Loading...
2020-12-30 Wire and escrow docsou r seasons four seasons escrow, inc 78070 Calle Cadiz , La Quinta, OA 92253 Phone (760) 564-4044 Fax (760) 771-2999 WIRE INSTRUCTIONS BANK NAME: CITY NATIONAL BANK BANK ADDRESS: ONE CENTERPOINTE DRIVE, STE 160 LA PALMA, OA 90623 ROUTING NO.: 122016066 ^ SWIFT CODE: CINAUS6L ACCOUNT NO.: 013601755/ CREDIT TO: FOUR SEASONS ESCROW, INC. 78070 Calle Cadiz La Quinta, CA 92253 REFERENCE: FS3245 Closing funds in the amount of $352,296.11'' FBO City of La Quinta - Dune Palms Mobile Park/ ESCROW OFFICER: LEETA SLAMA PLEASE SEND FUNDS AS SAME DAY WIRE. ACH AND EFT TRANSFERS ARE NOT ACCEPTABLE. WE WILL NEED TO RECEIVE FUNDS IN OUR ACCOUNT NO LATER THAN ONE DAY PRIOR TO CLOSE OF ESCROW TO AVOID ANY DELAY IN THE CLOSING. IF YOU HAVE ANY QUESTIONS, PLEASE CONTACT YOUR ESCROW OFFICER AT: (760) 564-4044. )6$VRI30 3DJH )RXU6HDVRQV(VFURZ,QF &DOOH&DGL]/D4XLQWD&$ 3KRQH   )D[   (VFURZ2IILFHU/HHWD6ODPD (VFURZ2IILFHU(PDLOOHHWD#VHDVRQVHVFURZFRP (  )6/6 %X\HU V%RUURZHU V6HWWOHPHQW6WDWHPHQW(VWLPDWHG 3URSHUW\'XQH3DOPV5RDG&ORVHG'DWH /D4XLQWD&$(VW&ORVLQJ'DWH /RDQ1XPEHU %X\HU&LW\RI/D4XLQWDD&DOLIRUQLDPXQLFLSDOFRUSRUDWLRQ  (VFURZ1XPEHU)6/6 'HELWV &UHGLWV 3XUFKDVH3ULFH 3XUFKDVH3ULFH  3URUDWLRQV&UHGLWV &RXQW\7D[HV 3DLG PRVWR $QQXDO2SHUDWLQJ3HUPLW3DUN3HUPLW)HHVPRIRU WR )XQGVGHSRVLWHGLQWRVWDWHFRQGHPQDWLRQDFFWRQ 5HQW5ROO3URUDWLRQSHU5HQW5ROO$QDO\VLVGDWHGPRIRU WR )XQGVGHSRVLWHGLQWRVWDWHFRQGHPQDWLRQDFFWRQ (VFURZ&KDUJHV 6HWWOHPHQWRU&ORVLQJIHHWR)RXU6HDVRQV(VFURZ,QF :LUH)HHWR)RXU6HDVRQV(VFURZ,QF 7LWOH&KDUJHV (OHFWURQLF5HFRUGLQJ)HH  5HFRUGLQJ)HHV7UDQVIHU7D[HV $GG O5HFRUGLQJ!2UGHURI&RQGHPQDWLRQ  $GG O5HFRUGLQJ!:LWKGUDZDORI/L]3HQGHQV  %DODQFH'XH  7RWDOV  7KLVLVDQHVWLPDWHGFORVLQJVWDWHPHQWDQGLVVXEMHFWWRFKDQJHVFRUUHFWLRQVRUDGGLWLRQVDWWKHWLPHRIILQDOFORVLQJ &LW\RI/D4XLQWDD&DOLIRUQLDPXQLFLSDOFRUSRUDWLRQ #%6 BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB %\-RQ0F0LOOHQ&LW\0DQDJHU 3DJHRI 12/30/2020 WebDirect Approve Wires • Confirmation Wire Information Wires displayed: i of i View status definitions Message Beneficiary Wire Wire Debit Sequence Type Name Four ^ , Seasons Domestic 12/30/2020 Inc. Amount Currency Amount 352,296.11 USD Number RELEASED 62 WT20123003626728 ^^1 Solz0 https://cib.bankofthewest.com/K1/corp/tandingpage 1/1 12/30/2020 WebDirect Create Free Form Wire - Domestic Confirmation Wire Release Information Status: PENDING View status definitions Sequence number; 62 Number of approvals required: 1 Message type cutoff time: 14:30 PST Message type: Domestic Wire Information Account: 059731851.CITY OF LA QUINTA OPERATING ACCOUNT Amount: 352,296.11 Currency; USD Value date: 12/30/2020 Beneficiary Bank Bank ID type: Bank ID; Bank name: Bank address l: Bank address 2 (Optional): Country (Optional): Beneficiary information Beneficiary account number: Beneficiary name: Beneficiary address 1 (Optional): Beneficiary address 2 (Optional): Country (Optional): Remittance information F-Fed Routing Number 122016066 CITY NATIONAL BANK ONE CENTERPOINTE DRIVE STE160 LA PALMA, CA 90623 US /013601755 Four Seasons Escrow, Inc. 78070 Calle Cadiz La Quinta, CA 92253 US Standard remittance (up to 70 characters per line) Remittance Payment details 1 FS3245 Closing Funds in the (Optional): (Optional): amount of $352,296.11 Payment details FBO City of La Quinta - Dune 2 (Optional): Palms Mobile Park / Intermediary Bank 1 information (Optional) Bank ID type (Optional): Bank ID (Optional): Bank name (Optional): Account number (Optional): Address 1 (Optional): Address 2 (Optional): Address 3 (Optional): Intermediary Bank 2 information (Optional) Bank ID type (Optional): Bank ID (Optional): Bank name (Optional): Account number (Optional): Address 1 (Optional): Address 2 (Optional): Address 3 (Optional): Originator information Originator name: Originator ID: Originator address 1: CITY OF LA QUINTA OPERATING ACCOUNT 059731851 78495 CALLE TAMPICO https://cjb-bankofHiewest.com/K1/corp/landingpage 1/2 12/30/2020 WebDirecS Originator address 2 (Optional): LA QUINTA, CA Originator address 3 (Optional): US Detail History information Acdon User ID Date/Time Created RHALUCK 12/30/202012:50:07 PST Save as Template https://cib.bankofthewest.com/K1/corp/landmgpage 2/2 Rosemarj/JHalli^ From: Karia Romero Sent: Wednesday, December 30, 2020 12:33 PM To: Rosemary Hallick; Angela Ferreira Cc: Monika Radeva; Gilbert Villalpando; Jessica Delgado Subject RE: File # FS3245 | 46400 DUNE PALMS ROAD, LA QUINTA, CA 92253 | City of La Quinta, a California municipal corporation That would be great. My understanding is we need to send $352,296.11 KarIa Romero 1 Finance Director/Ctty Treasurer *My working hours may not be your working hours. Please do not feel obligated to reply outside of your normal work schedule. From: Rosemary Hallick <rhallick@laquintaca.gov> Sent: Wednesday, December 30, 2020 12:32 PM To: Angela Ferreira <aferreira@laqurntaca.gov>; Karla Romero <kromero@laqulntaca.gov> Cc: Monika Radeva <mradeva@laquintaca.gov>; Gilbert Villalpando <Gvi))alpando@laquintaca.gov>; Jessica Delgado <jdelgado@laquintac3.gov> Subject: RE: File # FS3245 | 46400 DUNE PALMS ROAD, LA QUINTA, CA 92253 | City of La Quinta, a California municipal corporation Karla, Jessica and I are both I the office, let me know If you want us to handle this wire. @1 CALII-OKNIA Rosemary Hallick | Financial Services Analyst City of La Quinta 78495 Calle Tampico j La Quinta, CA 92253 Ph. 760.777.7058 www.laQuintaca.Qov www.Dlavinlaquinta.com City Hall Is currently open to the public by appointment only. Finance department information can be found on our website at https://www.laquintaca.aov/business/finance. For additional COVID-19 updates visit: wwwJaquintaca.aov/COVID19. Please note I may be working remotely, but will be conducting business during regular business hours. Thank you for your understanding. Finance staff may also be reached via email at Finance&)laaulntaca.aov. From: Angela Ferreira <aferreira@laQuintaca.gov> Sent: Wednesday, December 30, 202012:17 PM To: Karla Romero <kromero@laquintaca.gov>: Rosemary Hallick <rhallick@laQuintaca.gov> Cc: Monika Radeva <mradeva(5)laauintaca.gov>: Gilbert Villalpando <Gvillalpando(5)laauintaca.gov> Subject: FW: File # FS3245 | 46400 DUNE PALMS ROAD, LA QUINTA, CA 92253 [ City of La Quinta, a California municipal corporation Importance: High Good Morning Team, Please find the attached wire instructions for escrow. Please let me know if you have any questions. Thank you, Angela From: Leeta Slama <Leeta@4seasonsescrow.com> Sent: Wednesday, December 30, 2020 12:12 PM To: Angela Ferreira <aferreira@laQuintaca.gov> Cc: Rosie Ortega <Rosie(5)4seasQnsescrow.com>: Nidaa Sanchez <Nidaa(5)4seasonsescrow.com> Subject: File # FS3245 1 46400 DUNE PALMS ROAD, LA QUINTA, CA 92253 | City of La Quinta, a California municipal corporation Importance: High EXTERNAL: This message originated outside of the City of La Quinta. Please use proper judgement and caution when opening attachments, clicking links or responding to requests for information. Good Afternoon Angela: Pleasure talking with you and "the team". Thank you for arranging the conference call. As discussed, please find the Buyer Estimate and wire instructions for closing funds. The close date will adjust according to when court docs are available; yet the proratlons will remain as the 22"''. On a side note, Mr. Shoar just called and says he believes the proratlons should be as of December 17^^. He is calling BIN to discuss. For now I am leaving It as the 12/22 per our conference call. Let me know if you need anything further. Thank you. Leeta SCama Proudly providing our clients the "Four Seasons" experience for over 15 years. FOUR SEASONS ESCROW, INC. 78070 Calle Cadiz, La Quinta CA 92253 Phone: (760) 564-4044 • Fax: (760)771-2999