝƐ͕ƉŽůŝĐŝŶŐƌĞŶƚĞƌƐ͕ĐĂůůŝŶŐ ŚŽƚůŝŶĞƐ͕ĐĂůůŝŶŐƚŚĞƉŽůŝĐĞ͕ĐŽŶƚĂĐƚŝŶŐƚŚĞŝƚLJ͖ŝƚŝƐĂĐĂƚĐŚϮϮ͕ĂŶĚƚŚŝƐǀŝĐŝŽƵƐĐLJĐůĞƌĞƉĞĂƚƐǁĞĞŬůLJ͊͊/ ĂŵƌĞĂĐŚŝŶŐŽƵƚƚŽLJŽƵ͕ĞůĞĐƚĞĚŽĨĨŝĐŝĂůƐ͕ďĞĐĂƵƐĞLJŽƵŚĂǀĞƚŚĞĚƵƚLJ͕ŽďůŝŐĂƚŝŽŶĂŶĚƌĞƐƉŽŶƐŝďŝůŝƚLJƚŽ ĐĂƌĞĨŽƌƚŚĞǁĞůĨĂƌĞŽĨƚŚĞƌĞƐŝĚĞŶƚƐŽĨ>Y͕ĂŶĚƚŽƉƌŽƚĞĐƚƚŚĞĨƵůůƚŝŵĞƌĞƐŝĚĞŶƚƐĨƌŽŵƚŚŝƐŶŽŶƐĞŶƐĞ ƚŚĂƚLJŽƵŚĂǀĞĂůůŽǁĞĚƚŽŚĂƉƉĞŶĂŶĚƐŶŽǁďĂůů͘dŚĞůĂƚĞƐƚ/ŚĂǀĞŚĞĂƌĚŝƐƚŚĂƚƚŚĞƉƌŽƉĞƌƚLJŝŶƋƵĞƐƚŝŽŶ ŝƐďĞŝŶŐŐŝǀĞŶĂϲϬĚĂLJƐƐƵƐƉĞŶƐŝŽŶĂŶĚĂĐŝƚĂƚŝŽŶ͖ŚŽǁĞǀĞƌ͕ƚŚĂƚŚĂƐŶŽƚŚĂƉƉĞŶĞĚLJĞƚĂŶĚŝƚŝƐŶŽƚ ĞŶŽƵŐŚ͘ĨƚĞƌƚŚĂƚƚŝŵĞƚŚĞƐĂŵĞƉƌŽďůĞŵǁŝůůĐŽŶƚŝŶƵĞ͘dŚĞƉƌŽƉĞƌƚLJŶĞĞĚƐƚŽďĞƚŽƚĂůůLJďĂŶŶĞĚĨŽƌ ƐŚŽƌƚƚĞƌŵƌĞŶƚĂůƐĂŶĚŐĞƚďĂĐŬƚŽďĞŝŶŐƉĂƌƚŽĨƚŚĞƋƵŝĞƚŶĞŝŐŚďŽƌŚŽŽĚǁŚĞƌĞŝƚŝƐůŽĐĂƚĞĚ͘ tŚLJĚŽĞƐƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂƚŚŝŶŬƚŚĂƚŚĂƐƚŚĞƌŝŐŚƚƚŽƚĂŬĞĂǁĂLJŵLJƌŝŐŚƚƚŽĞŶũŽLJŵLJŽǁŶ ƉƌŽƉĞƌƚLJ͕ŵLJƌŝŐŚƚƚŽƉĞĂĐĞ͕ƚƌĂŶƋƵŝůŝƚLJĂŶĚƋƵŝĞƚŝŶŵLJŽǁŶƉƌŽƉĞƌƚLJ͕ĂŶĚŐŝǀĞƚŚĂƚƌŝŐŚƚƚŽƚŚĞ ĂďƵƐŝǀĞƌĞŶƚĞƌƐ͍/ŚĂǀĞƚŽŐĞƚƵƉďLJϱ͗ϯϬDƚŽŐŽƚŽǁŽƌŬ͘/ŶĞĞĚŵLJƌĞƐƚ͘tŚLJĐĂŶ͛ƚ/ŐŽĨƌĞĞůLJƚŽ ďĞĚĂƚϵƉŵďƵƚŝŶƐƚĞĂĚ/ŚĂǀĞƚŽďĞǁĂŝƚŝŶŐƵŶƚŝůϭϬƉŵƚŽƐĞĞŝĨƚŚĞƌĞŶƚĞƌƐƋƵŝĞƚĚŽǁŶ͕ǁŚŝĐŚƚŚĞLJĚŽ CITY COUNCIL MEETIN G- JULY 7, 2020 - PUBLIC COMMENTS BY RESIDENT MARIA PUENTE PUBLIC COMMENT ON MATTERS NOT ON THE AGENDA - RELATED TO STVR ŶŽƚ͕ĂŶĚƚŚĞŶ/ŚĂǀĞƚŽƐƚĂƌƚƚŚĞƵŶƉƌŽĚƵĐƚŝǀĞƉŚŽŶĞĐĂůůƐƐĞƐƐŝŽŶĂŶĚůŽƐĞĂŶŽƚŚĞƌŶŝŐŚƚŽĨƐůĞĞƉ͍/Ăŵ ĂŚŽƐƚĂŐĞŝŶŵLJŽǁŶŚŽŵĞ͊ tŚLJĚŽĞƐĐŝƚLJŽĨ>YĂůůŽǁƚŚŝƐ^dsZƐƚŽƚĂŬĞƉůĂĐĞĂŶĚƚĂŬĞŽǀĞƌŝŶƋƵŝĞƚ͕ŶŝĐĞŶĞŝŐŚďŽƌŚŽŽĚƐ͍tŚĂƚ ŝƐƚŚĞƌĂƚŝŽŶĂůĞƚŽĚĞƐƚƌŽLJƌĞƐŝĚĞŶƚŝĂů͕ƉĞĂĐĞĨƵůůLJĞƐƚĂďůŝƐŚĞĚŶĞŝŐŚďŽƌŚŽŽĚƐ͍dŚŽƐĞƌĞŶƚĞƌƐĂŶĚƚŚĞŝƌ ŽďŶŽdžŝŽƵƐďĞŚĂǀŝŽƌĨŽƌƐƵƌĞǁŽƵůĚŶŽƚďĞĂůůŽǁĞĚŝŶĂŶLJŚŽƚĞů͊dŚĞŽǁŶĞƌŽŶůLJĐĂƌĞƐĂďŽƵƚŵĂŬŝŶŐ ŵŽŶĞLJĨƌŽŵƚŚĞƉƌŽƉĞƌƚLJ͖ƚŚĞLJƚŚŝŶŬƚŚĞLJƌĞŶƚƚŽĨŝǀĞƉĞŽƉůĞďƵƚϮϬƌŽǁĚLJ͕ŽƵƚŽĨĐŽŶƚƌŽůƐŚŽǁƵƉ ǁŝƚŚŵĂŶLJĐĂƌƐĂŶĚĚĞƐƚƌŽLJƚŚĞƉĞĂĐĞ͕ƚƌĂŶƋƵŝůŝƚLJĂŶĚƐĞƌĞŶŝƚLJŽĨƚŚĞŶĞŝŐŚďŽƌƐĂŶĚƚŚĞĞŶǀŝƌŽŶŵĞŶƚ͘ tŚLJĚŽĞƐƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂĂůůŽǁƚŚŝƐŝŶƐĂŶŝƚLJƚŽĐŽŶƚŝŶƵĞ͍ 7KHVKRUWWHUPUHQWHUVWKUHHGD\VRQHZHHNHQGFRPHZLWKRQHRQO\JRDOLQPLQGWRSDUW\ZKLFK LQFOXGHVWKHFURZGVWKHPDQ\FDUVWKHQRLVHWKHVFUHDPLQJWKHPDULKXDQDWKHWUDVK$QRUPDO UHVLGHQWLDOQHLJKERUZRXOGQRWKDYHSDUWLHVDOOZHHNHQGDQGGXULQJWKHZHHNGD\VDQGPDNLQJQRLVHVDOO GD\ 7KHWUXWKLVWKDW6795VDUHMXVWLQFRPSDWLEOHZLWKUHVLGHQWLDODQGIDPLO\RULHQWHGUHJXODUZRUNLQJSHRSOH QHLJKERUKRRGV0RUHWKDQHYHUQRZWKDWZHVSHQGDORWRIWLPHDWKRPHDQGWKDWZHKDYHWRVWD\KRPH DQGZRUNIURPKRPHEHFDXVHRIWKHXQSUHFHGHQWHG&RURQD9LUXVSDQGHPLFLWLVPRVWLPSRUWDQWWRIHHO VDIHDQGEHDEOHWRUHOD[LQ\RXURZQKRXVHLQWKHTXLHWUHVLGHQWLDOQHLJKERUKRRGWKDWZHRULJLQDOO\ LQYHVWHGRXUPRQH\LQE\EX\LQJRXUKRXVHZLWKRXWFRQVWDQWVWUHVVIXOGLVWXUEDQFHVRIFDUHOHVV WUDQVLHQWDQGORXGSDUW\SHRSOH :KDWLVWKHVROXWLRQ"3OHDVHJLYHDKRWHOYRXFKHUIRUWKHQHLJKERUVDIIHFWHGE\WKHQRLVHGLVWXUEDQFHVRI WKH6795VVRWKH\FDQKDYHDJRRGQLJKWVOHHSLQFOXGLQJWKHPHDOWKH\FDQ¶WFRRNDWKRPHDQG JDVROLQH%XWZHGRQRWZDQWWROHDYHRXUKRXVHV%HWWHU\HWKDYHFLW\RI/4EX\P\SURSHUW\VR,FDQ PRYHWRTXLHWDUHD,DPPRUHWKDQZLOOLQJWRVHOOLWWR\RX+RZHYHUWKHEHVWVROXWLRQLV .HHS/D4XLQWDDVWKH*HPRIWKH'HVHUWQRWWKHKHOORIWKHGHVHUW 3OHDVH,EHJ\RXWRGRWKHULJKWWKLQJ3OHDVH,EHJ\RXQRWUHQHZDQGWRUHYRNHIRUJRRGWKH 6759SHUPLWWRWKLVSURSHUW\3OHDVH,EHJ\RXWRUHVWRUHSHDFHDQGWUDQTXLOLW\LQP\ QHLJKERUKRRG 7KDQN\RXYHU\PXFKIRUOLVWHQLQJWRPH CITY COUNCIL MEETIN G- JULY 7, 2020 - PUBLIC COMMENTS BY RESIDENT MARIA PUENTE PUBLIC COMMENT ON MATTERS NOT ON THE AGENDA - RELATED TO STVR )URP&KHUL)ORUHV 6HQW7XHVGD\-XO\30 7R0RQLND5DGHYD &F'DQQ\&DVWUR-RQ0F0LOOHQ 6XEMHFW):3DYLOLRQ3DOPV Monika, The applicant is requesting a continuance of the public hearing, see below. Cheri L. Flores | Planning Manager City of La Quinta 78495 Calle Tampico La Quinta, CA 92253 Ph. 760-777-7067 www.laquintaca.gov PLEASE NOTE: City Hall is now open on a limited basis by advanced appointment only. Information on types of appointments being accepted, how to schedule and City-implemented safety measures are available at HUB Appointments. &ƌŽŵ͗ŐǁďϵϲϰΛĂŽů͘ĐŽŵфŐǁďϵϲϰΛĂŽů͘ĐŽŵх ^ĞŶƚ͗dƵĞƐĚĂLJ͕:ƵůLJϳ͕ϮϬϮϬϭ͗ϮϱWD dŽ͗ŚĞƌŝ&ůŽƌĞƐфĐůĨůŽƌĞƐΛůĂƋƵŝŶƚĂĐĂ͘ŐŽǀх ^ƵďũĞĐƚ͗WĂǀŝůŝŽŶWĂůŵƐ ΎΎydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶŽƉĞŶŝŶŐ ĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ΎΎ &KHULZHDUHUHTXHVWLQJDFRQWLQXDQFHRIRXUSXEOLFKHDULQJWR2FWREHU *UHJ%HYHU CITY COUNCIL MEETING - JULY 7, 2020 - REQUEST FOR CONTINUATION BY APPLICANT GREG BEVER PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP-HUL0XW 6HQW7XHVGD\-XO\$0 7R&LW\&OHUN0DLO 6XEMHFW3DYLOLRQ3DOPV/D4XLQWD ΎΎydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶ ŽƉĞŶŝŶŐĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ΎΎ ƐĂƌĞƐŝĚĞŶƚŽĨ>ĂYƵŝŶƚĂ/ĂŵŝŶĨĂǀŽƌŽĨƚŚĞƵƉĐŽŵŝŶŐWĂǀŝůŝŽŶ^ŚŽƉƉŝŶŐĐĞŶƚĞƌƐŚŽƉƉŝŶŐĐĞŶƚĞƌƚŽďĞďƵŝůƚǁŝƚŚƚŚĞ ŶĞǁƌĞǀŝƐŝŽŶƐ͘/ĨƚŚĞƌĞŵƵƐƚďĞĂŐĂƐƐƚĂƚŝŽŶďƵŝůƚdŚĞŶůĞƚŝƚďĞƉĂƌƚŽĨƚŚĞWĂǀŝůůŝŽŶƐƐŚŽƉƉŝŶŐĐĞŶƚĞƌĂŶĚEKdŝŶƚŚĞ ZĂůƉŚ͛ƐƐŚŽƉƉŝŶŐĐĞŶƚĞƌŬŶŽǁŶĂƐŝƚƌƵƐWůĂnjĂ͘ WůĞĂƐĞƚĂŬĞŝŶƚŽĂĐĐŽƵŶƚŵLJǀŽƚĞ͊ dŚĂŶŬLJŽƵ :ĞƌŝĂůůŝŶŐĞƌ ZĞƐŝĚĞŶƚŽĨ>ĂYƵŝŶƚĂ͕ĂůŝĨŽƌŶŝĂ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP-DQD%DXPDQQ 6HQW7XHVGD\-XO\$0 7R&LW\&OHUN0DLO 6XEMHFW3DYLOLRQVVKRSSLQJFHQWHUFRPPHQWV ΎΎydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶ ŽƉĞŶŝŶŐĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ΎΎ d͗:ƵůLJϳ͕ϮϬϮϬ dK͗>ĂYƵŝŶƚĂŝƚLJŽƵŶĐŝůĂŶĚWůĂŶŶĞƌƐ &ZKD͗:ĂŶĂĂƵŵĂŶŶ Z͗WĂǀŝůŝŽŶWĂůŵƐƐŚŽƉƉŝŶŐĐĞŶƚĞƌĂƚ:ĞĨĨĞƌƐŽŶΘǀĞŶƵĞϱϬ /ĂŵĂĐůŽƐĞŶĞŝŐŚďŽƌƚŽƚŚĞWĂǀŝůŝŽŶWĂůŵƐƉƌŽũĞĐƚ͘/ƚǁŝůůŝŵƉĂĐƚŵĞĞǀĞƌLJĚĂLJĂƐ/ĂŵĂĨƵůůƚŝŵĞƌĞƐŝĚĞŶƚ͘dŚĂŶŬLJŽƵĨŽƌ ƚŚĞĐĂƌĞĨƵů͕ƚŚŽƵŐŚƚĨƵůǁŽƌŬLJŽƵĚŽĨŽƌŽƵƌĐŝƚLJ͘/ĨƚŚŝƐĐŽŵŵĞƌĐŝĂůƉƌŽũĞĐƚƌĞĨůĞĐƚƐƚŚĞƉƌŝĚĞĂŶĚďĞĂƵƚLJŽĨŽƵƌ>ĂYƵŝŶƚĂ ĐŝƚLJŚĂůů͕ůŝďƌĂƌLJ͕ĂŶĚŽƚŚĞƌƉƵďůŝĐƉůĂĐĞƐŝƚǁŝůůďĞĂǁŽŶĚĞƌĨƵů͕ǁĞůĐŽŵĞĂĚĚŝƚŝŽŶ͘ WůĞĂƐĞŝŶƐŝƐƚƚŚĂƚƚŚĞĚĞǀĞůŽƉĞƌƐƉĂLJƐƉĞĐŝĂůĂƚƚĞŶƚŝŽŶƚŽŚŽǁƚŚŝƐƉƌŽũĞĐƚůŽŽŬƐĨƌŽŵďŽƚŚ:ĞĨĨĞƌƐŽŶ^ƚƌĞĞƚĂŶĚǀĞŶƵĞ ϱϬ͘ >Ğƚ͛ƐŵĂŬĞƚŚŝƐ>ĂYƵŝŶƚĂƉƌŽũĞĐƚŵƵĐŚŵŽƌĞĂƉƉĞĂůŝŶŐƚŚĂŶƚŚĞŝƚƌƵƐWůĂnjĂ;ƚŚĞZĂůƉŚƐƐŚŽƉƉŝŶŐĐĞŶƚĞƌͿĂĐƌŽƐƐƚŚĞ ƐƚƌĞĞƚ͕/ǁŽƵůĚůŝŬĞƚŽƐĞĞĚĞƐĞƌƚůĂŶĚƐĐĂƉŝŶŐŝŶĐůƵĚŝŶŐƐŚĂĚĞƚƌĞĞƐ͕ǁĞůĐŽŵŝŶŐƐŚĂĚĞĚƉĂƚŚǁĂLJƐ͕ĂŶĚƐƵďƚůĞďƵƚ ĂĚĞƋƵĂƚĞůŝŐŚƚŝŶŐ͘dŚŝƐƉƌŽŵŝŶĞŶƚĐŽƌŶĞƌĚĞƐĞƌǀĞƐĂŶĂƉƉĞĂůŝŶŐĂƉƉĞĂƌĂŶĐĞ͘ /ƐƚƌŽŶŐůLJŽďũĞĐƚƚŽĂŶLJƐƚŽƌĞƐ͕ĞƐƉĞĐŝĂůůLJƚŚĞŐĂƐƐƚĂƚŝŽŶŽƌŵŝŶŝŵĂƌƚ͕ďĞŝŶŐŽƉĞŶĨŽƌďƵƐŝŶĞƐƐůĂƚĞĂƚŶŝŐŚƚ͘dŚŝƐŝƐŶŽƚĂ ŐŽŽĚůŽĐĂƚŝŽŶĨŽƌϮϰͬϳďƵƐŝŶĞƐƐĞƐ͘ ŽŶĐĞƌŶŝŶŐƚŚĞŐĂƐƐƚĂƚŝŽŶ͕ƉůĞĂƐĞŝŶƐŝƐƚŽŶůĂŶĚƐĐĂƉŝŶŐ͕ƐŚĂĚĞƐƚƌƵĐƚƵƌĞƐ͕ĂŶĚůŽǁůŝŐŚƚŝŶŐ͘/͛ǀĞƐĞĞŶŐĂƐƐƚĂƚŝŽŶƐŝŶ ŽƚŚĞƌĐŝƚŝĞƐƚŚĂƚĂƌĞƐŽŶŝĐĞůLJůĂŶĚƐĐĂƉĞĚƚŚĂƚLJŽƵĚŽŶ͛ƚŝŵŵĞĚŝĂƚĞůLJƐĞĞƚŚĂƚŝƚŝƐ͕ŝŶĚĞĞĚĂŐĂƐƐƚĂƚŝŽŶ͘/ƚĐĂŶďĞĚŽŶĞ͘ dŚĂŶŬLJŽƵĨŽƌĐŽŶƐŝĚĞƌŝŶŐŵLJĐŽŵŵĞŶƚƐ͘ŐĂŝŶ͕ƚŚĂŶŬLJŽƵĨŽƌƐĞƌǀŝŶŐŽƵƌĐŝƚLJ͘ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP-RKQ&DUQLH 6HQW7XHVGD\-XO\$0 7R&LW\&OHUN0DLO 6XEMHFW3DYLOOLRQ ΎΎydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶ ŽƉĞŶŝŶŐĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ΎΎ >Ğƚ͛ƐƐƚŽƉƚŚĞ^ĂŶĚŐĞƚƚŚŝƐĚŽŶĞŽƚŚĞƌǁŝƐĞǁĞǁŝůůďĞůŽŽŬŝŶŐĂƚĞŵƉƚLJůŽƚƐĂůůŽǀĞƌ>ĂYƵŝŶƚĂĨŽƌĚĞĐĂĚĞƐ͘:ŽŚŶ ĂƌŶŝĞ͕>ĂYƵŝŶƚĂ͘ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER 1 From:Dick Colliver Sent:Tuesday, June 30, 2020 5:54 PM To:Cheri Flores Subject:Re: City council meeting July 7, 2020, Proposed development @ 50th and Jefferson **EXTERNAL:ThismessageoriginatedoutsideoftheCityofLaQuinta.Pleaseuseproperjudgementandcautionwhen openingattachments,clickinglinksorrespondingtorequestsforinformation.** >OnJun29,2020,at4:06PM,wrote: > >WeRichardandRobinColliverasresidentsofthecityLaQuintasince2006,wouldliketoexpressourdisapprovalof thisprojectaspresentedbythedeveloper,LoudinDevelopment.Loudinhasahistoryofcuttingcorners, mismanagement,andatotaldisregardofcurrentCityofLaQuintaplanningandguidelines.Thiswasdemonstratedby theprevioussubmittedplansshowingtotaldisregardofrequestsbythemayorandmembersofthecitycouncil.The attitudeofLoudinis“mywayorthehighway.”Withthecurrentissuesduetoclimatechange,allautomotive manufacturersarebeingrequiredtofocusallfutureenginedevelopmentoncleanairemissions.ALLthisdevelopment willbeonelectric/batterypoweredvehicles,GeneralMotors,Ford,Toyota,Honda,BMW,Mercedes,Nissanandothers haveallannouncedplanstobringbatterypoweredproductstothemarketnextyear.Let’snotforgetaboutTeslawho arecurrentlyproducingandsellingover300,000batterypoweredvehiclesyearlyintheU.S.CouplethatwiththeEPA andtheUSgovernmentmandatedgoalof54.5mpgby2025,whywouldanyonewanttoinvestinautomobilefuel stations.Increasedfuelmpgrequirementsmeanslessgasolinesales,improvedfuelconsumptionforreciprocalengines, increasedbatterypoweredvehicleproductionandsalesallmeanslessgasolinesaleswhichequalsanempty/deserted fuelcenteratthegatewaytotheCityofLaQuinta.WhywouldthecitizensofLaQuintaortheCityCouncilthat representsthesecitizenswantafuelstationrightinthemiddleoftwo(2)residentialcommunities.Thecitizensof LaQuintaaskyoutovoteNOonthisprojectasproposed.Thankyou.RichardAndRobinColliver, LaQuinta92253 > >SentfrommyiPad CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP*HQQDUR,RYLQR 6HQW7XHVGD\-XO\30 7R&LW\&OHUN0DLO 6XEMHFW3DYLOLRQ3DOPVGHYHORSPHQWDW-HIIHUVRQ6W$YHQXH ,PSRUWDQFH+LJK ydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶŽƉĞŶŝŶŐ ĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ dŽƚŚĞ>ĂYƵŝŶƚĂŝƚLJŽƵŶĐŝůƌĞŐĂƌĚŝŶŐƐƵďũĞĐƚƉƌŽũĞĐƚ͘ ƐĂŶĞĂƌďLJƌĞƐŝĚĞŶƚ͕ƚŚĞĨŽůůŽǁŝŶŐŝƐƐƵďŵŝƚƚĞĚĨŽƌLJŽƵƌĐŽŶƐŝĚĞƌĂƚŝŽŶ͗ x tŚŝůĞƚŚĞƉůĂŶŶĞĚ͚ĨƵĞůĐĞŶƚĞƌ͛ĂƚƚŚŝƐůŽĐĂƚŝŽŶŵĂLJďĞĂĨŽƌŐŽŶĞĐŽŶĐůƵƐŝŽŶ͙ƚŚĞĂĚĚŝƚŝŽŶŽĨĂ͚ŵŝŶŝͲŵĂƌƚ͛ĂƚƚŚŝƐ ƐŝƚĞĂĚĚƐŝŶƐƵůƚƚŽŝŶũƵƌLJ͕ĂŶĚƚŚĞŽŶĞƉĂƌƚŽĨƚŚĞƉƌŽũĞĐƚƚŽǁŚŝĐŚ/ĂŵĂĚĂŵĂŶƚůLJŽƉƉŽƐĞĚĨŽƌƚŚĞĨŽůůŽǁŝŶŐ ƌĞĂƐŽŶƐ͗ x DŝŶŝͲŵĂƌƚƐƚLJƉŝĐĂůůLJĐŽŵĞǁŝƚŚĂŚŽƐƚŽĨƉƌŽďůĞŵƐŝŶŚĞƌĞŶƚƚŽƚŚĞƐĞƚLJƉĞƐŽĨĞƐƚĂďůŝƐŚŵĞŶƚƐ͕ƐƵĐŚĂƐ͙ o ƌŝŵĞ;ƌŽďďĞƌŝĞƐͿ o ZƵďďŝƐŚͬƚƌĂƐŚŽŶƚŚĞƐŝĚĞǁĂůŬƐĂŶĚƉĂƌŬŝŶŐůŽƚĂƌŽƵŶĚƚŚĞƐƚŽƌĞ o dŚĞLJŽĨƚĞŶĂƚƚƌĂĐƚƉĂŶŚĂŶĚůĞƌƐĂŶĚŚŽŵĞůĞƐƐŝŶĚŝǀŝĚƵĂůƐǁŚŽůŽŝƚĞƌŽƵƚƐŝĚĞƚŚĞƐƚŽƌĞ͘ o KƚŚĞƌƐĐŽŵĞǁŝƚŚƐŚŽƉƉŝŶŐĐĂƌƚƐĂŶĚĚŝŐƚŚƌŽƵŐŚƚŚĞƚƌĂƐŚĐĂŶƐĨŽƌƌĞĐLJĐůĂďůĞƐ͘ o ZĞĚƵĐĞĚƉĂƌŬŝŶŐĐĂƉĂĐŝƚLJĂŶĚĂĚĚŝƚŝŽŶĂůƚƌĂĨĨŝĐĚƵĞƚŽĐƵƐƚŽŵĞƌƐƚŚĂƚĂƌĞŶŽƚŐĞƚƚŝŶŐŐĂƐŽƌƉĂƚƌŽŶŝnjŝŶŐƚŚĞ ďƵƐŝŶĞƐƐĞƐŝŶƚŚĞĚĞǀĞůŽƉŵĞŶƚ͘ x /ƚĂůƐŽŵĂŬĞƐŶŽƐĞŶƐĞƚŽŝŶĐůƵĚĞĂ͚ŵŝŶŝͲŵĂƌƚ͛ŽŶƚŚĞƐŝƚĞǁŚĞŶƚŚĞƌĞŝƐĂŵĂũŽƌƐƵƉĞƌŵĂƌŬĞƚƐƵĐŚĂƐWĂǀŝůŝŽŶƐƌŝŐŚƚ ŶĞdžƚĚŽŽƌ͊ x ĚĚŝƚŝŽŶĂůůLJ͕ƚŚĞƐƵƌƌŽƵŶĚŝŶŐĂƌĞĂŝƐƉƌĞĚŽŵŝŶĂŶƚůLJƌĞƐŝĚĞŶƚŝĂů͖ŶŽƚĂĐŽŵŵĞƌĐŝĂůĐŽƌƌŝĚŽƌƐƵĐŚĂƐ,ǁLJϭϭϭ͘Ɛ ƐƵĐŚ͕ƚŚĞŝƐƐƵĞƐĂŶĚƉƌŽďůĞŵƐŶŽƚĞĚĂďŽǀĞǁŝůůŚĂǀĞĂŶĞŐĂƚŝǀĞŝŵƉĂĐƚŝŶƚŚĞĚĞƐŝƌĂďŝůŝƚLJŽĨƚŚĞĂƌĞĂ͕ƌĞƐƵůƚŝŶŐŝŶ ƌĞĚƵĐĞĚƉƌŽƉĞƌƚLJǀĂůƵĞƐ͘ x tŝƚŚĂǀŝĞǁƚŽƚŚĞĂďŽǀĞ͕/ƚƌƵƐƚƚŚĂƚLJŽƵ͕ƚŚĞŝƚLJŽƵŶĐŝů͕ǁŝůůŵĂŬĞĞǀĞƌLJĞĨĨŽƌƚ͕ĂƚƚŚĞǀĞƌLJůĞĂƐƚ͕ƚŽƌĞũĞĐƚƚŚĞ ŵŝŶŝͲŵĂƌƚƉŽƌƚŝŽŶŽĨƚŚĞƉůĂŶ͘dŚĂƚƐŚŽƵůĚďĞĂƌĞĂƐŽŶĂďůĞĐŽŵƉƌŽŵŝƐĞǁŝƚŚƚŚĞĚĞǀĞůŽƉĞƌ͘ x ^ŚŽƵůĚLJŽƵ͕ƚŚĞŝƚLJŽƵŶĐŝů͕ĨŽƌǁŚĂƚĞǀĞƌƌĞĂƐŽŶďĞƵŶƐƵĐĐĞƐƐĨƵůŝŶƌĞũĞĐƚŝŶŐƚŚĞŵŝŶŝͲŵĂƌƚ͙ƚŚĞŶLJŽƵŵƵƐƚ͕d D/E/DhD͕Ed,^>K&Ez>K,K>/sZ'^͙ďĞĞƌ͕ǁŝŶĞ͕ĂŶĚůŝƋƵŽƌƚŚĞƌĞŝŶ͘ dŚĂŶŬLJŽƵĨŽƌLJŽƵƌƚŝŵĞĂŶĚĐŽŶƐŝĚĞƌĂƚŝŽŶŽĨƚŚĞĂďŽǀĞ͕ĂŶĚ/ŚŽƉĞLJŽƵǁŝůůůŽŽŬĨĂǀŽƌĂďůLJƵƉŽŶŵLJƐƵďŵŝƐƐŝŽŶ͘ ZĞƐƉĞĐƚĨƵůůLJ͕ ŽŶĐĞƌŶĞĚZĞƐŝĚĞŶƚ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP-RKQ&ULVV 6HQW7XHVGD\-XO\$0 7R&LW\&OHUN0DLO 6XEMHFW3DYLOLRQ&HQWHU ΎΎydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶ ŽƉĞŶŝŶŐĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ΎΎ tĞĂƌĞďŽƚŚŝŶƐƵƉƉŽƌƚŽĨƚŚŝƐƉƌŽũĞĐƚĂƐƌĞǀŝƐĞĚ>LJŶŶĂŶĚ:ŽŚŶƌŝƐƐĞƐĞƌƚůƵďƐƚĂƚĞƐ ^ĞŶƚĨƌŽŵŵLJŝWĂĚ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP*DLO(//,621 6HQW0RQGD\-XO\$0 7R&LW\&OHUN0DLO &F 6XEMHFW6XEMHFW$YHQXH3URMHFW ydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶŽƉĞŶŝŶŐ ĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ /ĂŵĂ,ŽŵĞŽǁŶĞƌŝŶƚŚĞZĞŶĂŝƐƐĂŶĐĞĐŽŵŵƵŶŝƚLJĂŶĚŚĂǀĞƚŚĞĨŽůůŽǁŝŶŐĐŽŶĐĞƌŶƐƌĞŐĂƌĚŝŶŐƚŚĞĐŽŶƐƚƌƵĐƚŝŽŶ ŽĨƚŚŝƐĨĂĐŝůŝƚLJ͘ dƌĂĨĨŝĐŝŵƉĂĐƚĨŽƌĞŶƚĞƌŝŶŐĂŶĚůĞĂǀŝŶŐŽƵƌĐŽŵŵƵŶŝƚLJ͘ ϮϰŚŽƵƌůŝŐŚƚŝŶŐ͘ ƌŝŵŝŶĂůĂĐƚŝǀŝƚLJŽŶŽƌŶĞĂƌŽƵƌƉƌŽƉĞƌƚLJ͘ WƌŽƉĞƌƚLJǀĂůƵĞƐďĞŝŶŐĂĨĨĞĐƚĞĚǁŝƚŚƚŚŝƐƚLJƉĞŽĨĐŽŶƐƚƌƵĐƚŝŽŶ͘ EŽŝƐĞĂŶĚƉŽůůƵƚŝŽŶĨƌŽŵƚƌĂĨĨŝĐ͘ dŚĂŶŬLJŽƵĨŽƌĂĚĚƌĞƐƐŝŶŐƚŚĞƐĞŝƐƐƵĞƐ͘ ZĞƐƉĞĐƚĨƵůůLJƐƵďŵŝƚƚĞĚ͕ 'ĂŝůůůŝƐŽŶ >ĂYƵĞŶƚĂ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER ͲͲͲͲͲKƌŝŐŝŶĂůDĞƐƐĂŐĞͲͲͲͲͲ &ƌŽŵ͗ďƌƵĐĞĨĞƌŐƵƐŽŶ ^ĞŶƚ͗dƵĞƐĚĂLJ͕:ƵůLJϳ͕ϮϬϮϬϮ͗ϰϰWD dŽ͗ŚĞƌŝ&ůŽƌĞƐфĐůĨůŽƌĞƐΛůĂƋƵŝŶƚĂĐĂ͘ŐŽǀх ^ƵďũĞĐƚ͗:ƵůLJϳƚŚŚĞĂƌŝŶŐͲǁƌŝƚƚĞŶĐŽŵŵĞŶƚƐZĞ͗WĂǀŝůŝŽŶWĂůŵƐ ΎΎydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶ ŽƉĞŶŝŶŐĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ΎΎ dŽƚŚĞ>ĂYƵŝŶƚĂŽƵŶĐŝůŵĞŵďĞƌƐ͗ ZĞ͗>ƵŶĚŝŶĞǀĞůŽƉŵĞŶƚͲEtŽĨ:ĞĨĨĞƌƐŽŶĂŶĚϱϬƚŚ /ůŝǀĞŽŶůƚŚĞĂƌŝǀĞ͘ /ŚĂǀĞŶŽŝƐƐƵĞǁŝƚŚĂƌĞĂƐŽŶĂďůĞƌĞƚĂŝůĚĞǀĞůŽƉŵĞŶƚ͕ŚŽǁĞǀĞƌ͕ƐĞĞŶŽǀĂůƵĞŝŶƚŚĞĂĚĚŝƚŝŽŶŽĨĂŐĂƐƐƚĂƚŝŽŶĂƚƚŚŝƐ ůŽĐĂƚŝŽŶŝŶǁŚĂƚŝƐůĂƌŐĞůLJĂƌĞƐŝĚĞŶƚŝĂůŶĞŝŐŚďŽƌŚŽŽĚ;ůŝŐŚƚƉŽůůƵƚŝŽŶ͕ŝŶĂŶĚŽƵƚƚƌĂĨĨŝĐ͕ĞŶǀŝƌŽŶŵĞŶƚĂůƌŝƐŬͿ͘ dŚĞƌĞĂƌĞŶŽƐŚŽƌƚĂŐĞŽĨŐĂƐƐƚĂƚŝŽŶƐĂƚ,ǁLJϭϭϭ͘/ƚŝƐĂƐŚŽƌƚĚŝƐƚĂŶĐĞƚŽ,ǁLJϭϭϭ͕ĂŶĚƋƵŝƚĞĨƌĂŶŬůLJ͕,ǁLJϭϭϭŝƐŽŶƚŚĞ ƌŽƵƚĞƚŽĂůŵŽƐƚĂŶLJĚĞƐƚŝŶĂƚŝŽŶĨƌŽŵ:ĞĨĨĞƌƐŽŶĂŶĚϱϬƚŚ͘ 'ŝǀĞŶƚŚĞůŽĐĂƚŝŽŶ͕/ĂŵĂůƐŽĐŽŶĐĞƌŶĞĚƚŚĂƚƚŚĞĞĐŽŶŽŵŝĐƐĨŽƌĂŐĂƐƐƚĂƚŝŽŶǁŝůůŶŽƚŵĂŬĞƐĞŶƐĞ͘tŚŝůĞLJŽƵŵĂLJƐĂLJƚŚĂƚ ŝƐƚŚĞƚĞŶĂŶƚ͛ƐĂŶĚĚĞǀĞůŽƉĞƌƐƌŝƐŬ͕/ĚŽŶŽƚǁĂŶƚĂŐĂƐƐƚĂƚŝŽŶƚŽďĞĞǀĞŶƚƵĂůůLJĐůŽƐĞĚĐƌĞĂƚŝŶŐĂĨƵƌƚŚĞƌƵŶĂƚƚƌĂĐƚŝǀĞ ƐŝƚƵĂƚŝŽŶ͘ /ƵŶĚĞƌƐƚĂŶĚƚŚĞƌĞĂƌĞƉůĂŶƐĨŽƌĚƌŝǀĞͲƚŚƌƵŽƵƚůĞƚƐ͘/ŚĂǀĞƚŚĞƐĂŵĞĐŽŶĐĞƌŶƐǁŝƚŚĚƌŝǀĞͲƚŚƌƵĨŽŽĚŽƵƚůĞƚƐ͘dŚŝƐƚLJƉĞŽĨ ĚĞǀĞůŽƉŵĞŶƚŝƐŶŽƚĐŽŶŐƌƵĞŶƚǁŝƚŚƚŚĞƚŚĞŝŵŵĞĚŝĂƚĞƐƵƌƌŽƵŶĚŝŶŐƐƚŚĂƚĂƌĞƉƌŝŵĂƌŝůLJƌĞƐŝĚĞŶƚŝĂů͘ tŚŝůĞ/ŚĂǀĞƐĞĞŶƐŽŵĞƌĞƉŽƌƚŝŶŐƚŚĂƚĨŽŽĚĚƌŝǀĞͲƚŚƌƵƉĂƌĐĞůƐǁŝůůƌĞƋƵŝƌĞĨƵƌƚŚĞƌĂƉƉƌŽǀĂůƐ͕ũƵƐƚĂƐƚŚĞŐƌŽĐĞƌLJƐƚŽƌĞ ŚĂƐƉƌĞƐƐƵƌĞĚĨŽƌƚŚĞŝŶĐůƵƐŝŽŶŽĨĂŐĂƐƐƚĂƚŝŽŶ͕ƚŚĞĐŝƚLJǁŝůůďĞƉƌĞƐƐĞĚŝŶƚŚĞĨƵƚƵƌĞƚŽƉĞƌŵŝƚƚŚĞĨŽŽĚƵƐĞƐǁŝƚŚƚŚĞ ĂůƚĞƌŶĂƚŝǀĞďĞŝŶŐǀĂĐĂŶƚƉĂĚƐ͘ /ŝŵƉůŽƌĞƚŚĞĐŽƵŶĐŝůƚŽŶŽƚƉĞƌŵŝƚƚŚĞŝŶĐůƵƐŝŽŶŽĨĂŐĂƐƐƚĂƚŝŽŶŽŶƚŚĞƐŝƚĞĂŶĚƚŽƌĞƚŚŝŶŬƚŚĞĚƌŝǀĞƚŚƌƵŽƵƚůĞƚƐ͘ &ŝŶĂůůLJ͕/ĂŵĐŽŶĐĞƌŶĞĚǁŝƚŚƚŚŝƐƚLJƉĞŽĨŚĞĂƌŝŶŐ;ǀŝĂƚĞůĞĐŽŶĨĞƌĞŶĐĞͿĨŽƌƐƵĐŚĂŶŝŵƉŽƌƚĂŶƚŵĂƚƚĞƌ͘dŚĞŚĞĂƌŝŶŐƐƐƚĂƌƚĞĚ ǁŝƚŚŝŶͲƉĞƌƐŽŶŚĞĂƌŝŶŐƐĂŶĚƐŚŽƵůĚďĞƌĞĐŽŶǀĞŶĞĚŝŶƚŚĂƚǁĂLJǁŚĞŶĐŽŶĚŝƚŝŽŶƐƉĞƌŵŝƚ͘ /ĂƉƉƌĞĐŝĂƚĞLJŽƵƌĐŽŶƐŝĚĞƌĂƚŝŽŶŽĨƚŚĞƉŽŝŶƚƐ/ƌĂŝƐĞĚĂŶĚĂƉƉƌĞĐŝĂƚĞLJŽƵƌƐĞƌǀŝĐĞƚŽƚŚĞĐŽŵŵƵŶŝƚLJĂƐĐŽƵŶĐŝůŵĞŵďĞƌƐ͘ >ĂYƵŝŶƚĂŝƐĂǁŽŶĚĞƌĨƵůĐŽŵŵƵŶŝƚLJƚŚĂƚĚŽĞƐŶŽƚŶĞĞĚƚŚĞƉƌŽƉŽƐĞĚƵƐĞƐĂƚƚŚŝƐůŽĐĂƚŝŽŶ͘ ZĞŐĂƌĚƐ͕ ƌƵĐĞ&ĞƌŐƵƐŽŶ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP-HII+LJJLQV 6HQW7XHVGD\-XO\$0 7R&LW\&OHUN0DLO 6XEMHFW3DYLOOLRQV3URMHFW ydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶŽƉĞŶŝŶŐ ĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ tĞŚĂǀĞĂŚŽƵƐĞŝŶ>ĂYƵŝŶƚĂĐŽǀĞĂŶĚƐƵƉƉŽƌƚƚŚĞWĂǀŝůůŝŽŶƐƉƌŽũĞĐƚ͘ :ĞĨĨ,ŝŐŐŝŶƐ ͲͲ :ĞĨĨ,ŝŐŐŝŶƐĨƌŽŵ'ŵĂŝůDŽďŝůĞ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URPURELQKXEHUW 6HQW7KXUVGD\-XO\30 7R&LW\&OHUN0DLO 6XEMHFWWKSURMHFWFRQFHUQV )ROORZ8S)ODJ)ROORZXS )ODJ6WDWXV)ODJJHG ydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶŽƉĞŶŝŶŐ ĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ ,DPRXWRIWRZQDQGZLOOQRWEHDEOHWRDWWHQG ,OLYHLQ5HQDLVVDQFHVXEGLYLVLRQDQGEDFNXSWRWKHEDVLQDUHDWKDWZLOOEHDIIHFWHGE\WKLVGHYHORSPHQW 0\WKRXJKWV,ZRXOGOLNHWRKDYHUHJLVWHUHGIRUWKLVPHHWLQJDUHWKLV 0RVWRIXVZRXOGZHOFRPHDTXDOLW\QHLJKERUKRRGSURMHFWVLPLODUWRDFURVVWKHVWUHHWE\5DOSK VLQRUGHUWR XSJUDGHWKHFRPPXQLW\VHUYLFHVDQGYLVXDOO\LPSURYHWKHDUHD$OVRWRSURYLGHVHUYLFHVIRUERWKRXUQHDUE\ VXEGLYLVLRQVDQGWKHFRPPXQLW\ VVXUURXQGLQJXV 0\FRQFHUQLVWKDWWKHVHDUHKLJKHQGUHVLGHQWLDOFRPPXQLWLHV:HGRQ WQHHGWZRJDVVWDWLRQVZLWKLQOHVVWKDQD EORFNIURPHDFKRWKHU7KH5DOSKVSURMHFW&LWUXVZLOODOUHDG\EHEXLOGLQJDODUJHJDVVWDWLRQQH[WWRWKHLU FXUUHQWSURSHUW\VWDUWLQJ,EHOLHYHIDOO :HPXVWQRWVDFULILFHHYHU\WKLQJIRUWKHHFRQRPLFEHQHILWRIQHZO\HVWDEOLVKHGEXVLQHVVHVUHJDUGOHVVRIKRZLW ZLOOQHJDWLYHO\LPSDFWHVWDEOLVKHGFRPPXQLWLHV $OVR 1RWKLQJVKRXOGEHSDVVHGDQGLIQRWLQDFWXDOFRQWUDFWIRUFRPPLWPHQWFXUUHQWO\IURPEXVLQHVVHVWRRFFXS\ WKHVHVWRUHVWKDWDUHEHLQJEXLOW7KHJDVVWDWLRQVKRXOGLQQRPDQQHUEHDOORZHGZHDUHQRW:HERXJKW LQWRKLJKHQGUHVLGHQWLDOKRPHFRPPXQLWLHVWKDWVKRXOGQRWLQFOXGHJDVVWDWLRQVDQGKRXUPLQLPDUWV7KH\ '2127%(/21*+RZPDQ\RI\RXZDQWWRVSHQG\RXUUHWLUHPHQW\HDUVWKDW\RXKDYHZRUNHG\RXUZKROH OLIHIRULQRUGHUWROLYHLQSHDFHDWVRPHSRLQWWROLYLQJQH[WWRDJDVVWDWLRQDQGDVKRSSLQJFHQWHU"7KDWDOVRLQ QRZD\FRUUHVSRQGWRWKHVXUURXQGLQJQHLJKERUKRRGVWKDW\RXSXUFKDVHGIRU\RXUJROGHQ\HDUV" ,IWKHVHVWRUHVLWHVKDYHKLJKHQGSURMHFWHGVWRUHVDQGUHVWDXUDQWVWKH\WKDWZRXOGEHILQH:HFHUWDLQO\QHHG PRUHVLWGRZQUHVWDXUDQWVLQWKHQHDUE\DUHD127'5,9(7+528*+6:HZRXOGORYHDQRWKHUKLJKHQG JURFHU\VWRUH5DOSKVLVWRRFURZGHG)DVWIRRGGULYHWKURXJKUHVWDXUDQWVEHORQJRQZKLFKLVLVPRUH FRQVLVWHQWWRDEXVLQHVVGLVWULFWZLWKWKHWUDQVLHQWRUQRQDUHDFOLHQWVWKH\DWWUDFWQRWVHUYLFLQJWKH QHLJKERUKRRGEXWRWKHUDUHDVWKDWFRXOGEHGHWULPHQWDOWRWKHORFDOUHVLGHQWV 7KHVHWZRHOHPHQWVDOVREULQJDERXWWKHFRQFHUQRIORFDOSURSHUW\YDOXHVEHLQJDIIHFWHGZKLFKZRXOGGHILQLWHO\ KDSSHQZLWKWKHJDVVWDWLRQIDVWIRRGLQDQGRXWVWUDQVLHQWDQGWKHOLNHO\SRVVLELOLWLHVRIYDFDQWUHQWHGVWRUH IURQWV"We can eventually rent them is not acceptable due the past history of this company" CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER 7KHOLJKWLQJKHLJKWDQGKRXUVRIRSHUDWLRQVPXVWDOVREHFRQVLGHUHG:HGRQRWZDQWVKRSSLQJFHQWHUOLJKWV VKLQQLQJLQWRRXUZLQGRZVDWQLJKWDQGDOVRWKHTXLHWQHVVRIWKHQHLJKERUKRRGVVKRXOGDOVREHSDUDPRXQWWRWKH TXDOLW\RIOLIHWKDWZHDOOH[SHFW $JDLQZHZRXOGDOOOLNHDquiet and qualityFRUQHUVKRSSLQJFHQWHUZLWKDYDULHW\RIKLJKHQGVWRUHV*URFHU\ VLWGRZQUHVWDXUDQWVUHWDLO1RWHPSW\VWRUHVJDVVWDWLRQVPLQLPDUWVZLWKWKHFRUUHVSRQGLQJWUXFNVDQGQRLVH ODFNRITXDOLW\RIOLIHDQGGHFUHDVLQJSURSHUW\YDOXHVEDVHGRQDOORIWKLV 7KDQN\RX 5HVSHFWIXOO\ 5RELQ+XEHUW CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER &ƌŽŵ͗ůƵĐŝŶĚĂŵĂ ^ĞŶƚ͗dƵĞƐĚĂLJ͕:ƵůLJϳ͕ϮϬϮϬϵ͗ϯϰD dŽ͗ŚĞƌŝ&ůŽƌĞƐфĐůĨůŽƌĞƐΛůĂƋƵŝŶƚĂĐĂ͘ŐŽǀх ^ƵďũĞĐƚ͗WƌŽƉŽƐĞĚĚĞǀĞůŽƉŵĞŶƚŽŶĐŽƌŶĞƌŽĨ:ĞĨĨĞƌƐŽŶĂŶĚϱϬƚŚ ydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶŽƉĞŶŝŶŐ ĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ +HOOR 7KDQN\RXIRUSURYLGLQJDQRSSRUWXQLW\WRYRLFHP\RSLQLRQDERXWWKHSURSRVHGGHYHORSPHQW ,RZQDKRPHLQ$OWKHD6XEGLYLVLRQMXVWDIHZVWHSVDZD\IRUWKHSURSRVHGGHYHORSPHQW,UHDOO\VXSSRUW GHYHORSPHQWRIEHDXWLIXOYLOODJHW\SHVKRSVLQWKLVDUHDWKDWLVDOLJQHGZLWKWKHYLVLRQRI/D4XLQWDWKH*HP RIWKHGHVHUW +RZHYHU,GRQRWVXSSRUWJDVROLQHVWDWLRQV :KROHIRRGVDQG7UDGHU-RHVGRQRWKDYHJDVVWDWLRQVDVVRFLDWHGZLWKWKHLUVWRUHV ,DPFRQFHUQHGDERXWWKHLQDQGRXWRIWKRVHODUJHIXHOWUXFNVLQWRWKHORFDWLRQ$V,VHHLWWKHWUXFNVZRXOG EHXVLQJWKHWKDVDSULPDU\FRUULGRUDQGWKHQRLVHDORQJWKZLOOJRZD\XS$GGLWLRQDOO\,DPFRQFHUQHG DERXWWKHFKLOGUHQDORQJWKWKDWDWWHQGWKHVFKRRODQGWKHER\VDQGJLUOVFOXE7KHVHODUJHWUXFNVZLOOSRVH DGDQJHU ,DWWHQGHGVHYHUDORIWKHPHHWLQJVDQGZDVQRWLPSUHVVHGZLWKWKHGHYHORSHUVSODQQLQJLQUHJDUGWRWKHLQRXW RIWKHORFDWLRQQRUZLWKWKHLQFOXVLRQRIEHDXWLIXOODQGVFDSLQJ,WDSSHDUHGWKDWWKH\ZHUHFKDQJLQJWKHLUSODQV RQWKHVSRWWRDSSHDVHWKH&LW\&RXQFLO7KLVLVUHIOHFWLYHRIDSODQWKDWKDVQ WEHHQWKRURXJKO\FRQVLGHUHG ,DPFRQFHUQHGWKDWLIWKH\UHFHLYHWKHSHUPLWWKDWWKH\ZLOOEHGLIILFXOWIRUWKHFLW\WRFRQWURO:KDWWKH\VD\ WRREWDLQWKHSHUPLWDQGWKHQZKDWWKH\GRPD\EHGLIIHUHQW7KHUHGIODJVDUHDOUHDG\YLVLEOH 3OHDVHGRQ WOHWWKLVGHYHORSHUGRZQJUDGHWKHEHDXW\RIRXUFLW\/HWVNHHS/D4XLQWDEHDXWLIXODQGVDIHIRU RXUFKLOGUHQ 7KDQN\RX ͲͲ <ŝŶĚƌĞŐĂƌĚƐ͕ >ƵĐŝŶĚĂ0DKRQH\ /D4XLQWD&$ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER ͲͲͲͲͲKƌŝŐŝŶĂůDĞƐƐĂŐĞͲͲͲͲͲ &ƌŽŵ͗WĂƚDĂƚĂƐƐŽ ^ĞŶƚ͗dƵĞƐĚĂLJ͕:ƵůLJϳ͕ϮϬϮϬϴ͗ϱϱD dŽ͗ŚĞƌŝ&ůŽƌĞƐфĐůĨůŽƌĞƐΛůĂƋƵŝŶƚĂĐĂ͘ŐŽǀх ^ƵďũĞĐƚ͗ĞǀĞůŽƉŵĞŶƚŽŶǀĞϱϬͬ:ĞĨĨĞƌƐŽŶ ΎΎydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶ ŽƉĞŶŝŶŐĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ΎΎ tĞǁŽƵůĚůŝŬĞƚŽƐĂLJƚŚĂƚǁĞĚŽEKdƐĞĞĂŶĞĞĚĨŽƌĂŐĂƐƐƚĂƚŝŽŶŽŶƚŚŝƐĐŽƌŶĞƌ͘dŚĞƐƚĂƚĞŽĨŝƐƚƌLJŝŶŐƚŽŐŽŐƌĞĞŶ͕ƐŽ ǁŚĂƚŚĂƉƉĞŶƐƚŽĂůůƚŚĞƐĞĂůƌĞĂĚLJĞdžŝƐƚŝŶŐƐƚĂƚŝŽŶƐǁŚĞŶŐĂƐĐĂƌƐĂƌĞŶŽƚƚŚĞŶŽƌŵĂŶLJŵŽƌĞ͍>Ğƚ͛ƐĚŽĂǁĂLJǁŝƚŚƚŚĞŐĂƐ ƐƚĂƚŝŽŶĂŶĚŐŽŽŶǁŝƚŚƚŚĞƌĞƐƚŽĨƚŚĞƉƌŽũĞĐƚĂƐůŽŶŐĂƐƚŚĞƌĞĂƌĞŶŽĨĂƐƚĨŽŽĚĚƌŝǀĞƚŚƌŽƵŐŚƐ͘dŚĞƐĞďĞůŽŶŐŽŶϭϭϭ͊͘͘ /ǁŝůůƐŽƚŚĂƚ/ĚŽŶŽƚƚŚŝŶŬƚŚĞĂƌĐŚŝƚĞĐƚƵƌĞƚŚĞLJĂƌĞƐƵďŵŝƚƚŝŶŐŝƐƚŚĞůŽŽŬĨŽƌ>Y͘/ƚĨŝƚƐŵŽƌĞƚŚĞW^ĂƌĞĂ͘/ǁŽƌƌŝĞĚůŝŬĞ ƚŽƐĞĞƚŚĂƚŚĂǀĞŵŽƌĞĂ^ƉĂŶŝƐŚĨĞĞůƚŽŝƚ͕ďƵƚ͘͘͘ WĂƚĂŶĚ:ŝŵDĂƚĂƐƐŽ >Y CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP7HUHVD7KRPSVRQ 6HQW:HGQHVGD\-XO\30 7R7RP0D\GHZ &F0RQLND5DGHYD&KHUL)ORUHV 6XEMHFW&RPPHQWVWKDQG-HIIHUVRQ3URMHFW3DYLOOLRQV0D\GHZ 'ŽŽĚĨƚĞƌŶŽŽŶ͕ dŚĞDĂLJŽƌĂŶĚŝƚLJŽƵŶĐŝůŵĞŵďĞƌƐĂƌĞŝŶƌĞĐĞŝƉƚŽĨLJŽƵƌĐŽŵŵĞŶƚƐƌĞůĂƚŝǀĞƚŽƚŚŝƐƉƌŽũĞĐƚĂŶĚǁŝůůďĞŝŶĐůƵĚĞĚŝŶƚŚĞ ƌĞĐŽƌĚ͘ dŚĂŶŬLJŽƵ͕ dĞƌĞƐĂdŚŽŵƉƐŽŶ ŝƚLJDĂŶĂŐĞƌƐKĨĨŝĐĞ ^ĞŶƚĨƌŽŵŵLJŝWŚŽŶĞ KŶ:Ƶůϭ͕ϮϬϮϬ͕ĂƚϭϮ͗ϱϬWD͕dŽŵDĂLJĚĞǁ ǁƌŽƚĞ͗ ydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶ ǁŚĞŶŽƉĞŶŝŶŐĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ dŚŽŵĂƐĂŶĚ'ĞŽƌŐŝĂDĂLJĚĞǁƌĞƐŝĚŝŶŐĂƚ ŝŶ>ĂYƵŝŶƚĂZĞŶĂŝƐƐĂŶĐĞƐƵďĚŝǀŝƐŝŽŶ͕ǁŽƵůĚ ůŝŬĞƚŚĞ>ĂYƵŝŶƚĂĐŝƚLJĐŽƵŶĐŝůƚŽŬŶŽǁŽĨŽƵƌƐĞƌŝŽƵƐĚŝƐĂŐƌĞĞŵĞŶƚǁŝƚŚƚŚĞϱϬƚŚĂŶĚ:ĞĨĨĞƌƐŽŶ^ƚƌĞĞƚ ƉƌŽũĞĐƚ͘ KƵƌĐŽŶĐĞƌŶĐĞŶƚĞƌƐŽŶƚŚĞĨƵĞůƐƚĂƚŝŽŶƉŽƌƚŝŽŶŽĨƚŚĞƉƌŽũĞĐƚĚƵĞƚŽƚŚĞĐůŽƐĞƉƌŽdžŝŵŝƚLJƚŽƌĞƐŝĚĞŶƚŝĂů ŶĞŝŐŚďŽƌŚŽŽĚƐ͘ /ƚŝƐĂǁĞůůͲŬŶŽǁŶĨĂĐƚƚŚĂƚĨƵĞůƐƚĂƚŝŽŶƐŝŶĐůŽƐĞƉƌŽdžŝŵŝƚLJƚŽƌĞƐŝĚĞŶƚŝĂůŚŽƵƐŝŶŐůŽǁĞƌƉƌŽƉĞƌƚLJǀĂůƵĞƐ͘ 'ĂƐŽůŝŶĞůĞĂŬƐĂƌĞŝŶĞǀŝƚĂďůĞĂƚƚŚĞƉƵŵƉƐƚĂƚŝŽŶƐĂŶĚŽĨƚĞŶƚŚĞƵŶĚĞƌŐƌŽƵŶĚƚĂŶŬƐ͘dŚĞĐŽŶǀĞŶŝĞŶĐĞ ƐƚŽƌĞĂƚƚĂĐŚĞĚƚŽƚŚĞƉƵŵƉ/ƐůĂŶĚƐǁŝůůďĞĂƐŽƵƌĐĞŽĨůŽŝƚĞƌŝŶŐ͕ůŝƚƚĞƌ͕ƚƌĂĨĨŝĐĐŽŶŐĞƐƚŝŽŶĂŶĚĂůĐŽŚŽů ƐĂůĞƐĂŶĚĐŽŶƐƵŵƉƚŝŽŶ͘ /ĨƚŚŝƐƉƌŽũĞĐƚĂĚǀĂŶĐĞƐĂŶĚĞǀĞŶƚƵĂůůLJĨĂŝůƐ͕ƚŚĞĐŝƚLJŽĨ>ĂYƵŝŶƚĂǁŝůůŝŶŚĞƌŝƚŵƵůƚŝƉůĞƵŶĚĞƌŐƌŽƵŶĚ ŐĂƐŽůŝŶĞƐƚŽƌĂŐĞƚĂŶŬƐ͘/ŶĂĚĚŝƚŝŽŶ͕ĞůĞĐƚƌŝĐǀĞŚŝĐůĞƐǁŝůůƉƌĞǀĂŝůŝŶƚŚĞǀĞƌLJŶĞĂƌĨƵƚƵƌĞŵĂŬŝŶŐŐĂƐŽůŝŶĞ ŵŽƌĞĂŶĚŵŽƌĞŽďƐŽůĞƚĞ͘ dŚŝƐĚĞǀĞůŽƉĞƌŚĂƐĂŚŽƌƌŝďůĞƚƌĂĐŬƌĞĐŽƌĚŽĨŵĂŝŶƚĞŶĂŶĐĞĂŶĚĨŽůůŽǁͲƚŚƌŽƵŐŚŽŶŶƵŵĞƌŽƵƐŽƚŚĞƌsĂůůĞLJ ƉƌŽũĞĐƚƐ͘ tĞƐƚƌŽŶŐůLJƵƌŐĞƚŚĞĐŽƵŶĐŝůƚŽǀŽƚĞŶŽŽŶƚŚŝƐƉƌŽũĞĐƚ͘ dŚŽŵĂƐĂŶĚ'ĞŽƌŐŝĂDĂLJĚĞǁ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP(ODLQH0LOOV 6HQW7XHVGD\-XO\30 7R&LW\&OHUN0DLO 6XEMHFW:ULWWHQ&RPPHQWV3DYLOLRQ3DOPV6KRSSLQJ&HQWHU ydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶŽƉĞŶŝŶŐ ĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ ,ĞůůŽ͕ tĞĂƌĞůĂŝŶĞDŝůůƐĂŶĚtŝůůŝĂŵDŝůůƐ͘ĚĚƌĞƐƐ͗ ͕>ĂYƵŝŶƚĂ;WĂůŵŝůůĂͿ͘ tĞĂŵǀĞƌLJĐŽŶĐĞƌŶĞĚĂďŽƵƚŚĂǀŝŶŐŐĂƐƉƵŵƉƐĂĐƌŽƐƐƚŚĞƐƚƌĞĞƚĨƌŽŵŽƵƌƌĞƐŝĚĞŶĐĞ͘Ƶƚ ĂƉƉĂƌĞŶƚůLJ͕ǁĞŚĂǀĞŶŽĐŚŽŝĐĞŝŶƚŚĂƚƌĞŐĂƌĚ͘ ƐĨŽƌƚŚĞĞŶƚƌĂŶĐĞƚŽƚŚĞĨŝůůŝŶŐƐƚĂƚŝŽŶ͕ŝƚĂďƐŽůƵƚĞůLJƐŚŽƵůĚEKdďĞŽŶǀĞŶƵĞϱϬ͘dŚŝƐŝƐĂŶ ƌĞƐŝĚĞŶƚŝĂůĂƌĞĂ͘WůĞĂƐĞƌĞƋƵŝƌĞƚŚĞĚĞǀĞůŽƉĞƌƚŽƉƵƚƚŚĞĞŶƚƌĂŶĐĞŽŶ:ĞĨĨĞƌƐŽŶ͕ĂƐĨĂƌŶŽƌƚŚĂƐ ƉŽƐƐŝďůĞ͘tĞĐĞƌƚĂŝŶůLJĚŽŶΖƚǁĂŶƚĂůŽƚŽĨĐĂƌƐůŝŶŝŶŐƵƉŽŶĂŶƵƉƐĐĂůĞƌĞƐŝĚĞŶƚŝĂůƐƚƌĞĞƚĨŽƌŐĂƐ͘ ƐƉĞĐŝĂůůLJǁŚĞŶŽƐƚĐŽĂŶĚŽƚŚĞƌĨŝůůŝŶŐƐƚĂƚŝŽŶƐĂƌĞũƵƐƚĂƐŚŽƌƚĚŝƐƚĂŶĐĞĂǁĂLJŝŶƚŚĞĐŽŵŵĞƌĐŝĂů ĂƌĞĂ͘ dŚŝƐŝƐĂůŽŶŐͲƚĞƌŵĚĞĐŝƐŝŽŶƚŚĂƚǁŝůůĂĨĨĞĐƚƉƌŽƉĞƌƚLJǀĂůƵĞƐĂŶĚƋƵĂůŝƚLJŽĨůŝĨĞ͘ WůĞĂƐĞƉƌŝŽƌŝƚŝnjĞƚŚĞŐŽŽĚŽĨƚŚĞĐŽŵŵƵŶŝƚLJĨŽƌƚŚĞůŽŶŐͲƚĞƌŵ͕ĂŶĚ>Ă YƵŝŶƚĂΖƐƌĞƉƵƚĂƚŝŽŶĂƐĂĚĞƐŝƌĂďůĞĂƌĞĂ͘ dŚĂŶŬLJŽƵ͕ ůĂŝŶĞDŝůůƐĂŶĚtŝůůŝĂŵDŝůůƐ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER &ƌŽŵ͗dŝŵDŽŽƌĞ ^ĞŶƚ͗dŚƵƌƐĚĂLJ͕:ƵůLJϮ͕ϮϬϮϬϳ͗ϬϬD dŽ͗ŚĞƌŝ&ůŽƌĞƐфĐůĨůŽƌĞƐΛůĂƋƵŝŶƚĂĐĂ͘ŐŽǀх ^ƵďũĞĐƚ͗tƌŝƚƚĞŶŽŵŵĞŶƚƐͲWƌŽƉŽƐĞĚĚĞǀĞůŽƉŵĞŶƚͲWĂůŵƐWĂǀŝůŝŽŶͲϱϬƚŚΘ:ĞĨĨĞƌƐŽŶ:ƵůLJϳŵĞĞƚŝŶŐ ydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶŽƉĞŶŝŶŐ ĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ $WWHQWLRQ0V0D\RUDQG&LW\&RXQFLO $VUHVLGHQWVRIWKHFLW\RI/D4XLQWDVLQFHZHZRXOGOLNHWRH[SUHVVRXUGLVDSSURYDORIWKLVSURMHFWDV SUHVHQWHGE\WKHGHYHORSHU/XQGLQ'HYHORSPHQW:HIHHOLWKDVEHHQVKRZQRYHUDQGRYHUDJDLQE\WKHLU ZRUNLQWKHFLW\RI,QGLRDQGLVEHVWH[HPSOLILHGE\WKHWRWDOGLVUHJDUGIRUFXUUHQW&LW\RI/D4XLQWDSODQQLQJ DQGJXLGHOLQHV7KLVKDVEHHQGHPRQVWUDWHGE\WKHSUHYLRXVO\VXEPLWWHGSODQVQRWIROORZLQJDQ\RIWKH UHTXHVWVRIERWKWKH0D\RUDQG&LW\&RXQFLOLQLWVHQWLUHW\DVZHOODVWKHDWWLWXGHRIWKHLUUHSUHVHQWDWLYHVLQWKH SXEOLFKHDULQJV 7KHDWWLWXGHRI/XQGLQLV³P\ZD\RUWKHKLJKZD\´2QHFOHDUH[DPSOHRIWKDWLVWKHLUDUJXPHQWWKDWWKLV FRUQHUZLOOEHEHFRPHDZDONHUVGHVWLQDWLRQDQGZKHQSUHVVHGE\RQHRIWKH&RXQFLOPHPEHUVWKDWHYHU\RQH GULYHVWKDWWKHVWUHHWKDVDVSHHGOLPLWRIPSKDQGWKDWQRRQHZLOOZDONWKHUHZKHQLW V)WKH\PHUHO\ VKUXJJHGWKHLUVKRXOGHUV :LWKWKHFXUUHQWLVVXHVGXHWRFOLPDWHFKDQJHDOODXWRPRWLYHPDQXIDFWXUHUVDUHIRFXVLQJDOOIXWXUHHQJLQH GHYHORSPHQWRQFOHDQDLUHPLVVLRQV$OOWKLVGHYHORSPHQWZLOOEHRQHOHFWULFEDWWHU\SRZHUHGRUK\GURJHQIXHO FHOOSRZHUHGYHKLFOHVDVSHUWKHPDQGDWHMXVWDSSURYHGE\*RYHUQRU1HZVRPH&OLFNKHUHWRUHIHUHQFHWKH DUWLFOHRXWOLQLQJWKHJXLGHOLQHVDURXQGWKLV:K\ZRXOGZHDVDFLW\ZDQWWRVHHHOHFWULFRUK\GURJHQSRZHUHG WUXFNVKDXOLQJGLUW\SROOXWLQJJDVROLQHLQWRDUHVLGHQWLDODUHDDQ\ZD\"6HHPVFRXQWHULQWXLWLYHGRQ W\RX WKLQN"(OHFWULFWUXFNVKDXOLQJJDVROLQH :HXQGHUVWDQGWKHLVVXHDURXQGWD[HVIURPWKHVDOHRIIXHODQGZHFHUWDLQO\GRQ WZDQWWRVHHWKHFLW\RI ,QGLREHDWLQJXV6RZK\QRWWDNHDYLVLRQDU\DSSURDFKWRLWDQGHOLPLQDWHWKHJDVROLQHSXPSVDQGPDNH WKHJDWHZD\WR/D4XLQWDDUHDOGHVWLQDWLRQIRUHOHFWULFFKDUJLQJRUK\GURJHQILOOXS",WPD\QRWILOOWKH FRIIHUVIRUWKHFLW\QRZEXWLQWKHORQJUXQZHZLOOEH\HDUVDKHDGRI,QGLR 2KDQGZKDW VLQLWIRU9RQ V3DYLOLRQV"6XIILFHLWWRVD\WKDWFKDUJLQJLVDORQJHUSURFHVVVRWKHLUFXVWRPHUV JHWWRVWD\LQWKHVWRUHORQJHURUYLVLWVRPHRIWKHRWKHUVKRSV,UHDOL]H/RXGLQKDVQRW\HWVLJQHGDQ\RQH HOVHWKDW VDQRWKHUVWRU\ZKLOHWKHLUYHKLFOHLVFKDUJLQJ+\GURJHQEDVHGYHKLFOHVILOOXSDWURXJKO\WKHVDPH WLPHLWWDNHVIRUJDVROLQHVRWKDWEHQHILWLVVRPHZKDWPRRW+2:(9(5LWZRXOGEHWKHRQO\K\GURJHQVWDWLRQLQ WKH&RDFKHOOD9DOOH\WUXO\PDNLQJLWDGHVWLQDWLRQIRUWKRVHGULYHUVXVLQJK\GURJHQIXHOFHOOWHFKQRORJ\ZKLFK LVZKHUH7R\RWDLVLQYHVWLQJDVSHUWKHDUWLFOHKHUH 7KHFLWL]HQVRI/D4XLQWDDVN\RXWRYRWH12RQWKLVSURMHFWDVSURSRVHGDQGSHUKDSVORRNDWDQG EH\RQG%HYLVLRQDU\EHEROGEXWYRWHQR7KDQN\RX ͲͲͲͲͲͲͲͲͲͲͲͲͲ dŚĂŶŬƐ͕ dŝŵ 6DQG\0RRUH /D4XLQWD&$ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP-HUU\-XKO 6HQW7XHVGD\-XO\$0 7R&LW\&OHUN0DLO 6XEMHFW3DYLOLRQ3URMHFW ydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶŽƉĞŶŝŶŐ ĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ :HVXSSRUWWKH3DYLOLRQSODQDVSUHVHQWHGWRWKH&RXQFLO 7KHKRPHRZQHUVQHDUWKHSURMHFWSXUFKDVHGWKHLUSURSHUWLHVZLWKIXOOYLHZRIWKHFRPPHUFLDOSURSHUW\ DQGLPSOLHGFRPPHUFLDO]RQLQJRQVDLGSURSHUW\,QRXURSLQLRQWKH\PDGHWKHLUSXUFKDVHVZLWKWKH NQRZOHGJHWKDWWKHODQGPD\VRPHGD\EHGHYHORSHG7KHUHIRUHWKH\KDYHOLWWOHDUJXPHQWLQ RSSRVLWLRQWRWKHGHYHORSPHQW -HUU\-XKODQG6RSKLD0RWDJKHGL /D4XLQWD&$ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP%UDG1HOVRQ 6HQW0RQGD\-XO\30 7R&LW\&OHUN0DLO 6XEMHFW:ULWWHQ&RPPHQWVUH&LW\&RXQFLO$JHQGD,WHP3DYLOOLRQ3DOPV6KRSSLQJ&HQWHU ydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶŽƉĞŶŝŶŐ ĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ Dear Members of the City Council, Regarding the site design of this project, I support the relocation of the gas station to the northerly portion of the site. I also request you consider the appearance of the center at the corner of 50th and Jefferson. To better fit with the character of the community, the corner buildings should be "reverse facing" with their front doors facing to the north and west in order for landscaping to be provided on the south and east elevations of the buildings. A parkette and outside eating area can be located between the ends of the buildings and a landscape buffer can be located on the corner of the site. Pedestrian access can be provided from the street crosswalks directly into the eating area. The photo below illustrates how the corner would appear. CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER Thank you for considering my comments. ͲͲ Brad Nelson Resident of Palmilla La Quinta, CA 92253 ZĞĂůƐƚĂƚĞĚǀŝƐĞƌƐ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP5LFN2UWHJD 6HQW7XHVGD\-XO\$0 7R&LW\&OHUN0DLO 6XEMHFW3DYLOLRQ3DOPV ydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶŽƉĞŶŝŶŐ ĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ /ĂŵĂWĂůŵŝůůĂŚŽŵĞŽǁŶĞƌǁŚŝĐŚŝƐĂĐƌŽƐƐƚŚĞƐƚƌĞĞƚĨƌŽŵƚŚĞƉƌŽƉŽƐĞĚWĂǀŝůŝŽŶWĂůŵƐƉƌŽũĞĐƚ͘tŚŝůĞ/ďĞůŝĞǀĞƚŚĂƚ ƋƵĂůŝƚLJĚĞǀĞůŽƉŵĞŶƚĐĂŶŽŶůLJŚĞůƉƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͕/ĚŽŶŽƚďĞůŝĞǀĞƚŚŝƐƉƌŽũĞĐƚƌĞĂĐŚĞƐŽƵƌĐŽŵŵƵŶŝƚLJǁĂŶƚƐĂŶĚ ŶĞĞĚƐ͘dŚĞƌĞĂƌĞŐŝǀĞƐĂŶĚƚŚĞƌĞĂƌĞƚĂŬĞƐŝŶĚĞǀĞůŽƉŵĞŶƚƐ͕ĂƐƚŚĞƌĞƐŚŽƵůĚďĞ͘,ĂǀŝŶŐƐĂŝĚƚŚĂƚ͕/ǁŽƵůĚůŝŬĞƚŽŐŽŽŶ ƌĞĐŽƌĚƚŽƐĂLJƚŚĂƚĂŐĂƐƐƚĂƚŝŽŶĂƚƚŚŝƐůŽĐĂƚŝŽŶ͕ĐŽƵůĚŶŽƚƉŽƐƐŝďůLJĞŶŚĂŶĐĞƚŚŝƐĂƌĞĂŝŶĂŶLJǁĂLJ͕ĂŶĚ/ƐƚƌŽŶŐůLJŽƉƉŽƐĞ ŝƚ͊dŚĞƌĞĂƌĞƐŽŵĂŶLJŐĂƐƐƚĂƚŝŽŶƐǀĞƌLJŶĞĂƌďLJ͕ƚŚĂƚĂƌĞĂůƌĞĂĚLJŝŶŵŽƌĞĐŽŵŵĞƌĐŝĂůůLJƐƵŝƚĂďůĞĞŶǀŝƌŽŶŵĞŶƚƐ͘dŚŝƐŝƐĂ ƌĞƐŝĚĞŶƚŝĂůĂƌĞĂǁŚŝĐŚŝƐŝƚƐƐƚƌĞŶŐƚŚ͘'ĂƐƐƚĂƚŝŽŶƐĂƌĞĂŶĞLJĞƐŽƌĞ͘dŚĞLJĂƌĞŵŽƐƚŽĨƚĞŶŶŽŝƐLJ͕ĚŝƐƌƵƉƚŝǀĞĂŶĚĚŝƌƚLJ͘dŚĞLJ ĐĂŶĂĨĨĞĐƚƉƌŽƉĞƌƚLJǀĂůƵĞƐƚŽŶĞŝŐŚďŽƌŚŽŽĚƐƐƵĐŚĂƐŽƵƌƐŝŶďŽƚŚŽďǀŝŽƵƐĂŶĚƵŶŝŶƚĞŶĚĞĚǁĂLJƐ͘dŚĞůŝŐŚƚŝŶŐŝƐŽĨƚĞŶ ƵŶƉůĞĂƐĂŶƚůLJƐƚƌŽŶŐĂŶĚĚŝƐƌƵƉƚŝǀĞƚŽůŝǀŝŶŐĂŶĚƐůĞĞƉŝŶŐŶĞĞĚƐ͘/ĐŽƵůĚŐŽŽŶǁŝƚŚƚŚŝƐďƵƚŝŶĨŝŶĂůŝƚLJ͕ǁĞĐĂŶĚƌŝǀĞƚŚƌĞĞ ŵŝŶƵƚĞƐĂǁĂLJƚŽƚŚĞŵĂŶLJŐĂƐƐƚĂƚŝŽŶƐŵŽƌĞĐŽƌƌĞĐƚůLJƐŝƚƵĂƚĞĚŝŶŽƵƌĐŝƚLJ͘ŽŶƐŝĚĞƌǁŚĂƚŝƐƌŝŐŚƚƌĂƚŚĞƌƚŚĂŶǁŚĂƚŝƐ ǁƌŽŶŐ͘ŽƚŚĞƌŝŐŚƚƚŚŝŶŐďLJĞůŝŵŝŶĂƚŝŶŐƚŚĞŐĂƐƐƚĂƚŝŽŶƉůĂŶƐ͘ dŚĂŶŬLJŽƵĨŽƌLJŽƵƌĂƚƚĞŶƚŝŽŶƚŽƚŚŝƐǀĞƌLJŝŵƉŽƌƚĂŶƚŝƐƐƵĞ͘ ZŝĐŬKƌƚĞŐĂ ^ĞŶƚĨƌŽŵDĂŝůĨŽƌtŝŶĚŽǁƐϭϬ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP:DOOLV5DHPHU 6HQW7XHVGD\-XO\$0 7R&LW\&OHUN0DLO 6XEMHFW3URSRVHG3DYLOLRQ3DOPVVKRSSLQJ&HQWHUFRPPHQW UHTXHVWV ΎΎydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶ ŽƉĞŶŝŶŐĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ΎΎ ŽŵŵĞŶƚ͗ ƐĂƌĞƐŝĚĞŶƚŽĨ>ĂYƵŝŶƚĂ͕/ĂƉƉƌĞĐŝĂƚĞƚŚĞĐŽŶĐĞƌŶĨŽƌƚŚĞĞĐŽŶŽŵLJĂŶĚƚŚĞŵĂŶLJŚŽƵƌƐƚŚĞƚŽǁŶůĞĂĚĞƌƐŚĂǀĞƉƵƚŝŶƚŽ ƚŚŝƐƉƌŽũĞĐƚ͕ƐŽůĞƚ͛ƐŐĞƚŝƚƌŝŐŚƚ͊ ,ŽǁĞǀĞƌ͕/ĚŽǁŽŶĚĞƌǁŚLJŝŶĐƌĞĂƐŝŶŐƚŚĞĚĞŶƐŝƚLJŽĨƚŚŝƐŶĞŝŐŚďŽƌŚŽŽĚǁŝƚŚĂůĂƌŐĞƐĐĂůĞƐŚŽƉƉŝŶŐŵĂůů͕ŽĨǁŚŝĐŚƚŚĞƌĞ ĂƌĞŵĂŶLJĂůƌĞĂĚLJ͕ŝƐŶĞĞĚĞĚ͘/ŶŵLJŽƉŝŶŝŽŶ͕ĐŽŵŵĞƌĐŝĂůĂƌĞĂƐƐƵĐŚĂƐƚŚŝƐƉƌŽƉŽƐĞĚŽŶĞĚŽŶŽƚĞŶŚĂŶĐĞƚŚĞůŝǀĂďŝůŝƚLJ ĂŶĚĚĞƐŝƌĂďŝůŝƚLJŽĨƚŚŝƐƚŽǁŶǁŚŽƐĞƉƵďůŝĐĨĂĐŝůŝƚŝĞƐ͕ůŝŬĞƚŚĞůŝďƌĂƌLJĂŶĚĐŽŵŵƵŶŝƚLJĐĞŶƚĞƌ͕ĂƌĞĞdžĞŵƉůĂƌLJ͘ůƐŽ͕ƚŚĞƌĞŝƐ ĂŶŽƚŚĞƌŚĂůĨĞŵƉƚLJƐŚŽƉƉŝŶŐĐĞŶƚĞƌŝŶ>YĚŽǁŶƚŚĞƌŽĂĚƚŚĂƚĐŽƵůĚĂĐĐŽŵŵŽĚĂƚĞĂŶŽƚŚĞƌŐƌŽĐĞƌLJƐƚŽƌĞĂŶĚĂŐĂƐ ƐƚĂƚŝŽŶƚŽďƌŝŶŐŝŶƌĞǀĞŶƵĞ͊ tŝƚŚƚŚĂƚƐĂŝĚ͕ŝĨƚŚĞƉƌŽũĞĐƚŝƐŐŽŝŶŐƚŽŐŽĨŽƌǁĂƌĚ͕/ƌĞĐŽŵŵĞŶĚƚŚĞĨŽůůŽǁŝŶŐĂĚũƵƐƚŵĞŶƚƐďĞŵĂĚĞ͗ ϭͿ WůĞĂƐĞƌĞĚƵĐĞƚŚĞŽǀĞƌĂůůƐŝnjĞŽĨƚŚĞƉƌŽũĞĐƚ͕ŝĨƉŽƐƐŝďůĞͲƐĐĂůĞĂŶĚůĂŶĚƐĐĂƉŝŶŐƐŚŽƵůĚďĞŝŶŬĞĞƉŝŶŐǁŝƚŚƚŚĞĂƌĞĂ͕ ƵŶůŝŬĞƚŚĞŝƚƌƵƐWůĂnjĂĂĐƌŽƐƐƚŚĞƐƚƌĞĞƚǁŚŝĐŚŚĂƐĂǀĞƌLJĐŽŵŵĞƌĐŝĂůĂŶĚĐůƵƚƚĞƌĞĚůŽŽŬ͘ ϮͿ ƌĞĚƵĐĞƚŚĞŶƵŵďĞƌŽĨŐĂƐƉƵŵƉƐĂŶĚͬŽƌŵŽǀĞƚŚĞŝƌůŽĐĂƚŝŽŶĂǁĂLJĨƌŽŵƌĞƐŝĚĞŶĐĞƐ͕ĂŶĚĞŶƐƵƌĞůŽǁůŝŐŚƚŝŶŐĂŶĚ ƐŚĂĚĞ͕ĂŶĚ ϯͿ ĞŶƐƵƌĞƚŚĂƚŶŽďƵƐŝŶĞƐƐĞƐĂƌĞŽƉĞŶϮϰͬϳ͕ŝŶĐůƵĚŝŶŐƚŚĞŐĂƐƐƚĂƚŝŽŶĂŶĚŵŝŶŝŵĂƌŬĞƚ͘ŶĂůůŶŝŐŚƚƉůĂnjĂŝƐŶŽƚ ĂƉƉƌŽƉƌŝĂƚĞĨŽƌĂƉĂƌƚŝĂůƌĞƐŝĚĞŶƚŝĂůĂŶĚƐĐŚŽŽůŶĞŝŐŚďŽƌŚŽŽĚͲĂůůŶŝŐŚƚƐƚŽƌĞƐďĞůŽŶŐŽŶŚŝŐŚǁĂLJƐ͊ dŚĂŶŬLJŽƵĨŽƌLJŽƵƌĐŽŶƐŝĚĞƌĂƚŝŽŶŽĨƚŚĞƐĞĐŚĂŶŐĞƐ͘ ĞƐƚ͕ tĂůůŝƐĂŶĚĂŶZĂĞŵĞƌ >ĂYƵŝŶƚĂ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER )URP 6HQW0RQGD\-XO\30 7R&LW\&OHUN0DLO 6XEMHFW3DYLOOLRQ3DOPV6KRSSLQJ&HQWHU ydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶŽƉĞŶŝŶŐ ĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ ĞĂƌDĞŵďĞƌƐŽĨƚŚĞŽƵŶĐŝů͕ hŶůĞƐƐƚŚĞĚĞǀĞůŽƉĞƌĐĂŶƐŚŽǁŵŽƌĞƐƉĂĐĞƌĞŶƚĞĚ͕/ĂŵƚŽƚĂůůLJŽƉƉŽƐĞĚƚŽƚŚĞŐŽŝŶŐĨŽƌǁĂƌĚǁŝƚŚƚŚĞƉƌŽƉŽƐĞĚ ƐŚŽƉƉŝŶŐĐĞŶƚĞƌ͘tĞĂůƌĞĂĚLJŚĂǀĞƚŚĞĞŶƚĞƌŽŶtĂƐŚŝŶŐƚŽŶǁŝƚŚŽǀĞƌŚĂůĨŝƚƐďƵŝůĚŝŶŐƐƵŶŽĐĐƵƉŝĞĚ;ŝŶĐůƵĚŝŶŐƚŚĞŽůĚ ZĂůƉŚƐŵĂƌŬĞƚͿ͘tĞĚŽŶŽƚŶĞĞĚĂŶŽƚŚĞƌƉĂƌƚŝĂůůLJƌĞŶƚĞĚĞLJĞƐŽƌĞŝŶƚŚĞŶĞŝŐŚďŽƌŚŽŽĚ͘zĞƐ͕ƚŚĞŵĂƌŬĞƚĂŶĚŐĂƐƐƚĂƚŝŽŶ ŚĂǀĞŵĞƌŝƚ͘,ŽǁĞǀĞƌ͕ƚŚĞƌĞĂƌĞϵŽƚŚĞƌďƵŝůĚŝŶŐƐŝŶƚŚĞĐŽŵƉůĞdžƚŽƌĞŶƚ͘^ƵĐŚƌĞŶƚĂůŵŝŐŚƚďĞŵĂĚĞŵŽƌĞĚŝĨĨŝĐƵůƚďLJ ƚŚĞĐƵƌƌĞŶƚǀŝƌƵƐƐŝƚƵĂƚŝŽŶ͘DŽƌĞŝŶĨŽƌŵĂƚŝŽŶĂďŽƵƚǁŚĂƚďƵƐŝŶĞƐƐĞƐǁŝůůŽĐĐƵƉLJƚŚĞƐĞŝƐŶĞĞĚĞĚďĞĨŽƌĞƚŚĞĐŽƵŶĐŝů ƐŚŽƵůĚĂŐƌĞĞƚŽŐŽĨŽƌǁĂƌĚ͘ŽŶŽƚŐĞƚƉƌĞƐƐƵƌĞĚŝŶƚŽĂŐƌĞĞŝŶŐƚŽƚŚŝƐĚĞǀĞůŽƉŵĞŶƚƉƌĞŵĂƚƵƌĞůLJ͘ ^ŝŶĐĞƌĞůLJ͕ ŽŶĂůĚZĞŝĨĞƌ dŚĞŝƚƌƵƐ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER -----Original Message----- From: Tony Shepardson Sent: Wednesday, July 1, 2020 12:58 PM To: Cheri Flores <clflores@laquintaca.gov> Subject: No vote on shopping center ** EXTERNAL: This message originated outside of the City of La Quinta. Please use proper judgement and caution when opening attachments, clicking links or responding to requests for information. ** PLEASE vote NO on this development——n/w corner 50th & Jefferson. Please do not destroy our quiet residential community Sincerely, Jon A. Shepardson , La Quinta CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER $/%(576216&203$1,(6($673$5.&(17(5%28/(9$5'%2,6(,'$+2 :5,7(5 67(/(3+21(180%(5 :5,7(5¶6(0$,/6$06+,1.#6$)(:$<&20 -XO\ +RQRUDEOH0D\RUDQG&LW\&RXQFLOSHUVRQV &LW\RI/D4XLQWD &DOOH7DPSLFR /D4XLQWD&$ 9,$+$1''(/,9(5< 6XEMHFW 3URSRVHG3DYLOLRQ3DOPV SURMHFWWK DQG-HIIHUVRQ +RQRUDEOH0D\RUDQG&LW\&RXQFLOSHUVRQV ,DPZULWLQJWKLVOHWWHUWRFRQILUPWKHQHFHVVLW\RIWKHOHIWWXUQRXWDFFHVVWR$YHQXH IRUWKH3DYLOLRQ3DOPVGHYHORSPHQW7KHSURMHFW¶VDSSURYDOZDVVSHFLILFDOO\ FRQGLWLRQHGE\3DYLOLRQV¶PDQDJHPHQWRQWKHDYDLODELOLW\RIWKLVWXUQLQJPRYHPHQWDQG ZHEHOLHYHLWLVFULWLFDOWRWKHVXFFHVVRIWKHSURMHFW)XUWKHUPRUHZHXQGHUVWDQGWKDWWKH SURMHFW¶VWUDIILFVWXG\VKRZVQRDGYHUVHUHVXOWVDQGDQDFFHSWDEOHOHYHORIVHUYLFHZLWKWKLV WXUQLQJPRYHPHQW 3OHDVHIHHOIUHHWRUHDFKRXWWRPHYLDP\FRQWDFWLQIRUPDWLRQDWWKHWRSRIWKLV OHWWHULI\RXKDYHDQ\IXUWKHUTXHVWLRQV 9HU\WUXO\\RXUV 6$06+,1. 5HDO(VWDWH'HSDUWPHQW &RS\+HUE/XQGLQ*UHJ%HYHU&LW\RI/D4XLQWD3ODQQLQJ6WDII KWWSVU[VDIHZD\P\ VKDUHSRLQW FRPSHUVRQDOVVKLQBVDIHZD\BFRP'RFXPHQWV$%66:<1HZ&DS;/D4XLQWD(QWLWOHPHQWV/D4XLQWD&&PWJOWU GRF[ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER $/%(576216&203$1,(6($673$5.&(17(5%28/(9$5'%2,6(,'$+2 :5,7(5 67(/(3+21(180%(5 :5,7(5¶6(0$,/6$06+,1.#6$)(:$<&20 -XQH +RQRUDEOH0D\RUDQG&LW\&RXQFLOSHUVRQV &LW\RI/D4XLQWD &DOOH7DPSLFR /D4XLQWD&$ 9,$+$1''(/,9(5< 6XEMHFW 3URSRVHG3DYLOLRQ3DOPV SURMHFWWK DQG-HIIHUVRQ +RQRUDEOH0D\RUDQG&LW\&RXQFLOSHUVRQV 7KLVOHWWHUFRQILUPV3DYLOLRQV¶FRPPLWPHQWWRDVWRUHZLWKLQWKH3DYLOLRQ3DOPV &HQWHUSODQQHGIRU-HIIHUVRQ6WUHHW $YHQXH/D4XLQWDEDVHGRQWKHDWWDFKHGVLWHDQG ODQGVFDSHSODQV :KLOHRXUVWDQGDUGLVIRUSDUNLQJVWDOOVZLWKLQWKHSULPDU\SDUNLQJILHOGWKLV SODQLVDFFHSWDEOH $GGLWLRQDOO\ZHGRQRWDOORZVWUXFWXUHVWREHHUHFWHGZLWKLQWKHSDUNLQJILHOG ZKLFKZRXOGEORFNVWRUHYLVLELOLW\DQGLQFRQYHQLHQFHYHKLFXODUWUDIILF%DVHGRQWKH ODQGVFDSHSODQVWKHVKDGLQJSURSRVHGIRUWKHSDUNLQJORWLVDFFHSWDEOHWRXV 7KDQN\RXIRUIDYRUDEO\FRQVLGHULQJRXUIXHOFHQWHUORFDWLRQIURQWLQJ-HIIHUVRQ 6WUHHWDVVKRZQRQWKH6LWH3ODQ :LWK\RXUDSSURYDOZHORRNIRUZDUGWRRSHQLQJRXU3DYLOLRQVVWRUHDQGIXHOFHQWHU LQHDUO\ 3OHDVHIHHOIUHHWRUHDFKRXWWRPHYLDP\FRQWDFWLQIRUPDWLRQDWWKHWRSRIWKLV OHWWHULI\RXKDYHDQ\IXUWKHUTXHVWLRQV 9HU\WUXO\\RXUV 6$06+,1. 5HDO(VWDWH'HSDUWPHQW &RS\+HUE/XQGLQ*UHJ%HYHU KWWSVU[VDIHZD\P\ VKDUHSRLQW FRPSHUVRQDOVVKLQBVDIHZD\BFRP'RFXPHQWV$%66:<1HZ&DS;/D4XLQWD(QWLWOHPHQWV/D4XLQWD&&PWJOWU GRF[ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER 0RQLND5DGHYD )URP6DP6SLQHOOR 6HQW7XHVGD\-XO\30 7R&LW\&OHUN0DLO 6XEMHFW&LW\&RXQFLO0HHWLQJ-XO\3XEOLF+HDULQJ,WHP $WWDFKPHQWV0LFURVRIW:RUG&&$JHQGDSGI ydZE>͗dŚŝƐŵĞƐƐĂŐĞŽƌŝŐŝŶĂƚĞĚŽƵƚƐŝĚĞŽĨƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂ͘WůĞĂƐĞƵƐĞƉƌŽƉĞƌũƵĚŐĞŵĞŶƚĂŶĚĐĂƵƚŝŽŶǁŚĞŶŽƉĞŶŝŶŐ ĂƚƚĂĐŚŵĞŶƚƐ͕ĐůŝĐŬŝŶŐůŝŶŬƐŽƌƌĞƐƉŽŶĚŝŶŐƚŽƌĞƋƵĞƐƚƐĨŽƌŝŶĨŽƌŵĂƚŝŽŶ͘ ĞĂƌŝƚLJůĞƌŬ͕ /ǁŽƵůĚůŝŬĞƚŚĞŽƉƉŽƌƚƵŶŝƚLJƚŽƐƉĞĂŬƚĞůĞƉŚŽŶŝĐĂůůLJŝŶĨĂǀŽƌŽĨ/ƚĞŵηϭƵŶĚĞƌƚŚĞWƵďůŝĐ,ĞĂƌŝŶŐƐĞĐƚŝŽŶŽĨƚŚĞĂƚƚĂĐŚĞĚ ĂŐĞŶĚĂ;ƐĞĞĂƚƚĂĐŚĞĚͿĨŽƌƚŚĞŝƚLJŽƵŶĐŝůDĞĞƚŝŶŐƚŚĂƚŝƐƐĐŚĞĚƵůĞĚĨŽƌƚŽĚĂLJ͘ WůĞĂƐĞĐŽŶƚĂĐƚŵĞďLJĞŵĂŝůƚŽůĞƚŵĞŬŶŽǁŚŽǁ/ĐĂůůŝŶƚŽƚŚĞƐƵďũĞĐƚŵĞĞƚŝŶŐ͘ /ŶƚŚĞĞǀĞŶƚƚŚĂƚƚŚĞƌĞŝƐƚĞĐŚŶŝĐĂůĚŝĨĨŝĐƵůƚLJĨĂĐŝůŝƚĂƚŝŶŐŵLJĂďŝůŝƚLJƚŽƐƉĞĂŬƚĞůĞƉŚŽŶŝĐĂůůLJ͕ƉůĞĂƐĞŚĂǀĞƚŚĞďĞůŽǁ ƐƚĂƚĞŵĞŶƚƌĞĂĚŝŶƚŽƚŚĞƉƵďůŝĐƌĞĐŽƌĚ͘ DLJƉƵďůŝĐƐƚĂƚĞŵĞŶƚ͗ ĞĂƌDĂLJŽƌĂŶĚDĞŵďĞƌƐŽĨƚŚĞŝƚLJŽƵŶĐŝů͕ ƐĂŶŽǁŶĞƌŽĨĐŽŵŵĞƌĐŝĂůƉƌŽƉĞƌƚLJŝŶƚŚĞŝƚLJŽĨ>ĂYƵŝŶƚĂĨŽƌŽǀĞƌ&ŽƵƌƚĞĞŶzĞĂƌƐ͕/ŚĂǀĞĂůǁĂLJƐĂƉƉƌĞĐŝĂƚĞĚƚŚĞ ƉƌŽĐĞƐƐƚŚĂƚƚŚĞŝƚLJůĞĂĚĞƌƐ͕ŝƚLJ^ƚĂĨĨĂŶĚŶŐĂŐĞĚŝƚŝnjĞŶƐŚĂǀĞƚĂŬĞŶƵƉŽŶƚŚĞŵƐĞůǀĞƐƚŽĞŶƐƵƌĞƚŚĂƚĂŚŝŐŚƐƚĂŶĚĂƌĚ ŝƐƵƉŚĞůĚĨŽƌƉƌŽũĞĐƚƐďƵŝůƚǁŝƚŚŝŶƚŚĞĐŽŶĨŝŶĞƐŽĨƚŚĞĐŝƚLJůŝŵŝƚƐ͘ /ŚĂǀĞĨŽůůŽǁĞĚĐůŽƐĞůLJƚŚĞĞŶƚŝƚůĞŵĞŶƚƉƌŽĐĞƐƐĨŽƌƚŚŝƐƉƌŽũĞĐƚĂŶĚŚĂǀĞƐƉŽŬĞŶƉƵďůŝĐůLJŝŶĨĂǀŽƌŽĨƚŚĞƉƌŽũĞĐƚƚǁŽ ƚŝŵĞƐƉƌŝŽƌ͘ /ĂŵŽĨƚŚĞŽƉŝŶŝŽŶƚŚĂƚƚŚĞƉƌŽũĞĐƚŚĂƐĞǀŽůǀĞĚŝŶĂƉŽƐŝƚŝǀĞĨĂƐŚŝŽŶĂƐĂƌĞƐƵůƚŽĨƚŚĞƉƌĞǀŝŽƵƐůLJƌĞĨĞƌĞŶĐĞĚƉƌŽĐĞƐƐ͘ /ĂŵŝŶĨĂǀŽƌŽĨƚŚĞƉƌŽũĞĐƚďĞŝŶŐŐƌĂŶƚĞĚĂƉƉƌŽǀĂůĂƐƐƵďŵŝƚƚĞĚďĞĨŽƌĞƚŚĞŝƚLJŽƵŶĐŝůƚŚŝƐĞǀĞŶŝŶŐ͘ ůůƚŚĞďĞƐƚ͕ ^Ăŵ^ƉŝŶĞůůŽ Sam Spinello Lic# 01158773 Telephone:ϳϲϬ͘ϯϭϴ͘ϳϰϴϰ Fax:ϳϲϬ͘ϯϭϴ͘ϳϰϴϯ CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER 68936 Adelina Road Cathedral City, CA 92234 PO BOX 1419 Cathedral City, CA 92235 This electronic message and any attachments contain confidential and privileged information intended for the sole use of the intended recipient, and is protected by law. If you are not the intended recipient, you should immediately delete this message and any attachments. Any disclosure, copying or distribution of this message or the taking of any action based on it, is strictly prohibited. CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER SUNTECH CONSULTING & ROOFING 42215 Washington St. Suite A #350 Palm Desert, Ca. 92211 Ph: 760-275-4749 Office 760.343.0091 Lic#1010435 SUNTECH CONSULTING & ROOFING INC. (PDLO6XQWHFKURRI#JPDLOFRP 5/11/20 Re: Pavilion Palms loading dock Hello Council Members my name is Bill Fitzgerald and I own a roofing company here in the valley and a house at in the Renaissance development. I bought this house in April of 2019 knowing that at some time there would be a center built at the corner of Jefferson and 50th. Street, what I didn’t realize is the noise that can be heard from the loading dock at the Ralphs store when trucks are backing up to unload. When a large truck backs up a back up buzzard sounds off and the noise carries (I know you have all heard that noise). My concern is that currently the layout of the Pavilions puts that loading dock up against the block wall adjacent to our homes with no buffer for the noise that noise will travel over the existing wall and into our homes. If the loading dock was located on the other end of the Pavilions with the loading ramp lowered below the grade line like the loading dock at Ralphs 80% of the noise would be blocked by the rear of the store. Also the trucks could enter on Ave 50off Jefferson and exit onto 50th make two left turns and be heading back toward the freeway; this makes better sense for all concerned. Please see attached files. Sincerely and concerned Bill Fitzgerald CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER CITY COUNCIL MEETING - JULY 7, 2020 - WRITTEN PUBLIC COMMENTS PUBLIC HEARING ITEM NO. 1 - PAVILION PALMS SHOPPING CENTER