Loading...
HomeMy WebLinkAboutFA2022-0005ADDITIONAL SITES CHRONOLOGY CONTACTS NAME TYPE NAME ADDRESS1 CITY STATE ZIP PHONE FAX EMAIL APPLICANT ramon cervantes 6141 Katella Ave ste100 Cypress CA 90630 (951)784-6003 ramon.cervantes@sie mens.com BILL TO ramon cervantes 6141 Katella Ave ste100 cypress ca 90630 (951)784-6003 ramon.cervantes@sie mens.com CONTRACTOR SIEMENS INDUSTRY INC 1000 DEERFIELD PARKWAY BUFFALO GROVE IL 60089 (951)784-6003 ramon.cervantes@sie mens.com CHRONOLOGY TYPE STAFF NAME ACTION DATE COMPLETION DATE NOTES NOTE JACK LIMA 6/29/2022 6/29/2022 ADDED SUBCONTRACTOR ULTIMATE COMMUNICATION SYSTEMS TO THE PERMIT. LETTER OF AUTHORIZATION HAS BEEN RECEIVED BY THE PERMIT HOLDER SIEMENS AND IS UPLOAED TO ATTACHMENTS. CONDITIONS Description: GOLF CLUBHOUSE - MANUAL FIRE ALARM Type: FIRE ALARM (WEB)Subtype: COMMERCIAL - FIRE ALARM SYSTEM Status: ISSUED Applied: 2/10/2022 EPRS Parcel No: 777490013 Site Address: 79565 CLUBHOUSE DR LA QUINTA,CA 92253 Approved: 3/5/2022 KHET Subdivision: PM 33367 Block: Lot: 21 Issued: 3/7/2022 AMA Lot Sq Ft: 0 Building Sq Ft: 0 Zoning: Finaled: Valuation: $40,000.00 Occupancy Type: Construction Type: Expired: 9/3/2022 AMA No. Buildings: 0 No. Stories: 0 No. Unites: 0 Details: Silverrock Resort 52-400 couldnt find address below Printed: Friday, March 03, 2023 2:52:59 PM 1 of 3 Permit Details City of La Quinta PERMIT NUMBER FA2022-0005 CONTACTS NAME TYPE NAME ADDRESS1 CITY STATE ZIP PHONE FAX EMAIL OWNER SILVERROCK PHASE 1 3551 FONTUNA RANCH RD ENCINITAS CA 92924 (951)784-6003 SUBCONTRACT OR RJB ENTERPRISES INC dba ULTIMATE COMMUNICATION SYSTEMS 2579 WEST WOODLAND DRIVE ANAHEIM CA 92801 (951)784-6003 BVIVEROS@UCOMSYS. COM INSPECTIONS SEQID INSPECTION TYPE INSPECTOR SCHEDULED DATE COMPLETED DATE RESULT REMARKS NOTES ROUGH-WIRE INSPECTION KHET 6/30/2022 6/30/2022 APPROVED As-builts required prior to final. FUNCTION TEST KHET 6/30/2022 6/30/2022 NOT READY Too early. Rough wire only DUCT DETECTORS/VELOCITY KHET 6/30/2022 6/30/2022 NOT READY Too early. Rough wire only 24 HR. BATTERY TEST KHET 6/30/2022 6/30/2022 NOT READY Too early. Rough wire only FINANCIAL INFORMATION DESCRIPTION ACCOUNT QTY AMOUNT PAID PAID DATE RECEIPT #CHECK #METHOD PAID BY CLTD BY FIRE ALARM SYSTEMS 101-0000-42421 0 $500.00 $500.00 3/7/22 WEB10925 635815695 60 CREDIT ramon cervantes EPRS FIRE ALARM SYSTEMS PC 101-0000-42420 0 $584.00 $584.00 3/7/22 WEB10925 635815695 60 CREDIT ramon cervantes EPRS Total Paid for FIRE FEES: $1,084.00 $1,084.00 RECORDS MANAGEMENT FEE 101-0000-42416 0 $11.00 $11.00 3/7/22 WEB10925 635815695 60 CREDIT ramon cervantes EPRS Total Paid for RECORDS MANAGEMENT FEE: $11.00 $11.00 TECHNOLOGY ENHANCEMENT FEE 502-0000-43611 0 $5.00 $5.00 3/7/22 WEB10925 635815695 60 CREDIT ramon cervantes EPRS Total Paid for TECHNOLOGY ENHANCEMENT FEE: $5.00 $5.00 TOTALS:$1,100.00 $1,100.00 Printed: Friday, March 03, 2023 2:52:59 PM 2 of 3 Permit Details City of La Quinta PERMIT NUMBER FA2022-0005 ATTACHMENTS Attachment Type CREATED OWNER DESCRIPTION PATHNAME SUBDIR ETRAKIT ENABLED DOC 2/10/2022 Etrakit Public Registration 1ST SUBMITTAL SPEC SHEETS DATA SHEETS Club house.pdf 1 DOC 2/10/2022 Etrakit Public Registration 1ST SUBMITTAL PLANS FIRE ALARM 44OP- 263989-Golf CH - CityFA.pdf 1 DOC 2/10/2022 Etrakit Public Registration 1ST SUBMITTAL APPLICATION La Quinta City application.pdf 1 DOC 6/29/2022 JACK LIMA SIEMENS LETTER OF AUTHORIZATION FOR ULTIMATE COMM. Siemens Authorized Letter-2022 signed.pdf 0 DOC 3/5/2022 KOHL HETRICK FA2022-0005 - APPROVED PLANS.pdf FA2022-0005 - APPROVED PLANS.pdf 1 DOC 3/5/2022 KOHL HETRICK FA2022-0005 - COA AND JOB CARD.pdf FA2022-0005 - COA AND JOB CARD.pdf 1 BOND INFORMATION SPRINKLER MONITORING KHET 6/30/2022 6/30/2022 NOT READY Too early. Rough wire only FIRE FINAL**KHET 6/30/2022 6/30/2022 NOT READY Too early. Rough wire only REVIEWS REVIEW TYPE REVIEWER SENT DATE DUE DATE RETURNED DATE STATUS REMARKS NOTES 1ST FIRE (2 WK)KOHL HETRICK 2/10/2022 2/25/2022 3/5/2022 APPROVED SEE ATTACHMENTS 1ST PERMIT TECH (1 DAY) PERMIT TECH BUCKET 2/10/2022 2/11/2022 2/11/2022 COMPLETE PARENT PROJECTS Printed: Friday, March 03, 2023 2:52:59 PM 3 of 3 Permit Details City of La Quinta PERMIT NUMBER FA2022-0005 MONITORING COMPANY: SIEMENS BUILDING TECHNOLOGIES, INC.603961-0268600 NORTH ROYAL LANE, SUITE 100IRVING, TEXAS 75063(866) 552-7823 \ (877) 859-4135CENTRAL STATION UL NO.#ADDRESS:CITY / STATE / ZIP CODE:TELEPHONE NUMBER:..INITIATING DEVICE CIRCUIT (IDC): CLASS - (B)SIGNALING LINE CIRCUIT (SLC): CLASS - (B)NOTIFICATION APPLIANCE CIRCUITS (NAC): CLASS - (B)NOTE: REFERENCE NATIONAL FIRE ALARM CODE-NFPA FOR ADDITIONAL INFORMATION.PATHWAY SURVIVABILITY: LEVEL 1STATE OF CALIFORNI A S TA TE FIRE MARSHALLOCATION OF WORKCALIFORNIA STATE CONTRACTORSLICENSE NO.: #758796 - B/ C10/ C16/ C20.Siemens Building Technologies, Inc.FIS FIRE/ LIFE SAFETY DIVISION6141 Katella Avenue #100Cypress, California 90630 USAPhone: (714) 761-2200Fax: (714) 826-235379565 CLUBHOUSE DRIVE79565 CLUBHOUSE DRIVE CONDUIT WIRE FILL CHARTDEVICE NUMBERING LEGENDAPPLICABLE CODES & REGULATIONSDEVICE & SYMBOL LEGENDCLUB HOUSE SEQUENCE OF OPERATIONSCABLE LEGEND CLUB HOUSECABLE LEGENDCALIFORNIA STATE CONTRACTORSLICENSE NO.: #758796 - B/ C10/ C16/ C20.--TENANT IMPROVEMENTSYSTEM UPGRADEPER PLANSNEW INSTALLATIONDESIGN BUILDOTHEROTHER________________________________________PER SPECIFICATIONDESIGO:XLS50MXL250/500VOICEMODULAROTHER44OP-263989GOLF CLUBHOUSESILVERROCK RESORT52-400 SILVERROCK WAYLA QUINTA, CA 92253Siemens Building Technologies, Inc.FIS FIRE/ LIFE SAFETY DIVISION6141 Katella Avenue #100Cypress, California 90630 USAPhone: (714) 761-2200Fax: (714) 826-2353 --------FIREFIREFIREFIRE----System No. C-AJ-1001F Rating - 3 HrT Rating - 0 HrW Rating - Class I (See Item 4)A A 1.Floor or Wall Assembly — Min 4-1/2 in. (114 mm) thick lightweight or normal weight (100-150 pcfor 1600-2400 kg/m3) concrete. Wall may also be constructed of any UL Classified Concrete Blocks*. Max diam of circular throughopening is 32-1/2 in. (826 mm).See Concrete Blocks (CAZT) category in the Fire Resistance Directory for names of manufacturers.1A.Steel Sleeve — (Optional, not shown) — Nom 12 in. (305 mm) diam (or smaller) Schedule 40 (or heavier) steel pipe sleeve cast intoconcrete floor or wall. Sleeve to be flush with or project max 2 in. (51 mm) from top surface of floor or from both surfaces of wall. As analternate, nom 12 in. (305 mm) diam (or smaller) sleeve fabricated from nom 0.019 in. (0.48 mm) thick galv steel cast or grouted intofloor or wall assembly flush with floor or wall surfaces.2.Through — Penetrant — One metallic pipe, conduit or tubing installed either concentrically or eccentrically within the firestopsystem. The annular space between pipe, conduit or tubing and periphery of opening shall be min of 0 in. (0 mm, point contact) to max1-3/8 in. (35 mm). Pipe, conduit or tubing to be rigidly supported on both sides of wall assembly. The following types and sizes ofmetallic pipes, conduits or tubing may be used:A.Steel Pipe — Nom 30 in. (762 mm) diam (or smaller) Schedule 10 (or heavier) steel pipe.A1. Iron Pipe — Nom 30 in. (762 mm) diam (or smaller) cast or ductile iron pipe.B.Conduit — Nom 6 in. (152 mm) diam (or smaller) rigid steel conduit.C.Conduit — Nom 4 in. (152 mm) diam (or smaller) steel electrical metallic tubing.3.Packing Material — Polyethylene backer rod or nom 1 in. (25 mm) thickness of tightly-packed ceramic (alumina silica) fiberblanket, mineral wool batt or glass fiber insulation material used as a permanent form. Packing material to be recessed from top surfaceof floor or from both surfaces of solid concrete or concrete block wall as required to accommodate the required thickness of caulk fillmaterial (Item 4). As an alternate when max pipe size is 10 in. (254 mm) diam and when max annular space is 1 in. (25 mm), a min 1 in.(25 mm) thickness of tightly-packed ceramic fiber blanket or mineral wool batt packing material may be recessed min 1/2 in. (13 mm)from bottom surface of floor or from either side of solid concrete wall.4.Fill, Void or Cavity Materials* — Caulk — Applied to fill the annular space to the min thickness shown in the following table:(a) BR=Polyethylene backer rod.CF=Ceramic fiber blanket.GF=Glass fiber insulation.MW=Mineral-wool batt.(b) Caulk installed flush with top surface of floor or both surfaces of wall(c) Caulk installed flush with bottom surface of floor or one surface of solid (non-concrete block) wall3M COMPANY — Type CP 25WB+ or FB-3000 WT(Note - W Rating applies only when FB-3000 WT is used on top surface of floor and when it laps onto concrete for sleeved opening.)* Indicates such products shall bear the UL or cUL Certification Mark for jurisdictions employing the UL or cUL Certification(such as Canada), respectively.Max PipeMax AnnularPacking MtlMin CaulkDiam In.Space In.Type (a)Thkns In.10 (254)1 (25)BR, CF, GF or MW1/2 (13) (b)10 (254)1 (25)CF or MW1/2 (13) (c)30 (762)2-1/2 (64)BR, CF, GF or MW1 (25) (b)SECTION A-A------------------------------CALIFORNIA STATE CONTRACTORSLICENSE NO.: #758796 - B/ C10/ C16/ C20.--TENANT IMPROVEMENTSYSTEM UPGRADEPER PLANSNEW INSTALLATIONDESIGN BUILDOTHEROTHER________________________________________PER SPECIFICATIONDESIGO:XLS50MXL250/500VOICEMODULAROTHER44OP-263989GOLF CLUBHOUSESILVERROCK RESORT52-400 SILVERROCK WAYLA QUINTA, CA 92253Siemens Building Technologies, Inc.FIS FIRE/ LIFE SAFETY DIVISION6141 Katella Avenue #100Cypress, California 90630 USAPhone: (714) 761-2200Fax: (714) 826-2353 1*172*345678910111213141516+12/24V(-)PGM1PGM2PGM3IN1IN2*GNDIN3TIPRINGRING(+)TIP(-)PANELPANEL(R)RTSTX(B)PANELRX(G)PANEL(Y)CTSPower Supply(SLE-ULPS-R)YellowTroubleLEDGreen ACON LED+ BAT –RED BLK67234518 9 10 N/C COM N/O Black ( - ) Red (+)Single 12VRechargeableBackup Battery0.5AFuse(wire tie)(wire tie)16.5VACClass 2IN1+ 12V -AC INNote: Maintainminimum 1/4"separation ofbattery leads fromall other wiring.J2Chassis Mounted 16.5VAC / 20VA TransformerBLKRelay contactsrated max30VDC, 0.5A12VDC output ispower limitedSLE3/4G-CFB-PS OR SLECDMA-CFB-PSPC BoardAll connections are power limited exceptAC Mains, Telco and battery terminalsTerminals 14-17: No connections permitted.Note: Maintain minimum 1/4" separation of all wiring in this compartment from the yellow wires of the transformer.(Earth Ground)Note:IN2SUPERVISORY AlarmTroubleWaterflowNote 1:Note 2:Optionally, the following external antenna kits may be used:SLE-ANTEXT30 - Extended antenna with 30 feet of cableSLE-ANTEXT50 - Extended antenna with 50 feet of cableSLE-ANTEXT75 - Extended antenna with 75 feet of cableFP2012-U1TB10+24V(Red)(Blk)Brownout(Blue)GND(Blk)PSSILNGAVANTENTRETIENDESACTIVEZL'UNITEREMOVINGTERMINALBLOCKPROTECTIONDISCONNECTPOWERPRIORTOWARNINGBrownoutPSSIGND+24VJ3--TYPICAL PAD4 W/ FP2011-U1 9AMP POWER SUPPLY-WIRING DETAIL W/ HTRI-RNONESCALE:120VACNCCOMNO---(SSD-C)ANNCALIFORNIA STATE CONTRACTORSLICENSE NO.: #758796 - B/ C10/ C16/ C20.--TENANT IMPROVEMENTSYSTEM UPGRADEPER PLANSNEW INSTALLATIONDESIGN BUILDOTHEROTHER________________________________________PER SPECIFICATIONDESIGO:XLS50MXL250/500VOICEMODULAROTHER44OP-263989GOLF CLUBHOUSESILVERROCK RESORT52-400 SILVERROCK WAYLA QUINTA, CA 92253Siemens Building Technologies, Inc.FIS FIRE/ LIFE SAFETY DIVISION6141 Katella Avenue #100Cypress, California 90630 USAPhone: (714) 761-2200Fax: (714) 826-2353NAPCO CELL DIALER DETAILSCALE: NTSPOWER SUPPLY DETAILSCALE: NTSANNUNCIATOR DETAILSCALE: NTS CLUB HOUSECALIFORNIA STATE CONTRACTORSLICENSE NO.: #758796 - B/ C10/ C16/ C20.--TENANT IMPROVEMENTSYSTEM UPGRADEPER PLANSNEW INSTALLATIONDESIGN BUILDOTHEROTHER________________________________________PER SPECIFICATIONDESIGO:XLS50MXL250/500VOICEMODULAROTHER44OP-263989GOLF CLUBHOUSESILVERROCK RESORT52-400 SILVERROCK WAYLA QUINTA, CA 92253Siemens Building Technologies, Inc.FIS FIRE/ LIFE SAFETY DIVISION6141 Katella Avenue #100Cypress, California 90630 USAPhone: (714) 761-2200Fax: (714) 826-2353CLUB HOUSE BATTERY CALCULATIONSSCALE: NTSRISER DIAGRAMSCALE: NTS BATTERY42THERMISTOR1924TB213181TB4(-)P12GND4(-)32H(+)P9N(+)31BATTERY1324V 4A FAILHNET FAIL MODULE FAIL24V 12A FAILGND FAULT POWERCAN FAILPSC-12RESET2117121143P4TAMPER3P52TB11TB3+24V116+-120K10KHNET/CANTELEPHONESTERMINATORCAN TERMINATORASI TERMINATOR---LINE LOADCAUTION HIGH VOLTAGETB2FOR LAPTOP ONLYTO NEXT PTBAC OUTPUTH1P1P2PTBINPUTAC MAINNTB1NEH1TO FILTEREENH CB1TO FILTERCB2 P3TO PSC-12 OR PSX-12P4HNEHNP5E****CAB-2EARTHSLOT 1SLOT 2SLOT 3SLOT 4SLOT 5SLOT 1SLOT 2SLOT 3SLOT 4SLOT 5E1 (RED)E2 (ORANGE)E3 (YELLOW)E4 (GREEN)E5 (BLUE)E6 (RED)E7 (ORANGE)E8 (YELLOW)E9 (GREEN)E10 (BLUE)P4LVM+-1P3P1CANP1CC-5HNET/CANGROUND FAULTENABLEDISABLESTYLE 4HNET/XNET STYLESTYLE 7NIC-CXNETGND FAULTCANLOOP B FAILPOWERCARD FAILCAN FAILXNET FAILHNET FAIL RESETLOOP A FAILACTIVE NETWORKSHNETMONITOR PORT---HNET2POWERCARD FAILGND FAULT HNET FAIL XDLCRESETALARMTROUBLE31564OPENSHORT78ZONE 1ZONE 2ZONE 3ZONE 4USBHUNDREDSTENSONESOD-BPOD-BPOD-GPAUDIBLESSUPERVISORYALARMTROUBLEPOWER?ESCONSILENCEDSYSTEMCPU FAILDISABLEMENUMOREINFOFCM-2041---PARTIAL ID-SPD2300-MP12321D2300CPXTMR RECV A PAIRDATA/DDGXTMR B PAIR RECV 5VDC+-12321D2300CPXTMR RECV A PAIRDATA/DDGXTMR B PAIR RECV 5VDC+-INPUTOUTPUT43215V5V24VPS-5AID-SP+-BATTERY12VDC, 75AH BATTERYBATTERY JUMPERTO PSC-12/PSX-12CAB-BATT+-BATTERY12VDC, 75AH (BATTERY(CAB-BATT)BATT(CAB-2)120VAC FACU(PAD-4)120VAC PADCALIFORNIA STATE CONTRACTORSLICENSE NO.: #758796 - B/ C10/ C16/ C20.--TENANT IMPROVEMENTSYSTEM UPGRADEPER PLANSNEW INSTALLATIONDESIGN BUILDOTHEROTHER________________________________________PER SPECIFICATIONDESIGO:XLS50MXL250/500VOICEMODULAROTHER44OP-263989GOLF CLUBHOUSESILVERROCK RESORT52-400 SILVERROCK WAYLA QUINTA, CA 92253Siemens Building Technologies, Inc.FIS FIRE/ LIFE SAFETY DIVISION6141 Katella Avenue #100Cypress, California 90630 USAPhone: (714) 761-2200Fax: (714) 826-2353CLUB HOUSE FIRE ALARM CONTROL PANELSCALE: NTS SSPHASE II - SITE PLANSCALE: 1/64"=1'-0"CALIFORNIA STATE CONTRACTORSLICENSE NO.: #758796 - B/ C10/ C16/ C20.--TENANT IMPROVEMENTSYSTEM UPGRADEPER PLANSNEW INSTALLATIONDESIGN BUILDOTHEROTHER________________________________________PER SPECIFICATIONDESIGO:XLS50MXL250/500VOICEMODULAROTHER44OP-263989GOLF CLUBHOUSESILVERROCK RESORT52-400 SILVERROCK WAYLA QUINTA, CA 92253Siemens Building Technologies, Inc.FIS FIRE/ LIFE SAFETY DIVISION6141 Katella Avenue #100Cypress, California 90630 USAPhone: (714) 761-2200Fax: (714) 826-2353LOCATION OF WORKCLUB HOUSEPENDRY HOTEL UNDER SEPARATESUBMITTAL.CONFERENCE CENTER & SHARED SERVICESUNDER SEPARATE PERMIT FFFFFFFFFF F SSB5AC142D143D144D144C143C143A142A144A144E143B145A146ABOH145ELEC146MECH147147A147B1104KING CF14PROSHOP101CART BARN215VALET/BAGSTORAGE211TRASH213JAN.205STAFF RR208ELEC.214WH210RESTAURANT201KITCHEN202MEN' RR203WOMEN'SRR204FITTING RM102PANTRY206OPEN OFF.104GEN. MAN.OFF.207201A201D201B201CIDF RM.209211B211A215A213B213A214A215B215C215D215ETYPMECHANICAL/ SERVICEYARD216214B216ACAN WASH217217A218ASTORAGE218GOLF DIR.OFF.103CART WASH AREAMAU13000CFMMAU26600CFMCLUB HOUSE AREA OF WORK - 1ST FLOORSCALE: 0'-1/8" = 1'-0"CALIFORNIA STATE CONTRACTORSLICENSE NO.: #758796 - B/ C10/ C16/ C20.--TENANT IMPROVEMENTSYSTEM UPGRADEPER PLANSNEW INSTALLATIONDESIGN BUILDOTHEROTHER________________________________________PER SPECIFICATIONDESIGO:XLS50MXL250/500VOICEMODULAROTHER44OP-263989GOLF CLUBHOUSESILVERROCK RESORT52-400 SILVERROCK WAYLA QUINTA, CA 92253Siemens Building Technologies, Inc.FIS FIRE/ LIFE SAFETY DIVISION6141 Katella Avenue #100Cypress, California 90630 USAPhone: (714) 761-2200Fax: (714) 826-2353CLUB HOUSE FLOORNORTHNORTHLOCATION OF WORK SIEMENS Industy, Inc. Building Technologies - FIS Fire / Life Safety Division 6141 Katella Ave #100 Tel: (714) 761-2200 Cypress, California 90630 Fax: (714) 220-4958 PREPARED FOR: Club house Silverrock Resort Phase II 52-200 Silverrock Way La Quinta, Ca 92253 MODEL NUMBER DESCRIPTION CSFM LISTING XLS / Desigo Modular EQUIPMENT Desigo Modular Fire Alarm Voice Control Panel 7165-0067:0508 FCM2041-U2 Operator Interface (CPU/Display)7165-0067:0508 CC-5 Common Module System Cardcage 7165-0067:0508 PSC-12 Main Power Supply Charger 7165-0067:0508 XDLC Device Loop Card (Isolator compatible)7165-0067:0508 CAB-2 2-row Cabinet Enclosure 7165-0067:0508 CAB2-BB 2-row Cabinet Backbox 7165-0067:0508 OD-GP Outer Door Vented Grill Plate 7165-0067:0508 ID-SP Inner Door Single Blank Plate 7165-0067:0508 BCL Panel Backplane Connection Cable N/A D2325CPS Fiber Optic Interface Module 7300-0067:0172 CAB-BATT Battery Cabinet for (2) 100 A.H. Batteries 7300-0067:0172 Power Supplies PAD-4-9A 9.0 Amp Auxiliary Power Supply/NAC Extender 7315-0067:0268 Annunciators SSD-C System Status Display w/ Control 7165-0067:0508 XLS/Desigo Addressable Devices FDBZ492-HR Duct Detector Housing w/ Relay 3240-0067:0265 ST-100 Sampling Tube (10' Length)N/A FDO421 Intelligent Photoelectric Smoke Detector 7272-0067:0258 FDOOTC441 Intelligent Multi-Sensor Smoke/Heat/CO Detector 7272-0067:0260 DB-11 Detector Base 7300-0067:0134 ABHW-4B Intelligent Detector Sounder Base 7300-0067:0271 ILED-XW Intelligent Remote Lamp with Dual Isolators 7300-0067:0501 XTRI-R Addressable Relay / Monitor Module with Dual Isloators 7300-0067:0501 XTRI-D Addressable Dual Monitor Module with Dual Isloators 7300-0067:0501 XTRI-S Addressable Monitor Module with Dual Isloators 7300-0067:0501 XMS-S Single-Action Manual Pull Station 7150-0067:0512 Audible & Visual Devices ZH-MC-CW Multi-Candela Ceiling Mount Horn/Strobe 7125-0067:0248 ZR-MC-CW Multi-Candela Ceiling Mount Strobe 7125-0067:0252 AS-75-R-WP Weatherproof Wall Mount Horn/Strobe 7125-0067:0247 AS-HMC-CW-WP Weatherproof Multi-Candela Ceiling Mount Horn/Strobe - 115/177cd 7125-0067:0247 WPBBS-R Weatherproof Surface Mount AS Series Horn/Strobe Backbox - Red 7125-0067:0247 WFPAS-W Weatherproof Flush Mount Gasket Plate - White N/A Batteries FIRE ALARM SUBMITTAL TABLE OF CONTENTS SIEMENS Industy, Inc. Building Technologies - FIS Fire / Life Safety Division 6141 Katella Ave #100 Tel: (714) 761-2200 Cypress, California 90630 Fax: (714) 220-4958 PREPARED FOR: Club house Silverrock Resort Phase II 52-200 Silverrock Way La Quinta, Ca 92253 MODEL NUMBER DESCRIPTION CSFM LISTING FIRE ALARM SUBMITTAL TABLE OF CONTENTS PS-1270 7 Amp-Hour 12VDC Battery N/A PS-121000 100 Amp-Hour 12VDC Battery N/A Siemens Data Sheet 7300 Smart Infrastructure – Building Products usa.siemens.com/fire Desigo® Fire Safety Modular system Advanced | Addressable Fire Alarm Control Panel Desigo Fire Safety Modular panel (with mounted FCM2041 -U2 Operator Interface) Architect & Engineer Specifications  Standard / 2500 -point-capacity addressable fire-alarm control panel (FACP)  Ability to network with other Desigo Fire Safety Modular (Desigo Modular) systems  Powerful, easy-to-use programming capabilities - Multiple levels of password protection  Fully programmable through use of a Windows operating system  6 -inch (15.2 cm.), backlit liquid - crystal display (LCD) - Multi-language display  User-friendly system interface - Useful diagnostic light -emitting diodes (LEDs) on all cards  Touch screen for maintenance op erations and function keys  Menu-driven operator commands - End-user HELP screens  32-character custom messages - 40 programmable macro and function buttons – (e.g. – Holiday schedule)  Global annunciation and control capability  `Alarm’ | `Trouble’ | `Programmable’, etc. relay commands  Alarm verification by device, zone - Pre-alarm operation  SureWire™ addressable-loop technology: - Patented polarity-insensitive detection circuits  Supports FirePrint® application-specific detection, and single-person `Walk Test’  Coded outputs  Seismic certified  Modular assembly  Distributed processing  UUKL Listed for smoke control System Overview – (continued) with the requirements of NFPA Standard 72, and is listed by Underwriters Laboratories under their UL 864 standard and is FM Approved. Underwriters Laboratories Canada also lists Desigo Fire Safety Modular panels under ULC-S527. Each panel is additionally UL Listed under the category `UUKL for Smoke Control.’ When it comes to Siemens Sinorix® clean - agent systems, Desigo Modular panels are UL | ULC Listed for use in foam or water applications. Each panel is also listed as a Fireman’s Smoke Control Station (in high - rise office buildings | malls | other large structures. Desigo Fire Safety Modular has been seismic qualified in accordance with: − International Building Code | 2006 Ed. − California Building Code | 2007 Ed. − AS CE Standard 7 | 2005 Ed. − OSHPD, OSP-0057-10 − OSHPD, CAN 2-1708A.5, Rev. 3 − ICC-ES AC 156, effective 1/1/2007 Architect & Engineer Specifications  Universal AC power input: - 120VAC – 240VAC @ 50 / 60Hz - 12A of basic system power; expandable to 48A  Supported by all Desigo® CC Management Stations  Automatic environmental compensation for smoke detectors  Peripheral interface to remote printers - connected to the communication bus from any NIC-C output in an enclosure - Class B (Style 4) or Class A (Style 7) wiring  Security-device monitoring - UL1076 Listed  Mounts in one (1) electrical back box - Optional 4 –11/16 inch [12 cm.] and 5- inch [12.7 cm.] square back boxes  Supports pre-action | deluge | agent releasing - sprinkler supervision  NEC 760 power-limited circuits  200 notification-appliance-circuits (NACs) capacity - Up to 3A @ 24VDC per NAC - Built-in strobe synchronization protocol  UL 864 10 th Edition and UL 2572 Listed, ULC-S527 3 rd Edition Listed; FM, CSFM ApprovedFM (#3010), CSFM (#7165 - 0067:0222) and NYC Fire Dept. (NYCFD - M (#3010), CSFM (#7165 -0067:0222) and NYC Fire Dept. (NYCFD - #6160) Approved System Overview Sold as part of the product line of Siemens – Fire Safety products, Desigo Fire Safety Modular (Desigo Modular) is a microprocessor-based, reliable and advanced fire-safety system. Each of these addressable panels uses a contemporary operator interface that functions as an operator interface and as a central microprocessor. Desigo Modular is ideally suited for commercial, institutional and industrial intelligent detection and notification - appliance applications. Each panel complies Siemens Smart Infrastructure – Building Products –2– usa.siemens.com/fire System Components A basic Desigo Fire Safety Modular fire- alarm control panel (FACP) consists of one (1) of the following parts: Operator Interface; power supply (PSC-12); Class X Device Loop Card (XDLC); Zone Indicating Card (ZIC -4A); five-slot card cage (CC-5); Inner Door Blank Single Plate (ID-SP), and a CAB1, CAB2 or CAB3 system enclosures. Optional modules that can be installed on a Desigo Fire Safety Modular FACP include: Card Cage (Model CC-2); Network Interface Card (Model NIC -C); 8-Circuit Zone Indicating Card (Models ZIC-8B / Z IC- 2C); Output Control Module (Model O CM - 16); Switch Control Module (Model S CM - 8); LED Control Module (Model LCM-8); Fan Control Module (Model FCM-6); Supervised Input Module (Model SIM-16); Power Supply Extender (Model PSX-12); Remote Network Interface (Model RNI); Remote Printer Module (Model RPM); System Status Display (Model SSD); Digital Alarm Communicator (Model F CA2015- U1) Multi-Point Digital Alarm Communicator (Model MDACT); Two- Module Remote Enclosure (Model REMBOX2), and the Four-Module Remote Enclosure (Model REMBOX4). Additionally, Desigo Modular panels are compatible with all of the advanced Siemens field devices in signaling appliances and intelligent, addressable detection. Desigo CC Management Stations compatible with Desigo Fire Safety Modular Desigo Fire Safety Modular panels are compatible with Siemens Fire Safety Management Stations, which provide integrated and reliable FACP monitoring and control of system events − including: `Alarm’ | `Trouble’ | `Security’ | `Supervisory’ commands. Desigo CC management station s include PC-based, color-graphics software designed for use with the XNET network, offering full control and annunciation. An extensive history log of all system events, as well as extensive report-generation capabilities, is easily maintained. There are also user-programmable electronic buttons that allow for site - specific control functions. Operator Interface used on Desigo Fire Safety Modular FACPs FCM2041 -U2 → Operator Interface The Operator Interface is the primary user interface and central microprocessor for Desigo Modular. Enhancements to the most current version of the Desigo Modular Operator Interface include go -to-beginning, go - to -end queue buttons; a front-end command screen with `Alarm’ | `Supervisory’ | `Trouble’ light-emitting diodes (LEDs), and three (3) types of alternate-language overlays all orderable under one (1) part. See: Details for Ordering section in this document for more info). Desigo Modular panels are controlled and operated from the Operator Interface, which uses large, lighted control buttons to prompt the end-user to the next avai lable, correct system operation shown on the front-end screen. Additionally, the system Operator Interface provides a 6” (15.2 cm.) front-end touch screen comprised of system-status LEDs as well as a liquid- crystal display (LCD) of 1200 –x– 800. There are language overlays that provide naming in alternate languages for visual indicators found on the front of each Operator Interface. Each overlay is assigned on the o uter assembly, respectively, when affixed to the front- end display on the user interface . The Operator Interface contains the site- specific program configuration in the software too, Zeus-D. Z IC-4A → Zone Indicating Card The Zone Indicating Card (Model ZIC -4A) provides four (4) fully supervised, programmable output circuits for use on each Desigo Modular FACP. Model ZIC-4A supplies four (4 ). `Class B’ (Style Y) or `Class A’ (Style Z)-type output circuits, power limited to 3.0A, maximum, per circuit. Each circuit can be independently programmed for use with agency listed/approved audible or visual notification appliances; emergency audio speakers; municipal-tie boxes; leased lines, or as optional releasing circuits. Model ZIC-4A plugs into one (1) slot in the Model CC-5 or CC-2 card cage, and has on-board LEDs for system status and troubleshooting. Indication of power, communication, internal operation and ground-fault conditions are provided, as well as indication of circuit activation or `Trouble’ conditions. ZIC-8B → Zone Indicating Card (with Model ZIC-2C) Another Zone Indicating Card (Model ZIC-8B) provides eight (8) fully supervised, programmable output circuits for use on Desigo Modular panels. Model ZIC -8B contains eight (8) `Class B’ (Style Y)- type output circuits, power limited to 2.0A, max., per circuit. Each circuit can be independently programmed for use with agency-listed/approved audible or visual notification appliances, or emergency audio speakers. Model ZIC-8B plugs into one (1) slot in the Model CC-5 or CC- 2 card cage, and has on -board LEDs for system status. A Model ZIC-2C mounts directly on Model ZIC-8B, and allows each Model ZIC -8B output circuit to be used for two -channel voice applications. Indication of power, communication, internal operation, and ground-fault conditions are provided, as well as indication of circuit activation or `Trouble’ conditions. Desigo CC Management Station Desigo Fire Safety Modular Siemens Smart Infrastructure – Building Products –3– usa.siemens.com/fire System Components XDLC → Device Loop Card The `Class X’ Device Loop Card (Model XDLC) is the interface used for connecting Siemens addressable, intelligent `X’ as well as `H’-series devices. A Model XDLC operates and maintains a ll devices residing on up to four (4) `Class A’, eight (8) `Class B’ addressable circuits. Additionally, Model XDLC has 16 LEDs for diagnostic purposes, and provides ground-fault detection and zone- isolation circuitry. NIC-C → Network Interface Card The Network Interface Card (Model NIC -C) provides HNET or XNET network communications between enclosures. In addition to HNET or XNET communication, Model NIC -C provides CAN network communication within an enclosure or external to the enclosure. HNET or XNET communication can be wired Style 4 o r Style 7, but the CAN network can be wired Style 4 only. When used for HNET communications, Model NIC-C provides contact between enclosures on a single system. When NIC -C is used for NXET communications, Model NIC -C provides co mmunication between systems. The maximum of NIC - C cards on a single-panel XNET is one (1) for a total 64 NIC -C cards o n a peer-to- peer XNET network. Model NIC-C has diagnostic LEDs that indicate: `Card Fail’, `CAN Fail’, `HNET Fail’, `XNET Fail’, `Ground Fault’, `Loop ‘A’ Fail’ and `Loop `B’ Fail’. This card also has LEDs to indicate `Power’, `Style’ and `Active Networks’. Intelligent Control Point Module Model HCP is designed to be used with the Siemens – Fire Safety Alarm Signaling Devices product line. Model HCP can be set as an independent, remotely located telephone zone, speaker zone or notification-appliance circuit. Model HCP communicates throu gh analog loop of Model DLC. Model HCP can be wired either `Class B’ (Style Y) or `Class A’ (Style Z). The 24 Volts DC power input is from either the control panel or from any UL Listed power-limited, auxiliary power supply. NRC → Network Ring Card, 2nd Generation Model NRC is a network ring card that transmits single-mode or multi -mode network communication via fiber-optic or copper lines. Each NRC uses a `Class A’ (Style 7) ring configuration with a Desigo Modular panel. One (1) Model NRC (per system node) provides XNET, peer-to -peer network communication between panels, allowing 64 (max.), Desigo Modular panels to be networked simultaneously. Model NRC takes one (1) card slot, and mounts in a Model CC-2 or CC-5 card cage inside a Model CAB1, Model CAB2, or Model CAB3 enclosure. PSC-12 → Power Supply Charger Module The Power Supply Charger Module (Model PSC-12) is an addressable- intelligent, microprocessor-controlled module that communicates its status to the operator interface. Additionally, PSC- 12 is a high -current power supply that provides primary, regulated (at 24VDC) system power. Model PSC-12 is rated at 12Amps (`Alarm’) / 5Amps (Standby), and has a built-in battery charger, capable of charging up to 100 AH batteries. PSX-12 → Power Supply Charger Module The Power Supply Extender (Model PSX- 12) is a high-current, auxiliary power supply that expands the main Model PS C- 12 power supply and battery cha rger to an additional 24VDC of system power. Model PSX-12 is rated at 12 Amps. PTB → Power Termination Board Each Model PSC-12 comes packaged with a module known as the Power Termination Board (Model PTB). Model PTB is required for operation with Model PSC-12. Model PTB filters the power from the incoming AC mains, and distributes it to the Model PSC-12 power supply and the optional Model PSX-12 power-supply extender. Model PTB has an optional connector that can be used during system installation, commissioning and service to provide the technician with a place to plug in their laptop PC, if required. Model AC-ADPT is an optional accessory cable that allows connection on one side to Model PTB, via a keyed connector and on the other end directly into to the laptop's transformer. Most laptop-computer external power transformers have removable AC power cords, which can be replaced by the optional Model AC-ADPT to temporarily provide an AC power source for laptop-PC usage during system installation, service and maintenance calls when needed. SNU-ASSY → Single -Node Upload (SNU) Module The Single-Node Upload (SNU) is an optional system module that provides a solution for having data configuration done remotely. SNU can easily transmit data from a PC running the custom-configuration tool, Zeus-D, to a maximum 64 central processors. Each SNU module has three (3) connectors: Power, Ethernet and USB. The data transported between the Zeus-D tool and SNU is made through a direct 128 -bit, Secure Sockets Layer (SSL) connection . HCP Typical mounting set-up of a SNU module Siemens Smart Infrastructure – Building Products –4– usa.siemens.com/fire System Components – (continued) DACT → Digital Alarm Communications Transmitter The Digital Alarm Communications Transmitter (Model FCA2015-U1) optionally provides a means for communication between either a Desigo Modular system; one (1) Fire Terminal (Model FT2050), and with either a central or remote monitoring station. Available communication protocols include: SIA DCS 8 | SIA DCS 20 | Ademco Contact ID. Additionally, each DACT can sync with IP and GSM communication technology. XDACT-ASSY → XDACT Assembly The XDACT Assembly (Model XDACT-ASSY) is the blank plate used for holding the optional Digital Alarm Communication Transmitter (DACT), Model FCA2015-U1 on Desigo Modular systems. Model XDACT-ASSY can be mounted on all CAB-series enclosures. Each assembly must be located in the Global Operator Interface cabinet for global configurations. SSD Series → System Status Display The System Status Display (SSD-series model displays) is a remote LED / LCD display that shows the local status of a Desigo Modular system. An LED illuminates when `Alarm’ | `Supervisory’ | `Trouble’, and `Security’ events occur on the system. A (4) four-line liquid-crystal display (LCD) will give details of the event in alphanumeric form. The display can be toggled to display additional events. Optional remote system control capabilities are available. Models SSD- C, SSD-C-INT, and Model SSD-C-REM have three (3) additional control buttons to acknowledge events; silence audible circuits, and reset the system. Models SSD-C and SSD-C-INT have an integral key-switch that enables these control buttons to operate. Model SSD-C- REM is located within a locked cabinet. So, no additional key-switch is required for manual activation of the control buttons. RPM → Remote Printer Module The Remote Printer Module (Model RPM) provides a means of connecting a Desigo Modular system to a printer, such as Model PAL-1, for creating a hard copy of system status and configuration reports. Concurrently, Model RPM provides an output port that can be configured to communicate with external systems. VNTPC → Virtual Network Tunnel The Virtual Network Tunnel (VNT) is an efficient means for real -time communication, as well as providing support to HNET, XNET and DNET monitoring and supervision – when used as part of a Fire Command Center or a Building network. Each Model VNTPC is a fanless, headless industrial computer, receiving its operating power from a Desigo Modular panel . Model S IM-16 Model OCM-16 SIM -16 → Supervised Input Module The Supervised Input Module (Model S IM- 16) is a remotely located, genera l-purpose input module. Model SIM-16 provides 16 input circuits for remote system monitoring. Each input can be individually programmed as supervised (dry-contact only) or unsupervised (general-purpose input.) Model SIM-16 has two (2) `Form C ’ relays. The relays and inputs are programmed using the system software-programming tool , Zeus-D. OCM-16 → Output Control Module The Output Control Module (Model OCM-16) is a remotely located, general -purpose output module that provides 16 open - collector outputs to drive LEDs, incandescent lamps or external relays. There is an additional output for a local audible and two (2) inputs for momentary lamp test, as well as local, audible silence switches. Model OCM-16 is mounted in a separate enclosure from the main control panel. C900V2 → Dialer-Capture Ethernet Module The Dialer-Capture Ethernet Module (Model C900V2) links the data output of Model MDACT from the Desigo Modular FACP to an Ethernet connection ─ on a local-area network (LAN) or wide-area network (WAN) ─ for communication to a central station over the Internet. Model C900V2 also allows Model MDACT to be optionally linked to the public switched telephone network (PSTN) for communication to a central station, via telephone lines. MDACT → Multi-Point Digital Alarm Communicator Transmitter The Multi-Point Digital Alarm Communicator Transmitter (Model MDACT) is used in Desigo Modular systems where point identification of system events is required at Central or Remote Receiving Stations. An intelligent RS−485 communications protocol transmits all system information to Model MDACT. The installer selects the specific event or groups of events that are set to transmit from Model MDACT over phone lines to listed receiving station equipment. In turn, Model MDACT can transmit point information, via the Ademco Contact ID and the SIA protocol. A mounting plate (Model MOM2-XMP), MOM-2 card cage, and an XMI Interface Card are required for installation. RPM module Siemens Smart Infrastructure – Building Products –5– usa.siemens.com/fire System Components – (continued) Model CC-2 Model CC-5 CC-5 / CC -2 → Card Cages The Model CC-5 / CC-2 card cages provide the physical mounting location and all wiring connection points for all fire-and-voice system options cards to each Desigo Fire Safety Modular system. Model CC-5 has five (5) slots, while Model CC-2 has two (2) slots. All cards plugged into each CC-5 / CC-2 card cage communicate with other Desigo Modular system modules via a common data bus. Connectors are provided on the left and right side of the CC-5 to connect a 60 -pin cable for communications with the Desigo Modular operator interface, power supplies and amplifiers modules. Field wiring to devices and circuits terminates on the Models CC-5 / CC-2 card cages. All cards designed for use with the Models CC-5 / CC-2 route their field wiring terminations to the ‘top’ of the Model CC-5 / CC-2 card cages. These connections are all power limited. Internal wiring connections distribute 24VDC to cards or high-level audio signals (depending on application used) connect to the ‘bottom’ of the Model CC-5 / CC-2 card cages. These connections are all non -power limited. All wiring connections to the Mo del CC-5 / CC-2 card cages are to removable terminal blocks. Terminal blocks are rated for use with wire sized 12 American Wire Gauge (AWG) to 24AWG. Each connector is numbered to make wiring terminations to the correct position on the terminal block simple in order to reduce potential system-wiring errors. SCM -8 → Switch Control Module The Switch Control Module (Model SCM- 8) is a Desigo Modular system option module that provides manual control of the Emergency Voice Evacuation System or manual fire system control. Each Model SCM-8 module has eight (8) momentary push -button switches and 16 LEDs to indicate their status. Each switch is assigned two (2) LEDs and a label to indicate the Model SCM -8 switch is in use. The label slides behind a clear, protective covering, and one of the LEDs assigned to each switch is a dual-color LED used to indicate what type of signal is active. Each Model SCM-8 and switch is fully programmable, and may be used to control speaker circuits and a wide range of general-system functions such as: `All Call’ | `All Evac’ | `Speaker ’ | etc. Any number of circuits may be grouped and controlled by a single switch. Switch usage and zone groupings are assigned using the Desigo Fire Safety Modular system-programming tool, Zeus-D. Model SCM-8 is mounted on a hinged panel, as part of the Desigo Modular Command Console (C.C.) enclosure. LCM -8 → LED Control Module The LED Control Module (Model L CM-8) is a Desigo Modular system option module that provides LED annunciation for system activity. Each Model LCM-8 module contains eight (8) groups of two (2) LEDs – each of which can be assigned to desired outputs, via the Desigo Fire Safety Modular system - programming tool, Zeus-D. Eight (8) LEDs are dual-color capable of emitting either in RED or GREEN — `Flashing’ or `Steady’. The remaining LEDs are AMBER – `Flashing’ or `Steady ’. There is a space provided for labeling of LED functions. The label slides behind a clear, protective membrane. Model LCM-8 dimensions are identical to Model SCM-8, and the LED control module is mounted on the same hinged panel, as part of the Desigo Fire Safety Modular C.C. enclosure. FCM-6 → Fan Control Module The Fan | Motor | Dampers Control Module (Model FCM-6) is a Desigo Modular system command-console option module that provides manual control of the fans, motors, and dampers used in building heating | ventilation | air-conditioning (HVAC) systems. Each Model FCM-6 module provides six (6) sets of three (3) push -button switches for manual -system control. Each switch has three (3), associated LEDs to indicate Fan / Damper / Motor status: OFF (RED LED); ON (GREEN LED), `Trouble’ (YELLOW LED). When manually switched to the ON position, the G REEN LED will flash, indicating the output circuit used to turn on the Fan / Damper has activated. The GREEN LED will light to a steady green to indicate positive feedback of the Fan / Damper actually turning on (via a monitored input.) IIC → Interface Isolation Card The Interface Isolation Card (Model IIC ) is designed to isolate network signals when used with a Desigo Modular Command Console (C.C.) ring configuration, via the network-ring card, Model NRC. Model IIC executes the aforementioned isolation by removing the backplane network signals from each Model CC-2 card cage. Model IIC also provides one (1) end of CAN termination on each side of Model CC-2. Two (2) 60-pin interfaces are contained in each Model IIC: the male-ribbon- cable receptacle accepts the data from the cable of the previous Model CC-2 card cage, and the female-ribbon -cable receptacle plugs into the 60 -pin receptacle of the next-in -line Model CC-2 card cage. Siemens Smart Infrastructure – Building Products –6– usa.siemens.com/fire System Enclosures and Equipment CAB1 → Single Row Enclosure Model CAB 1, the smallest of the Desigo Modular system enclosures, can house a single Model CAB-MP cabinet mounting plate for mounting card cages; power supplies, and bulk amplifiers. Model CAB1 also has four (4) mounting slots on the inner door for mounting the Desigo Modular operator interface and Model ID- MP switch module brackets. Model CAB1 comes complete with a black back box; black inner and outer doors; a single lock and key set on the outer door; a single, installed cabinet mounting plate (Model CAB-MP), and a single, installed outer door lens plate (Model OD- LP). A red version (Model CAB1-R) is also available. Approximate size: 27” (68.6cm.) high ; 26” (66cm.) wide, and 8” (20.3cm.) deep CAB2 → Two-Row Enclosure The Two-Row Enclosure (Model CAB2) is the mid-sized Desigo Modular system enclosure capable of housing up to two (2) Model CAB-MP cabinet mounting plates. The inner door has two (2) rows of four (4) mounting slots. The outer door has space for mounting two (2) outer door plates (Models OD-LP, OD-BP or OD-GP), and can be configured to open from either side. Model CAB2 consists of the black Model CAB2-BB back box, the Model CAB2-BD black inner and outer door package, and one (1) Model OD-LP lens plate. The outer door has a single lock and key set installed. A red version (Model CAB2R) is also available, and a CAB2-RB back box is used with Model CAB2R. Approximate size: 45” (114.3cm.) high, 26” (66cm.) wide, and 8” (20.3cm.) deep CAB3 → Three-Row Enclosure Model CAB3, the largest Desigo Modular system enclosure available, can house a maximum three (3) Model CAB-MP cabinet mounting plates in the enclosure, and three (3) rows of inner-door mounting slots. The outer door can be configured to open from either side. Model CAB3 consists of the Model CAB3-BB back box, the Model CAB3-BD black inner and outer door package, and one (1) Model OD -LP lens plate. The outer door has two (2) locks and key sets installed. A red version (Model CAB3 R) is also available. Approximate size: 63” (160cm.) high, 26” (66.4cm.) wide, and 8” (20.3cm.) deep REMBOX → Remote System Enclosures Models REMBOX2 and REMBOX4 are Desigo Modular system enclosures that are used for remotely mounting inner-door modules, which include: the Desigo Modular o perator interface and switch- control modules (Model SCM series). Models REMBOX2 and REMBOX4 are thinner than regular Model CAB-series of enclosures – just 5” (12.7cm.) deep overall, and are perfect for mounting in limited- space areas (e.g. – office-complex lobbies or behind a receptionist’s desk). No card cages, power supplies or bulk amplifiers can be mounted in a given Model REMBOX-series enclosure due to their smaller depth. However, the Desigo Modular operator interface and some modules (e.g. – the remote network interface module [Model RNI]; the output control module [Model OCM-16], and the supervised input module [Model S IM -16]) can be mounted in a given Model REMBOX-series enclosure. Due to the depth of Models LVM and FMT, no Model OCM-16 or Model S IM-16 modules can be used simultaneously with Model LVM or Model FMT. Model REMBOX2 and Model REMBOX4 are designed for flush mounting with no trim kit required. Both enclosures also come with a clear lens plate on the cover. REMBOX2 → Two-Module Remote Enclosures Model REMBOX2 has two (2) inner-door module spaces, and can hold a single Desigo Modular operator interface, as well as up to two (2) switch-module brackets. Model REMBOX2 can also mount a single RNI remote network interface on a bracket included in the backbox. A bracket, known as Model REMBOX2-MP, can be used to mount up to four (4) Model OCM-16 output control modules or SIM-16 supervised input modules. A Model REMBOX2-MP must be purchased separately. Approximate size : 18-1/2” (47cm.) high; 14-1/2” (36.8cm.) wide, & 5” (12.7cm.) deep REMBOX4 →Four-Module Remote Enclosures Model REMBOX4 has space for mounting four (4) inner-door modules. Any combination of an operator interface (two-module spaces); switch module brackets; Model LVM, or Model FMT (one-module space each) can be used. Unused module spaces can be covered with Model ID-SP blank plates. Model REMBOX4 can also mount a single, remote network interface (Model RNI) on a bracket included in the backbox. A separately orderable bracket known as Model REMBOX4-MP can be used to mount up to eight (8) output control modules (Model OCM- 16) or supervised input modules (SIM- 16). Approximate Size : 24” (61cm.) wide, 18-1/2”(47cm.) high and 5” (2.7 cm) deep Siemens Smart Infrastructure – Building Products –7– usa.siemens.com/fire System Enclosure s and Equipment – (continued) CAB -MP → Cabinet Mounting Plate The cabinet-mounting plate for Desigo Modular systems, Model CAB-MP, provides mounting for a single row of system modules housed in a Desigo Modular system enclosure. Up to four (4) module spaces are available on one (1) Model CAB-MP plate. Each of these mounting plates is used to mount the Model CC-5 Card Cage; the Model CC-2 Card Cage; the Model PSC-12 power supply, and the Model PSX-12 power-supply extender for Desigo Modular fire-only systems. ID-MP →Inner Door Mounting Plate The inner-door mounting plate (Model ID-MP) is mounted on the inner door of any given Model CAB-series enclosure. Each Model ID-MP plate is used to mount switch-control modules (Model SCM-8); LED control modules (Model LCM-8), or fan-control modules (FCM-6). Four (4) mounting plates are included with one (1) order of Model ID-MP. Each mounting plate has four (4) spaces for control modules, and can hold either four (4) Model SCM -8 modules: one (1) control -module space for each actual module, or two (2) fan-control modules: two (2) module spaces per each Model FCM -6. Mounting combinations are possible. Blank spaces found in Model ID-MP plates can be covered using the blank- control module plate (Model BCM). Up to four (4) modules can be mounted on a single row of the inner door. BCM → Blank Control Module Plate Blank Control Module P lates (Model BCM) can be mounted on a single ID-MP. Four (4) blank module plates are included with each order of Model BCM. ID-SP → Inner Door, Single (blank) Plate The inner door, single blank plate (Model ID-SP) is used to cover any single-module blank spaces within the inner door where no Desigo Modular operator interface or Model ID-MP is being used. Up to four (4) Model ID-SP modules can be mounted in a single row on the inner door. Two (2 ) blank plates are included with each order of Model ID-SP. OD -LP → Outer Door Lens Plate The outer-door lens plate (Model OD-LP) is a clear, plastic lens plate mounted on the outer door of a system cabinet. Model OD-LP is used to allow operators to see the system interface and controls mounted on the inner door, but restricts access to unautho rized users. The plate covers an entire row on the outer door. One (1) single lens plate is included with each order of Model OD-LP. OD -GP → Outer Door Grill Plate The outer-door grill plate (Model OD -GP) covers an entire row on the outer door of a system cabinet, but has four (4) rows of ventilation louvers on it. Model OD-GP is mounted in front of system bulk amplifiers, card amplifiers, or other modules that generate heat. Using Model OD-GP will permit airflow across these modules to aid in heat dissipation. One (1) grill plate is included with each order of Model OG-GP. OD-BP → Outer Door Blank Plate The outer-door blank plate (Model OD-BP), which mounts on the outer door of a Desigo Modular enclosure, entirely covers an unused row found on a Desigo Modular system cabinet. XLS-MSE2/R-ADPT →Enclosure Adapter Model XLS-MSE2-ADPT, which must be used in conjunction with Model CAB - MP plates, is an adapter that allows Desigo Modular cards to be mounted in older-generation MXL Model MSE- 2–series small black enclosures. Model XLS-MSE2R-ADPT, which must be used in conjunction with Model CAB-MP plates, is an adapter that allows Desigo Modular cards to be mounted in older-generation MXL Model MSE-2R small red enclosures. XLS-MME3/R-ADPT →Enclosure Adapter Model XLS-MME3-ADPT, which must be used in conjunction with Model CAB-MP plates, is an adapter that allows Desigo Modular cards to be mounted in older-generation MXL Model MME-3–series or Model MBR -2 medium black enclosures. Model XLS-MM E3R-ADPT, which must be used in conjunction with Model CAB-MP plates, is an adapter that allows Desigo Modular cards to be mounted in older-generation MXL Model MME-3R medium red enclosures.Blank Control Module Plate Outer Door Lens Plate Outer Door Inner Door Adapter Plate Outer Door Inner Door Adapter Plate Siemens Smart Infrastructure – Building Products –8– usa.siemens.com/fire System Enclosures and Equipment – (continued) XLS-MSE3/R-ADPT → Enclosure Adapters Model XLS-MSE3-ADPT is an adapter that allows Desigo Modular cards to be mounted in older-generation MXL-IQ Model MSE-3L or Model MSE-3M black enclosure. Model XLS-MSE3R-ADPT is an adapter that allows Desigo Modular cards to be mounted in older- generation MXL- IQ Model MSE-3LR or Model MSE-3MR red enclosure. XLS-RCC13F/R-ADPT →Enclosure Adapter Model XLS-RCC13F-ADPT is an adapter that allows the Desigo Modular Model SSD/-C series remote annunciator to be mounted in older-generation Model RCC-1F or Model RCC -3F black, flush- mount enclosure. Model XLS-RCC13FR-ADPT is an adapter that allows the Model SSD/-C series to be mounted in older-generation RCC- 1FR and RCC-3FR, red flush-mount enclosure. XLS-RCC-1-ADPT → Enclosure Adapter Model XLS-RCC1-ADPT is an adapter that allows the Desigo Modular Model SSD/-C series remote annunciator to be mounted in older-generation Model RCC-1 surface-mount enclosure. Remote Transponders Desigo Modular systems can use remote transponders for mounting additional modules such as amplifiers without requiring a Desigo Modular operator interface or any control switches. Special doors are available for systems using Model CAB-2 or Model CAB-3 remote transponders. These doors (Models CAB2-XBD and CAB3-XBD) omit the unused inner door, and come complete with ventilation louvers built into the door. Model CAB2 -XBD fits into Model CAB2 - BB, and Model CAB3-XBD fits into Model CAB3-BB. Model CAB2 -XBD and CAB3- XBD are supplied in black. Red versions (Models CAB2 -XRD and CAB3-XRD) are also available. Complete box and door kits are available, Models CAB2 -X and CAB3-X. Enclosure Trim Kits Trim kits are available for all Desigo Modular system enclosures for semi-flush mounting applications. Model CAB1 -TK (for black enclosures) and the Model CAB1R-TK (for red enclosures) fit inside the Models CAB1 and CAB1 -R enclosures. Similarly, Models CAB2-TK and CAB-2R-TK fit inside the Model CAB-2 enclosure, while Models CAB3-TK and CAB3R-TK fit the Model CAB-3 enclosure. Model VPM Model VESDA-HLI-KIT VESDA High Level Interface The Very Early Smoke Detection Aspiration (VESDA) Peripheral Module (Model VPM) and the VESDA High-Level Interface Kit (Model VESDA-HLI-KIT) are optional system modules that work in conjunction to provide bi-directional communication between the Modular FACP and multiple VESDA detection networks for the following types of VESDA detectors: • LaserCOMPACT • LaserFOCUS • LaserPLUS • LaserSCANNER Model VPM allows each Desigo Modular FACP to annunciate `Alert,’ `Action,’ `Fire 1,’ and `Fire 2’ levels, as well as provide `faults’ from any zone on a connected VESDA network. The VPM Mounting plate (Model VPM-MP) allows mounting one (1) Model VPM and two (2) of Model VESDAHLI-KIT inside a standard Model CAB1, Model CAB2 or Model CAB3 enclosure. Model VPM-MP utilizes two (2) module spaces on a single row of each enclosure. Model FT-GLS FT-GLS — Replacement Glass Additional replacement glass for Model FC300S is orderable as Model FT-GLS. Outer Door Inner Door Adapter Plate Trim Plate Plate CAB2 -XBD Voice-Related Components Trim Plate Plate Siemens Smart Infrastructure – Building Products –9– usa.siemens.com/fire Voice-Related Components – (continued) XDMC XDMC → Digital Message Card The Digital Message Card (Model XDMC) provides the capability of programming and sounding custom voice messages for Evacuation, Alert, Tornado Warning, System Testing and other emergency and non -emergency building notifications. Model XDMC, which serves as a Desigo Modular option module, plugs into an available expansion slot in the Model CC-2 / CC-5 card cage. Up to two (2) Model XDMC modules can be supported on a single Desigo Modular panel. Each Model XDMC can be programmed for up to 300 different custom messages. ALCC ALCC → Audio Level Conversion Card The Audio Level Conversion Card (Model ALCC) provides the capability of conducting a global-emergency page across multiple, remote Desigo Modular panels with each audio riser holding a maximum of 63 nodes. The emergency page originates at a Desigo Modular global paging station, where it is broadcast at 70VRMS over an audio riser, in conjunction with the 40W Amplifier Card, Model ZAC -40. FB-300 with FTS Remote Telephone Stations Remote telephone stations for the emergency telephone system consist of a handset-with-hook assembly; a wall - mounted back box, and a locked door with a breakable glass panel. Models FTS | FTS -P | FTS-C | FTS-CL | FTS-PLC Remote Telephone Stations consist of a ha ndset; a black plate; handset cradle with magnetic switch mounted to the back plate, and a connection cable from the handset to the back plate. The –P designates that a momentary, push-to -talk button is included in the handset. The –C designates that an armored cable is used in place of a coiled, retractable cord between the handset and the back plate. The –L designates that a LED is mounted to the back plate to indicate two -way contact is established between the telephone and Model FMT. The remote telephone station must be used with either remote telephone-station back box, Models FB-300 or FB-301S. Model FB-300 is used for flush -mount configurations, and Model FB-301S is used for surface-mount configurations. The remote station / back-box assembly also requires the Model F C-300S cover with key-lock door and breakable glass. FJ -304 Remote Telephone Jacks Remote Telephone Jacks, (Models F J -303 | FJ-303SS | FJ-304 | FJ-304SS) are connected to the emergency telephone system. The jacks are wired to the telephone zone circuits, via the Model TZC- 8B Telephone Zone Card located in the Desigo Modular system enclosure. There is no limit to the number of remote telephone jacks that can be connected to a single telephone zone circuit. The remote telephone jacks are mounted to a single - gang electrical box. Models FJ-303 and F J - 303SS have flying leads connected to the phone jack, while Models F J-304 and F J- 304SS have screw terminals. Models F J-303 and FJ-304 have a red- baked, enamel finish with a white silk- screened telephone handset icon, and Models FJ303SS and FJ-303SS have a brushed, stainless-steel finish with the handset icon. PFT-series Portable Firefighters’ Telephones Portable Firefighters’ Telephones (Models PFT and PFT-P) are available for field connection to the emergency telephone system. Each phone consists of a rugged, high - impact plastic handset with a red, coiled phone cord attached to the PFT. A 1/4" (0.64 cm.) phone-plug assembly is attached to the end of the phone cord for connection to the field-mounted phone jacks. Model PFT-P includes a momentary spring-action, push-to -talk switch mounted in the handset. Th e push- to -talk switch subsequently allows users to depress the button to activate the mouthpiece of the handset when speaking. The Model MTE-2 Telephone Enclosure includes the enclosure and door with clear lens, and can be used to store a maximum six (6) PFT or PFT-P telephone handsets in a locked cabinet. AIC → Audio Input Card The Audio Input Card (Model AIC) provides two (2) external, isolated analog inputs to the Desigo Modular fire-with-voice systems. Model AIC also provides two (2) dry-contact inputs, used to separately activate the two (2) audio inputs. The two (2) external, isolated analog inputs connect to the panel for functionality of external sources that use a TRS connector (e.g. – external handheld audio players | receivers; portable compact-disc players). Siemens Smart Infrastructure – Building Products –10– usa.siemens.com/fire Voice-Related Components – (continued) TZC-8B → Firefighters’ Telephone Zone Card The firefighters’ telephone zone card provides a way for emergency-response personnel located throughout a building to speak to one another during emergency situations. Model TZC-8B is a Desigo Modular option module that plugs into a Model CC-2 or CC-5 card cage, providing eight (8) firefighters telephone zones. The zones have an off-hook `acknowledge’ tone, as well as a command-console `busy’ tone. Each telephone zone uses a single pair of wires, and is individually supervised in a ‘Class B’ type mode. Field wires are connected to one or more phone jacks or stations. Zones are also individually power limited, per NEC 760, and each zone also contains transient protection. A maximum five (5) telephone stations may be off-hook simultaneously in a conferencing-line mode with no loss of audio quality. FMT → Replacement Glass Model FMT provides firefighters with an emergency telephone system for communication with remote locations. Model FMT mounts to the rear of the inner door of a Model CAB 1, Model CAB2, Model CAB3, or Model REMBOX4 Enclosure. Model FMT includes a handset for the operator of the telephone system. The firefighters’ telephone unit is designed for maximum performance in communication. The circuitry for Model FMT allows the master telephone and at least five (5) telephone stations to be off-hook simultaneously with no degradation of audio quality. Model FMT also supports a `warden’s page’ function, which allows live voice announcements from any remote telephone. Telephone zone call -ins are annunciated on the appropriate Model SCM-8 switch module. Remote stations receive an `Acknowledge’ tone when dialing into the command center prior to the call being answered, indicating a call -in in progress and a `busy’ tone if calling into the command center and anoth er telephone zone is already on line. Diagnostic LEDs are located on the back of Model FMT in order to simultaneously indicate power has been applied to the module, as well as failure of th e card, CAN communication or telephone. ZAC-40 → Zone Amplifier Card (40 Watt) Model ZAC-40 is a combination 40 -Watt, amplifier / speaker zone for use with Desigo Modular. Style `Y’, `Z’ or `A’ / `B’ speaker-zone wiring configurations are supported. Model ZAC-40 is power limited, and can be configured to provide 40 Watts of audio at 25VRMS or 70VRMS. Model ZAC-40 is a plug-in card that mounts in a Model CC-5 or CC-2 card cage. Model ZAC-40 is capable of amplifying any of the eight (8) digital audio channels that are transmitted from Model DAC-NET, via the Audio Serial Interface, Model ASI. Model ZAC-40 is supervised for functionality, and provides a single, 40 - Watt speaker zone that supports two (2) speaker circuits. Model ZAC -40 can be used for (1) one-to -eight (8) channel applications, or as a bulk amplifier for (1) one-or-two (2) channel applications ─ feeding high -level audio to Models ZIC - 4A and ZIC -8B. Model ZAC-40 can also be used for single-channel applications feeding high-level audio to Model HCP. ZAM-180 ZAM-180 → Zone Amplifier Module (180 Watt) Model ZAM-180 is a combination 180- Watt, amplifier / speaker zone for use with Desigo Modular. Style `Y’, `Z’ speaker-zone wiring is supported, as well as split-zone or (`A’ / `B’) speaker - zone-wiring configuration on Style `Y’. Model ZAM-180 can be configured to provide 150 Watts of audio at 25VRMS or 180 Watts of audio at 70VRMS. Model ZAM-180 mounts in one (1) module space directly on the back box or optional Model CAB-MP mounting plate. Model ZAM-180 is capable of amplifying any one (1) of the eight (8) digital-audio channels that are transmitted from Model DAC-NET (Digital Audio Card), via the digital audio bus: Model ASI (Audio Serial Interface). Model ZAM-180 amplifier is supervised for functionality. Model ZAM-180 can be used as a single 180 Watt speaker zone for (1) one-to-eight (8) channel applications or as a bulk amplifier for (1) one-or-two (2) channel applications feeding high -level audio to Model ZIC-4A or Model ZIC -8B. LPB → Local Page Board The Local Page Board (Model LPB) is used to connect the microphone ─ mounted inside the Live Voice Module (Model LVM) ─ and the voice-internal telephone system. Model LPB is a plug-on board to Model DAC-NET, and converts the two (2) analog input signals into the system’s internal digital format. Up to five (5) Model LVMs can be connected to Model LPB. Additionally, Model LPB provides one (1) analog output to connect to the monitor speaker, which is mounted inside Model LVM. The one (1) analog output is one (1) of eight (8) voice-internal audio channels selectable at the Modular panel. Siemens Smart Infrastructure – Building Products –11– usa.siemens.com/fire Voice-Related Components – (continued) DAC-NET → Digital Audio Card Model DAC-NET provides the audio source for the Desigo Modular Voice Evacuation System, as well as D -NET network communication to and from the Desigo Modular o perator interface and between enclosures. Model DAC-NET transmits eight (8) digital channels of audio, via two (2) pairs of wire. One (1) Model DAC-NET is required in each Desigo Modular enclosure. A maximum 32 Model DAC-NET cards are allowed on a single Desigo Modular panel. Model DAC -NET can be wired `Class A’ (Style 7 ) (four [4] pairs of wires) or `Class B’ (Style 4) (two [2] pairs of wires). Model DAC-NET card plugs into one (1) slot in the Model CC -5 or CC-2 card cage, and has on -board LEDs for system status and troubleshooting. Indication of power, communication, internal operation, ground fault, and trouble conditions are pro vided. Model DAC-NET Card contains an on -board microprocesso r that provides communication with switch modules, LED modules, microphone, telephone zone cards, and zone amplifiers across the Control Area Network CAN Bus. Model DAC-NET can supervise up to 99 CAN address modules, and contains on - board tones and pre-recorded EVAC and ALERT messages. Custom messages or tones can also be downloaded to Model DAC-NET using the Desigo Modular software tool, Zeus-D, for a total of five minutes of storage memory. LVM LVM → Live Voice Module Model LVM provides a supervised, high - quality and dynamic microphone as a means of sending live voice messages to specified audio zones. Model LVM mounts on the inner door of a Model CAB1, Model CAB2, Model CAB3 or remote lobby enclosure. Model LVM includes a microphone with a push -to - talk switch and retractable coiled cord. The micro phone and push-to -talk switch are fully supervised. Model LVM also provides a green pre- announce LED that indicates the pre - announce signal is active at the selected zones and a green ready to page LED, which indicates selected zones are ready to be paged. The pre-announce signal can be programmed as a tone or message and the duration is adjustable from 0 to 10 seconds in one-second increments. A built-in speaker with volume control allows the monitoring of the audio channels. The front panel of Model LVM contains six (6) switches and six (6) pairs of LEDs. Each pair contains one (1) dual-color (RED / GREEN) and LED. These switches can be programmed for manual voice functions as well as for generic system commands. When the switches are used as generic switches, all LEDs can be programmed for ON | OFF or FLASHING. Details for Ordering MODEL OR T YPE PART NUMBER PRODUCT AC-ADPT 500-633992 Technician Laptop-Power Connector AIC 500-035300 Audio-Input Card ALCC 500-650127 Audio-Level Conversion Card BCM 500-033320 Blank Control Module Plate [Four (4) per package] C900V2 S 54430-C 13-A 2 Dialer-Capture Ethernet Module CAB1 500-633007 Complete Single-Row Cabinet, black CAB1R 500-633728 Complete Single-Row Cabinet, red CAB1-TK 500-633013 Single-Row Trim-kit Cabinet, black CAB1R -TK 500-633729 Single-Row Trim-kit Cabinet, red CAB2-BB 500-633009 Two-Row Back Box, black CAB2-RB 500-634941 Two-Row Back Box, red CAB2-BD 500-633008 Two-Row Inner & Outer Door Set, black CAB2-R D 500-633755 Two-Row Inner & Outer Door Set, red MODEL OR TYPE PART NUMBER PRODUCT CAB2-TK 500-633014 Two-Row Trim-kit Cabinet, black CAB2R-TK 500-633753 Two-Row Trim-kit Cabinet, red CAB2-XBD 500-633768 CAB2 Transponder Door CAB2-XRD 500-633792 Medium-Enclosure Transponder Door [mounts to Model CAB2-RB] CAB3-BB 500-633011 Three-Row Back Box, black CAB3-RB 500-634942 Three-Row Back Box, red CAB3-BD 500-633010 Three-Row Inner & Outer Door Set, black CAB3-RD 500-633757 Three-Row Inner & Outer Door Set, red CAB3-TK 500-633015 Three-Row Trim-kit Cabinet, black CAB3R-TK 500-633754 Three-Row Trim-kit Cabinet, red CAB3-XBD 500-633769 CAB3 Transponder Door CAB3-XRD 500-633793 Large-Enclosure Transponder Door [mounts to Model CAB3-RB] CAB-MP 500-633012 Module Mounting Plate CAB-55- BRKT S 54430-B1 -A 1 Bracket to hold down 55AH batteries in CAB-BATT enclosure CAB-100- BRKT S 54430-B2 -A 1 Bracket to hold down 100AH batteries in CAB-BATT enclosure CCL 599-634214 CAN Cable 3 ft. (91.4 cm.) Length required for: SCM / LCM / FCM modules from Models CC- 5 / CC-2 Inner Doors, and from row-to-row on Model CAB-series Inner Doors CC-2 500-633440 Two-Slot Card Cage CC-5 500-633037 Five-Slot Card Cage CDC-4 500-034200 Conventional Detector Card COM-BRK S 54430-B7 -A 1 Communications Bracket CRC-6 500-033250 Controllable Relay Card CSB 500-033150 CAN Sounder Board DAC-NET 500-035100 Digital Audio Card DCT-P 500-699291 MDACT Programmer EN CL-01 S 54465-C 63 -A 1 SNU Enclosure (w/ key-lock) FB-300 500-680587 Remote Telephone Stations FCM-6 500-033140 Fan-Control Module Switches [ON | OFF | AUTO] FCM2041 -U2 S 54430-C 17 -A 1 Operator Interface for Desigo Fire Safety Modular FJ-304 500-692670 Remote Telephone Jacks FMT 500-034100 Fireman’s Main Telephone Details for Ordering NOT ICE – The information contained in this data -sheet document is intended only as a summary, and is subject to change without notice. The product(s) described here has/have a specific instruction sheet(s) that cover various technical, limitation and liability information. Copies of install-type, instruction sheets – as well as the General Product Warning and Limitations document, which also contains important data , are provided with the product, and are available from the Manufacturer. Data contained in the aforesaid type of documentation should be consulted with a fire-safety professional before specifying or using the product. Any further questions or assistance concerning particular problems that might arise, relative to the proper functioning of the equipment, please contact the Manufacturer. Details for Ordering – (continued) MODEL OR TYPE PART NUMBER PRODUCT GPMI-3 S 54430-C 25 -A 1 Global Operator Interface (v3) GPMI- HW-KEY S 54430-C 22 -A 1 Hardware key for Modular Global Operation HCP 500-034860 Intelligent Control Point HL IM 500-033170 Line Isolator Module ID-MP 500-633027 Inner-Door Enclosure Mounting Plate [four (4) per package] ID-SP 500-633028 Single-Door Inner-Door Enclosure Mounting Plate [two (2) per package] IIC 500-850328 Interface Isolation Card LCM-8 500-033100 LED Annunciator Module [ON | OFF | AUTO] LPB 500-035200 Local Page Board LVM 500-034090 Live Voice Module MDACT 500-699254 Multi-Point Digital Alarm Communication Transmitter MLC S 54431-B4 -A1 MXL Addressable- Device Line Card NIC-C 500-033240 Network Interface Card NRC S 54430-A2 -A1 Network Ring Card: 2nd Generation PMI-1 UPLD- CBL S 54430-A4 -A1 Serial Adapter Cable for USB-to-serial- converter connection between single-node upload assemblies and 1st - version central processors PS-5A 500-492369 Aux (5V) Power Module PSC-12 500-033340 Power Supply Charger PSC-IS0- CBL S 54430-K4-A 1 Optional Cable Extender (for use with two [2} Model PSC-12s PSX-12 500-034120 12A Pwr. Supply Extender PTB 500-033390 Pwr. Termination Board MODEL OR T YPE PART NUMBER PRODUCT SCM-8 500-033040 Switch Module (eight [8] switches) SIM-16 500-034060 Supervised Input Module SNU-ASSY S 54430-A3 -A 1 SNU Processor with USB cables (w/ SNU IOM) SNU-KIT S 54430-C19-A1 Single-Node Upload (SNU) Kit SSD 500-034170 System-Status Display SSD-C 500-648733 System-Status Display with control SSD-INT 500-034740 System-Status Display [w/ multi-lingual overlays] SSD-C-INT 500-034750 System-Status Display with control [w/ multi-lingual overlays] SSD-C-REM 500-634773 System-Status Display w/ control [for remote lobby enclosure] TZ C-8B 500-034110 Firefighter’s Telephone Zone Card VESDA- HL I-KIT S 54430-F99-A2 VESDA High-Level Interface Kit VNTPC 500-650490 Virtual Network Tunnel VPM S 54430-F9 3-A2 VESDA Peripheral Module VPM-MP S 54430-F9 5-A2 Mounting Plate for the VESDA Peripheral Module ZAC-40 500-035400 40W Zone-Amplifier Card ZAM-180 500-035600 180W Zone-Amp. Card XDACT- ASSY S 54430-A5-A1 XDACT Mounting Plate (with cable) XDLC S 54430-B8-A1 Device Loop Card XDMC S 54430-B5-A1 Digital Message Card MODEL OR TYPE PART NUMBER PRODUCT XLS-EXT-CABLE-PKG S 54430-K1 -A1 5 ft. (1.5m) 60-pin cable 5 ft. (1.5m) CAN cable Long ground-strap cable XLS-MLE6-ADPT S 54430-C9 -A1 MLE-6 Enclosure Adapter, black XLS-MLE6R-ADPT S 54430-C9-A 2 MLE-6R Enclosure Adapter, red XLS-MME3-ADPT S 54430-C8 -A1 MME-3 and MBR-2 enclosure adapters, black XLS-MME3R-ADPT S 54430-C8 -A2 MME-3 and MBR-2 encl. adapters, red XLS-MSE2-ADPT S 54430-C7 -A1 MSE-2 enclosure adapter, black XLS-MSE2R-ADPT S 54430-C7 -A2 MSE-2 enclosure adapter, red XLS-MSE3-ADPT S 54430-C 14-A1 MXL-IQ | MSE-3L & MSE- 3M enclosure adapters, black XLS-MSE3R-ADPT S 54430-C 14-A2 MXL-IQ | MSE-3L & MSE-3M enclosure adapters, red XLS-RCC1-ADPT S 54430-Z 14-A1 RCC-1 enclosure adapter, black XLS-RCC13F-ADPT S 54430-Z13-A1 RCC-1F | RCC-3F enclosure adapter, black XLS-RCC13FR-ADPT S 54430-Z13-A 2 RCC-1F | RCC-3F enclosure adapter, red ZIC-2C 500-648671 Two-Channel Adapter Card (via Model ZIC-8B) ZIC-4A 500-033050 Four -Circuit-Zone Indicating Card ZIC-8B 500-648670 Eight-Circuit-Zone Indicating Card Desigo® Fire Safety Siemens Industry, Inc. Smart Infrastructure - Building Products 8 Fernwood Road • Florham Park, NJ 07932 Tel: (973) 593-2600 August - 2020 (Rev. 6) Siemens Data Sheet 7350 Smart Infrastructure – Building Products usa.siemens.com/fire Product Overview The Operator Interface (OI), Model FCM2041-U2, is the central processor and user interface for each Desigo Fire Safety Modular (Desigo Modular) system. Model FCM2041-U2 provides straightforward, front-end access for an end-user to perform system tasks, such as: acknowledge events; control addressable points (e.g. – intelligent detectors | notification appliance circuits [NACs]), and reset the system. In terms of hardware used for Desigo Modular, Model FCM2041-U2 Operator Interfaces can be mounted in full-size CAB1 | CAB2 | CAB3 enclosures. Additionally, remote, multi-module-mounted enclosures for Desigo Modular, Models REMBOX2 and REMBOX4, can each house one (1) Model FCM2041-U2 OI. It is through the custom-configuration software tool, Zeus-D, that Model FCM2041- U2 OIs are able to provide programmed logic and panel supervision . Specifications Each Desigo Modular Operator Interface contains a full liquid-crystal display (LCD) at the front end. An audible sounds from a Model FCM2041-U2 operator interface when there are unacknowledged events. The display is surrounded by keys that are used to control the displayed information and to navigate through these screens. Keys are also readily available in order for the end user to obtain help information, as well as to enter into the menu features of a Model FCM2041-U2 OI. Desigo® Fire Safety Modular system Operator Interface Model FCM2041-U2 Model FCM2041-U2 Operator Interface Unit mounted in a Model CAB1 enclosure Architect & Engineer Specifications  Main-operator interface with user- prompted lighted, large buttons for system control, operating sequence  Large, 6-inch (15.2 cm) color display  Touch-screen driven, system-control menus - Context-sensitive `Help’ button - Navigation buttons and `More Info’ - Additional tabs , including queues for mass notification (MNS)  Go-to-beginning; go-to-end queue buttons  Front-end light-emitting diodes (LEDs) for `Alarm’ | `Supervisory’ | `Trouble’ commands - Partial-system disable LED - Audible Status LEDs (ON and Silenced)  Global annunciation and control capability  Integrated slots for switch-control (Model SCM-8) and LED-control (Model LCM-8) modules  Mounts in any of one (1) of the following enclosures: - Model CAB1 (smallest cabinet) - Model CAB2 (medium cabinet) - Model CAB3 (largest cabinet) - Model REMBOX2 (two-module remote enclosure) - Model REMBOX4 - (four-module remote enclosure)  40 software-programmable `User Macro’ switches  UL864 & CAN / ULC-S576 Listed - File S24304, Vol. 3 Additional diagnostic displays can be found at the back end of each Model FCM2041-U2 to provide efficiency to the end -user in troubleshooting the Desigo Modular fire-alarm control panel (FACP). A 40-inch (1.02m) long 60-pin wire cable, P/N 555-133743, is used to connect a Desigo Modular Operator Interface, Model FCM2041-U2 to the Siemens five - slot card cage, Model CC-5. Slide-in labels are orderable under a single part number for applications that require French (Canadian) | Spanish | Portuguese- Brazilian text. NOTE: Alternate-language labels are ordered separately. Siemens Smart Infrastructure – Building Products –2– usa.siemens.com/fire Operation In normal | standby condition, a Model FCM2041-U2 OI displays the site-specific, customized message; the time and date, and a rundown of the system status. When an event occurs in the system, the display enters the `Alert’ mode. The event is displayed, the local audible sounds, and the tab on the display for the corresponding event queue flashes. If the system-event type is `Alarm’ | `Trouble’ | `Supervisory’, the appropriate LED blinks. If the event caused notification appliances to sound the `Audibles On’ indicator illuminates. At the bottom of the screen, an `Acknowledge’ button is subsequently displayed. Pressing this button acknowledges the event and silences the local audible. Once a ll events are acknowledged, a reset button becomes available in the lower right side of the display. If notification appliances are active, two (2) additional buttons appear at the bottom of the screen. These buttons subsequently allow the operator to silence or unsilence the notification appliances. When the notification appliances are silenced , the `Audibles Silenced’ LED illuminates. The system can only be reset with the notification appliances silenced. Up to five (5) events can be displayed at a time. For Canadian operation, nine (9) events are shown. When more than five (5) events are present, the up-and-down arrow keys allow the user to vertically scroll the list of events. A progress meter on the side of the list indicates the size of the list of events and the location in the list. New, ‘unacknowledged’ events are indicated by a flashing exclamation point (!). Once acknowledged, the exclamation point changes to a checkmark (✓). Pressing the `More Info’ button will display a screen showing details relating to the selected event. Other buttons also appear at the bottom of this screen. There is an expanded text message available , as well as a selection to show all of the devices associated with the event that are active. The operator can return to the previous screen by pressing the ESC button. NOTE: Refer to installation manual: P/N – A6V11231622 for the most detailed information on the Desigo Modular Operator Interface. Model FCM2041-U2 Desigo Modular Operator Interface Slide-in tab to apply corresponding label (for non-English text) Slide-in tab to apply corresponding label (for non-English text) NOTE: Alternate-language labels are orderable under a single part number, S54430-C16-A1. NOTICE – The information contained in this data -sheet document is intended only as a summary, and is subject to change without notice. The product(s) described here has/have a specific instruction sheet (s) that cover various technical, limitation and liability information . Copies of install-type, instruction sheets – as well as the General Product Warning and Limitations document , which also contains important data , are provided with the product, and are available from the Manufacturer. Data contained in the aforesaid type of documentation should be consulted with a fire-safety professional before specifying or using the product. Any further questions or assistance concerning particular problems that might arise, relative to the proper functioning of the equipment, please contact the Manufacturer. Temperature and Humidity Range Desigo Modular Operator Interfaces are UL Listed | ULC Listed. Environmental operating conditions for each Model FCM2041-U2 operator interface is 32ºF (0ºC) to 120ºF (49ºC) with a relative humidity of no greater than 95%, non-condensing. Electrical Ratings MODEL OR TYPE PART NUMBER PRODUCT FCM2041-U2 S54430-C17-A1 Desigo Modular Operator Interface INPUT POWER: 24V Back Plane Current 195μA Screw Terminal 24V Current 0 6.2V Back Plane Current 0 24V Standby Current 125μA OUTPUT POWER: Each HNET / XNET - and - CAN Network Pair 8V peak-to-peak, max. 75μA, max. (during message transmission) Details for Ordering Desigo® Fire Safety Siemens Industry, Inc. Smart Infrastructure - Building Products 8 Fernwood Road • Florham Park, NJ 07932 Tel: (973) 593-2600 July - 2019 (Rev. 1) THIS PAGE INTENTIONALLY LEFT BLANK FOR DUPLEX PRINTING Siemens Data Sheet 7312 Building Technologies Division usa.siemens.com/desigo-fire-safety Product Overview The Siemens – Fire Safety `Class X’ Device Loop Card (Model XDLC) is the interface used for connecting Siemens addressable, intelligent `X’ as well as `H’-series devices. Each Model XDLC plugs into one (1) slot of the Model CC-2 or Model CC-5 card cage. Programming for Model XDLC is accomplished via the Desigo Fire Safety Modular system custom-configuration tool, Zeus-D. Model XDLC takes one (1) address on the network, communicating up to a total 252 detectors and devices. Model XDLC has 16 LEDs for diagnostic purposes, and provides ground-fault detection and zone- isolation circuitry. Specifications The `Class X’ Device Loop Card (Model XDLC) initializes, ope rates and maintains all devices residing on up to four (4) `Class A’, eight (8) `Class B’ addressable circuits. Model XDLC communicates all relevant device and event data (`Alarm’, `Trouble’ and `Supervisory’ commands) to a Desigo Fire Safety Modular (Desigo Modular) fire-alarm control panel (FACP), and supervises the device loop circuit. Model XDLC is polarity insensitive via SureWire technology, which greatly reduces commissioning time normally spent tracing down crossed-field wiring. Model X DLC communicates detector data, such as sensitivity of intelligent fire detectors and logic- function information, to the Desigo Modular Operating Unit (Model FCM2041-U2), which is located within a given Desigo Modular system. Each device loop card supports four (4) `Class A’, eight (8) `Class B’ circuits for up to a total of 252 addressable devices – as well as relay and audible bases, remote lamps and duct-detector housings in any combination. The microprocessor in a Model XDLC controls the on-board isolation, in case there is a fault (short) in any of the circuits, thus allowing the other circuit to continue operating. For continuous protection, the on-board microprocessor continues to operate even in the event of a CPU failure. NOTE: Refer to installation manual: P/N – A6V101040156 to ensure Model XDLC compatibility with the Siemens FACPs intended for use in the given application . Desigo® Fire Safety Modular system Device Loop Card Model XDLC Architect & Engineer Specifications  Supports up to 252 addressable points  Operates and maintains all devices residing on up to four (4) `Class A’, eight (8) `Class B’ addressable circuits  Compatible with Siemens intelligent, addressable ‘X’ and ‘H’-series devices: - Multi-criteria / Carbon Monoxide (CO) Detector with ASAtechnologyTM - Multi-criteria Detector with ASAtechnologyTM - Multi-criteria Detector - Thermal (Heat) Detector - Input / Output Interface Module  Polarity insensitive (in non-isolation mode) via SureWire™ technology: - Modern technology supports comprehensive system and interface communication  Quantity 16 diagnostic light-emitting diodes (LEDs) for easy circuit diagnosis  Microchip controls on-board isolators  Device Programmer / Tester (Model DPU) programs and verifies device’s address: - programming capabilities include testing a duct detector, as well as other Siemens addressable devices  Supports `Class B’ | `Class A’ | `Class X’ wiring  Supports T-Tapping  Degrade mode  UL864 | CAN / ULC Listed Model XDLC d Side View Model d XDLC d Front View NOTICE – The information contained in this data-sheet document is intended only as a summary, and is subject to change without notice. The product(s) described here has/have a specific instruction sheet(s) that cover various technical, limitation and liability information. Copies of install-type, instruction sheets – as well as the General Product Warning and Limitations document, which also contains important data, are provided with the product, and are available from the Manufacturer. Data contained in the aforesaid type of documentation should be consulted with a fire-safety professional before specifying or using the product. Any further questions or assistance concerning particular problems that might arise, relative to the proper functioning of the equipment, please contact the Manufacturer. MODEL OR T YPE PART NUMBER PRODUCT XDLC S54430-B8-A1 `Class X’ Device Loop Card Temperature and Humidity Range `Class X’ Device Loop Cards are UL Listed | ULC Listed for indoor dry locations within a temperature range of 120 +/-3°F (49 +/-2°C) to 32 +/-3°F (0 +/-2°C) and a relative humidity of 93 +/-2% at a temperature of 90 +/-3°F (32 +/-2°C). Technical Data xx 24V CURRENT DRAW: [Back Plane] 0 24V CURRENT DRAW: [Screw Terminal] 100mA + 1.4mA per device 6.2V CURRENT DRAW: [Back Plane] 1mA, max. 24V CURRENT DRAW: [Standby] 100mA + 1.4mA per device DEVICE L OOP: [@ 30 VDC Max.] 500mA, max. (power limited) Desigo® Fire Safety Siemens Industry, Inc. Building Technologies Division 8 Fernwood Road • Florham Park, NJ 07932 Tel: (973) 593-2600 August 2018 ─ Supersedes sheet dated 10/2017 (Rev. 2 ) Details for Ordering Model XDLC- Diagram of an `Class X’ Device Loop Card mounted to a Siemens Card Cage Siemens Data Sheet 7327 Building Technologies Division usa.siemens.com/desigo-fs-modular Desigo® Fire Safety Modular Enclosures and Equipment Models: BCM | CAB1 | CAB-BATT/-R | CAB-MP | CAB2-BB | CAB2-BD | CAB2-XBD | CAB2-XRD | CAB3-BB | CAB3-BD | CAB3-XBD | CAB3-XRD | ID-MP | ID-SP | OD-BP | OD-GP | OD-LP | REMBOX2 | REMBOX4 | XLS-MLE6-ADPT | XLS-MME3-ADPT | XLS-MSE2- ADPT | XLS-MSE3-ADPT –and– XLS-RCC13F-ADPT Model CAB1- One -row system enclosure Architect & E ngineer S pecif ica tions  One (1) | two (2) | three (3) row enclosure types  Blank plates (ordered separately) for inner and outer doors  Clear lens and grill plates (sold separately) for use with outer door  UL 864 Listed, ULC Listed; FM (#3010), CSFM (#7272 -0067:0222) and NYCFD (#6160) Approved Product Overview The enclosures used with Desigo Fire Safety Modular systems (Models CAB1, CAB2, and CAB3), along with their accessories, provide a complete set of hardware for mounting all main system and remote transponder cards and modules. The hardware allows each DSFM system to be configured for a wide variety of applications. Included in the enclosure series are backbox and door sets; removable mounting plates and clear lenses; louvered ventilation grill plates, and blank plates for use with the enclosure doors. All enclosures come with ground straps for the inner and outer doors; shield termination lugs; grounding lugs, and tie wrap lances for securing wire. All enclosures can also mount system backup batteries up to 31AH in capacity. Model CAB2- [with mounted optional inner door] Model CAB3- [with mounted optional inner door] Model REMBOX 4- Model REMBOX 2- Siemens Building Technologies Division –2– usa.siemens.com/desigo-fs-modular Enclosures | Doors | Plates Single-Row Enclosure Model CAB1, the smallest of the Desigo Fire Safety Modular system enclosures, can house a single Model CAB-MP cabinet mounting plate for mounting card cages, power supplies and bulk amplifiers. Model CAB1 also has four (4) mounting slots on the inner door for mounting an Operator Interface (OI) and Model ID-MP switch module brackets. Each Model CAB1 comes complete with a black back box, with black inner and outer doors, a single lock- and-key set on the outer door, and a single OD-LP outer door lens plate (installed). A red version (Model CAB1R) is also available. Approximate size is 27" (68.6cm.) high; 26" (66cm.) wide, and 8" (20.3cm.) deep. Two-Row Enclosure Model CAB2 is the mid-sized Desigo Fire Safety Modular enclosure capable of housing a maximum two (2) Model CAB-MP cabinet mounting plates. The inner door has two (2) rows of four (4) mounting slots. The outer door has space for mounting two (2) outer door plates (Models OD-LP, OD- BP or OD-GP). The outer door can be configured to open from either side. Model CAB2 consists of the Model CAB2-BB back box; the Model CAB2- BD black inner and outer door package, and one (1) Model OD-LP lens plate. The outer door has a single lock and key set installed. Red doors are available in Model CAB2- RD. Additional door mounting plates must be ordered separately. Approximate size is 45" (114.3cm.) high, 26" (66cm.) wide, and 8" (20.3cm.) deep. Three-Row Enclosure Model CAB3, the largest single Desigo Fire Safety Modular enclosure available, can house a maximum three (3) Model CAB-MP cabinet mounting plates in the enclosure, and three (3) rows of inner door mounting slots. The outer door can be configured to open from either side. Model CAB3 consists of the Model CAB3-BB back box; the Model CAB3-BD black inner and outer door package, and one (1) Model OD-LP lens plate. The outer door has two (2) locks and key sets installed. Red doors are available via Model CAB3-RD. Additional door mounting plates must be ordered separately. Approximate size is 63" (160cm.) high, 26" (66cm.) wide, and 8" (20.3cm.) deep. Enclosure Trim Kits Trim kits are available for all system enclosures for semi-flush mounting applications. Model CAB1-TK (for black enclosures) and Model CAB1R-TK (for red enclosures) fit Models CAB1 and CAB1-R enclosures. Similarly, Models CAB2-TK and CAB2R-TK fit the Model CAB2 enclosure, and Models CAB3-TK and CAB3R-TK fit the Model CAB3 enclosure. CAB2-XBD- CAB3-XBD- Remote Transponder Doors The Desigo Fire Safety Modular system can use remote transponders for mounting additional modules such as amplifiers, without requiring an Operator Interface (OI) or any control switches. Special doors are available for systems using Model CAB2 or Model CAB3 remote transponders. Models CAB2-XBD and CAB3-XBD omit the unused inner door and come complete with ventilation louvers built into the door. Model CAB2-XBD comes in black, and fits specifically on Model CAB2-BB. Model CAB3-XBD also comes in black, and fits specifically on Model CAB3-BB. Remote transponder doors are also orderable in red: Models CAB2- XRD and CAB3-XRD. Model OD-GP- Outer-Door Grill Plate Model OD-GP also covers an entire row on the outer door of a system cabinet, but has four rows of ventilation louvers on it. Model OD- GP is mounted in front of system bulk amplifiers, card amplifiers, or other modules that generate heat. Using Model OD-GP will permit airflow across these modules to aid in heat dissipation. A single grill plate is included with each Model OG-GP. Remote System Enclosures Models REMBOX2 and REMBOX4 are Desigo Fire Safety Modular system enclosures that are used for remotely mounting inner-door modules, such as the Desigo Modular OI, Model SCM-8, Model LCM-8 and Model FMT. REMBOX4 hardware used with Desigo Fire Safety Modular systems are thinner than the regular CAB enclosures, just 5" (12.7cm.) deep overall, and are perfect for mounting in places where space is limited (such as lobbies or behind a receptionist’s desk). Due to their smaller depth, no card cages, power supplies or bulk amplifiers can be mounted in a given REMBOX. However, modules such as the Remote Network Interface Module (Model RNI); the Output-Control Module (Model OCM-16) and the Supervised Input Module (Model SIM- 16) can be mounted in a REMBOX. Due to the depth of the Live Voice Module (Model LVM) and the Model FMT firefighters’ master telephone, no Model OCM-16 or Model SIM-16 modules can be used simultaneously with Model LVM or Model FMT. Models REMBOX2 and REMBOX4 are designed for flush mounting with no trim kit required. Both enclosures also come with a clear lens plate on the cover. Siemens Building Technologies Division –3– usa.siemens.com/desigo-fs-modular Enclosures | Doors | Plates – (continued) REMBOX2 -REMBOX2- (with doors closed) (with doors open) Two-Module Remote Enclosure Model REMBOX2 has two (2) inner-door module spaces, and can hold on Desigo Modular OI, up to two (2) switch-module brackets, one (1) Model LVM. Combinations are permissible. Model REMBOX2 can also mount a single Model RNI on a bracket included in the backbox. A bracket (Model REMBOX2-MP) can be used to mount up to four (4) Model OCM-16s or Model SIM-16 enclosures. Model REMBOX2-MP must be purchased separately. Approximate size of Model REMBOX2 is 14-1/2" (36.8cm.) wide, 18-1/2" (47cm.) high and 5" (12.7cm.) deep. NOTE: A red, (2) two -module remote lobby enclosure (Model REMBOX2R) is also available. Model REMBOX4- Four-Module Remote Enclosures Model REMBOX4 has space for mounting four (4) inner door modules. Any combination (two-module spaces), switch module brackets, Model LVM or Model FMT (one-module space each) on a Desigo Modular OI can be used. Unused module spaces can be covered with Model ID-SP blank plates. Model CAB-MP- Cabinet Mounting Plate The cabinet mounting plate (Model CAB-MP) provides mounting for a single row of modules in a Desigo Modular system cabinet. Four (4)- module spaces are available on Model CAB-MP. Model CAB-MP is used to mount the Model CC-5 card cage, the Model CC-2 card cage, the Model PSC- 12 power supply, the Model PSX-12 power supply extender, and the Model ZAM-80 / 180 zone amplifiers. Model ID-MP- Inner-Door Mounting Plate The inner door mounting plate (Model ID-MP) is mounted on the inner door of a CAB enclosure. Model ID-MP plates are used to mount Model SCM-8 switch control modules; Model LCM-8 LED control modules, or with Model FCM-6. Four (4) mounting plates are included in each Model ID-MP. Each mounting plate has four (4) spaces for control modules, and can hold either four (4) Model SCM-8 modules {one [1] control module space each}; four (4) Model LCM-8 modules {one [1] control module space each}; or two (2) Model FCM-6 modules {two [2] module spaces each}. Combinations are also allowed. Blank spaces in Model ID-MP can be covered using the Model BCM blank control module plate. A maximum four (4) Model ID-MP plates can be mounted in a single row on the inner door. Model ID-SP- Inner-Door Single Blank Plate Model ID-SP is used to cover any single module blank spaces on the inner door not used to mount a Desigo Modular OI or one (1) Model ID- MP. Up to four (4) Model ID-SP plates can be mounted in a single row on the inner door. Two (2) blank plates are included in each Model ID-SP. Model XDACT-ASSY- Class X Assembly Plate The XDACT Assembly (Model XDACT-ASSY) is the blank plate used for holding the optional Digital Alarm Communication Transmitter (DACT), Model FCA2015-U1. The XDACT assembly vertically mounts on the back, left-hand side of an inner door of any type of Desigo Modular panel, adjacent to an Operator Interface (0I). Model BCM- Blank Control Module Plate Model BCM is used on Model ID- MP to cover any blank areas where control modules are not used. A maximum four (4) Model BCM plates can be mounted on a single Model ID-MP. Four (4), blank-module plates are included in each Model BCM. Outer Door Lens Plate Model OD-LP is a clear plastic lens plate mounted on the outer door of a system cabinet. Model OD-LP is used to allow operators to see the system interface and controls mounted on the inner door, but restricts access to unauthorized users. Model OD-LP covers an entire row on the outer door. A single lens plate is included with each Model OD-LP. REMBOX2 (with doors closed) Siemens Building Technologies Division –4– usa.siemens.com/desigo-fs-modular Enclosures | Doors | Plates – (continued) -Model OD-BP- Outer Door Blank Plate The Outer Door Blank Plate (Model OD-BP) is used to cover an entire row of a Desigo Modular system cabinet. Model OD-BP is mounted when no module is used in that location. Model OD-BP is mounted on the outer door, and one (1) blank plate is included with each order. MME-3–series Enclosure Adapters Model XLS-MME3-ADPT, which must be used in conjunction with Model CAB-MP plates, is an adapter that allows Desigo Modular cards to be mounted in older-generation MXL Model MME-3–series or Model MBR-2 medium black enclosures. Model XLS-MME3R-ADPT, which must be used in conjunction with Model CAB-MP plates, is an adapter that allows Desigo Modular cards to be mounted in older-generation MXL Model MME-3R medium red enclosures. MSE-3–series Enclosure Adapters Model XLS-MSE3-ADPT is an adapter that allows Desigo Modular cards to be mounted in older-generation MXL-IQ Model MSE-3L or Model MSE-3M black enclosures. Model XLS-MSE3R-ADPT is an adapter that allows Desigo Modular cards to be mounted in older-generation MXL-IQ Model MSE-3LR or Model MSE-3MR red enclosure. RCC13-series Enclosure Adapters Model XLS-RCC13F-ADPT is an adapter that allows the Desigo Modular Model SSD/-C series remote annunciator to be mounted in older-generation Model RCC- 1F or Model RCC-3F black, flush-mount enclosure. Model XLS-RCC13FR-ADPT is an adapter that allows the Model SSD/-C series to be mounted in older-generation RCC-1F R and RCC-3FR, red flush-mount enclosure. RCC-1–series Enclosure Adapters Model XLS-RCC1-ADPT is an adapter that allows the Desigo Modular Model SSD/-C series remote annunciator to be mounted in older-generation Model RCC-1 surface- mount enclosure. Remote Transponders Desigo Modular systems can use remote transponders for mounting additional modules such as amplifiers without requiring a Desigo Modular operator interface or any control switches. Special doors are available for systems using Model CAB2 or Model CAB3 remote transponders. These doors (Models CAB2-XBD and CAB3-XBD) omit the unused inner door, and come complete with ventilation louvers built into the door. Special doors are available for systems using Model CAB2 or Model CAB3 remote transponders. These doors (Models CAB2-XBD and CAB3-XBD) omit the unused inner door, and come complete with ventilation louvers built into the door. Enclosure Trim Kits Trim kits are available for all Desigo Modular system enclosures for semi-flush mounting applications. Model CAB1-TK (for black enclosures) and the Model CAB1R- TK (for red enclosures) fit inside the Models CAB1 and CAB1R enclosures. Similarly, Models CAB2-TK and CAB2R-TK fit inside the Model CAB2 enclosure, while Models CAB3-TK and CAB3R-TK fit the Model CAB3 enclosure. Outer Door Inner Door Adapter Plate Outer Door Inner Door Adapter Plate Trim Plate Plate Trim Plate Plate Siemens Building Technologies Division –5– usa.siemens.com/desigo-fs-modular Details for Ordering MODEL OR TYPE PART NUMBER PRODUCT BC M 500-033320 Blank Control Module Plate [Four (4) per package] CAB1 500-633007 Complete Single -Row Cabinet, black CAB1 R 500-633728 Complete Single -Row Cabinet, red CAB1 -TK 500-633013 Single-Row Trim-kit Cabinet,, black CAB1 R -TK 500-633729 Single-Row Trim-kit Cabinet, red CAB2-BB 500-63300 9 Two-Row Back Box , black CAB2-R B 500-634941 Two-Row Back Box , red CAB2-BD 500-63300 8 Two-Row Inner & Outer Door Set, black CAB2-R D 500-633755 Two-Row Inner & Outer Door Set , red CAB2-TK 500-633014 Two-Row Trim-kit Cabinet, black CAB2R -TK 500-633753 Two-Row Trim-kit Cabinet, red CAB2-XBD 500-633768 CAB2 Transponder Door CAB2-XR D 500-633792 Medium-Enclosure Transponder Door [mounts to Model CAB2-RB] CAB3-BB 500-633011 Three-Row Back Box, black CAB3-R B 500-634942 Three-Row Back Box, red CAB3-BD 500-633010 T hree-Row Inner & Outer Door Set, black CAB3-R D 500-633757 T hree-Row Inner & Outer Door Set , red CAB3-TK 500-633015 Three-Row Trim-Kit Cabinet, black CAB3R -TK 500-633754 Three-Row Trim-Kit Cabinet, red CAB3-XBD 500-633769 CAB3 Transponder Door CAB3-XR D 500-633793 Large-Enclosure Transponder Door [mounts to Model CAB3-RB] MODEL OR TYPE PART NUMBER PRODUCT CAB-MP 500-633012 Module Mounting Plate CAB-55- BRKT S 54430 -B1- A1 Bracket to hold down 55AH batteries in CAB-BATT enclosure CAB-100- BRKT S 54430 -B2- A1 Bracket to hold down 100AH batteries in CAB-BATT enclosure ENC L-01 S 54465-C 63- A1 SNU Enclosure (with key -lock) ID-MP 500-633027 Inner-Door Enclosure Mounting Plate [four (4) per package] ID-SP 500-633028 Single-Door Inner- Door Enclosure Mounting Plate [two (2) per package] OD-BP 500-63301 7 Outer Door Blank Plate, black OD-BP -R 500-634919 Outer Door Blank Plate, red OD-GP 500-633018 Outer Grill Plate, black OD-GP-R 500-634920 Outer Grill Plate, red OD-LP 500-633016 Outer Door Lens Plate REMBOX2 500-633772 (2) Two-module remote lobby enclosure, black REMBOX2R 500-650612 (2) Two-module remote lobby enclosure, red REMBOX2- MP 500-634211 Mounting plate for Models OCM-16 / SIM-16 in Model REMBOX2 REMBOX4 500-633914 (4) F our-module remote lobby enclosure, black REMBOX4R 500-65061 3 (4) F our-module remote lobby enclosure, red REMBOX4- MP 500-63421 2 Mounting plate for Models OCM-16 / SIM-16 in Model REMBOX4 MODEL OR TYPE PART NUMBER PRODUCT XDACT-ASSY S54430 -A 5-A1 XDACT Mounting Plate (with cable) XLS-MLE6- ADPT S54430 -C9 -A1 MLE-6 Enclosure Adapter, black XLS-MLE6R- ADPT S54430 -C9 -A2 MLE-6R Enclosure Adapter, red XLS-MME3- ADPT S54430 -C8 -A1 MME-3 and MBR-2 enclosure adapters, black XLS-MME3R- ADPT S54430 -C8 -A2 MME-3 and MBR-2 encl. adapters, red XLS-MSE2- ADPT S54430 -C7 -A1 MSE-2 enclosure adapter, black XLS-MSE2R- ADPT S54430 -C7 -A2 MSE-2 enclosure adapter, red XLS-MSE3- ADPT S54430-C14-A1 MXL-IQ | MSE-3L & MSE-3M enclosure adapters, black XLS-MSE3R- ADPT S54430-C14-A2 MXL-IQ | MSE-3L & MSE-3M enclosure adapters, red XLS-RCC1- ADPT S54430-Z14-A1 RCC-1 enclosure adapter, black XLS-RCC13F- ADPT S54430-Z 13-A1 RCC-1F | RCC-3F enclosure adapter, black XLS-RCC13FR- ADPT S54430-Z 13-A2 RCC-1F | RCC-3F enclosure adapter, red Details for Ordering – (cont.’d) Details for Ordering – (cont.’d) NOT ICE – The information contained in this data -sheet document is intended only as a summary, and is su bject to change without notice. The product(s) described here has/hav e a specific instruction sheet (s) that cover various technical, limitation and liability information . Copies of install -type, instruction sheets – as well as the General Product Warning and Limitations document , which also contains important data , are provided with the product, and are available from the Manufacturer. Data contained in the aforesaid type of documentation should be consulted with a fire-safety professional before specifying or using the product. Any further questions or assistance concerning particular problems that might arise, relative to the proper functioning of the equipment, please contact the Manufacturer. Desigo® Fire Safety Siemens Industry, Inc. Building Technologies Division 8 Fernwood Road • Florham Park, NJ 07932 Tel: (973) 593-2600 September 2018 ─ Supersedes sheet dated 9/2017 (Rev. 1) Network Fiber Modules 5080 s Industry, Inc. Building Technologies Division s Data Sheet  Fire Safety & Security Products  MXL / MXLV [with FireFinderTM XLS] Network Fiber Modules Models D2300CPS and D2325CPS Product Overview The Siemens Fire Safety Models D2300CPS (multi-mode) and D2325CPS (single-mode) fiber-optic interface modules can be used to transmit RS-485 communication between FireFinder XLS and MXL intelligent, addressable fire-alarm control panels ─ which includes H-Net communication between FireFinder XLS main and remote panels; M-Net communication between MXL main and remote panels; and X-Net communication between MXL or FireFinder XLS panels. Models D2300CPS and D2325CPS can act as either a repeater or an end-point unit. The fiber-optic interface modules are powered by 24VDC from the fire-alarm control panels. Models D2300CPS and D2325CPS can be powered from the Model PSC-12 power supply or Model PSX-12 power supply extender when used with the FireFinder XLS. When used with the MXL system, Models D2300CPS and D2325CPS can be powered from Model MMB-2, Model MMB-3 or Model PSR-1. The fiber-optic interface modules can also be powered by Model PAD-3 or Model PS-35. Specifications Using the model D2300-MP mounting plate, two (2) Models D2300CPS and D2325CPS modules can be mounted in any FireFinder XLS CAB-series enclosure. For the MXL, up to two (2) Model D2300CPS or Model D2325CPS modules can be mounted in any MXL enclosure that will accept a given Model MOM-4, using the Model MXL-MPFO mounting plate. When using System 3TM-style rails that mount on the MXL’s Model MBR-2 or Model MME-3 backbox, Model MSR-1. Model D2300CPS or Model D2325CPS can also be mounted with the System 3 bracket, Model MPFO. Up to three (3) brackets can be installed on a single rail. The Model D2300CPS module can also operate in either a daisy chain or star configuration, allowing for network configurations that are not possible with RS-485 networks alone. The connection between the Model D2300CPS modules uses two (2), high-quality duplex 50/1 25 or 62.5/1 25 fiber-optic cables and ST-style fiber connectors. The duplex fiber-optic cable has two (2) cables in a single shield similar to an electrical zip cord. Each segment of the fiber network can be up to 1.9 miles. The connection between the Model D2325CPS modules uses two (2), high-quality duplex 9/125 fiber optic cables and ST-style fiber connectors. The duplex fiber-optic cable has two (2) cables in a single shield similar to electrical zip cord. Each segment of the fiber network can be up to 10 miles. • Works with H-Net, M-Net, or X-Net • Style 4 or Style 7 Communication • Uses multi-mode or single-mode optical fiber pairs • Power provided by the fire-alarm control panel • Acts as network repeater • Daisy-chain or Star configurations • UL 864 9th Edition Listed, ULC Listed ARCHITECT AND ENGINEER SPECIFICATIONS s Industry, Inc. Building Technologies Division Fire Safety 8 Fernwood Road Florham Park, NJ 07932 Tel: (973) 593-2600 FAX: (908) 547-6877 URL: www.SBT.Siemens.com/FIS (SII‐FS) Printed in U.S.A.    Fire Safety 2 Kenview Boulevard Brampton, Ontario L6T 5E4 / Canada Tel: (905) 799-9937 FAX: (905) 799-9858 December 2010 Supersedes sheet dated 7/09 (Rev. 2) Specifications ─ (continued) For both multi-mode and single-mode installations, overall system-fiber length is limited by the communication delay across the entire fiber network. Total network length should not exceed 70,000 feet. Details for Ordering For both fiber-optic interface modules (Models D2300CPS and D2325CPS), there are five (5) light- emitting diode (LED) indicators for Power and Status. The Power LED is green and lights whenever there is 24VDC. Both channels A and B have a yellow and green LED. The green LED indicates the module is transmitting data on that channel. The yellow LED light will trigger when data is received. Temperature and Humidity Range Models D2300CPS and D2325CPS are approved for operation within the temperature range of 32° to 120°F (0°C to 49°C), and at a relative humidity of 93+/-2% at a temperature of 90+/-3°F (32+/-2°C). Notice: This marketing data sheet is not intended to be used for system design or installation purposes. For the most up-to-date information, refer to each product’s installation instructions. Model Number Part Number Description D2300CPS 500-650018 Multimode Fiber-Optic Interface Module D2325CPS 500-650019 Single mode Fiber-Optic Interface Module D2300-MP 500-634758 FireFinder XLS Fiber Module Mounting Plate MXL-MPFO 500-692880 MXL Fiber Module Mounting Plate SYS3-MPFO 500-692881 Fiber Module Mounting Plate Installation and Operation Manual [IOM] Model Number Part Number Description MMB-3 315-078860 MXL Main Control Board (with MBP-MP plate) Note: For further details, refer to MXL IOM manual: 315-092036. Related Documentation Product Data Sheet Number MXL 5000 NIM-1W 5069 XLS 6300 Siemens Building Technologies Fire SafetyP/N 315-033917-5 INTRODUCTION The Model CAB-BATT/R Battery Box from Siemens Building Technologies, Inc. is used to house BTX-2 (75AH) and BTX-3 (100AH) batteries for the FireFinder-XLS System and up to 100AH battery sets for the FS-250 and FS-250C Systems. The CAB-BATT is black and the CAB-BATT-R is red. The CAB-BATT-R will be referred to in the remainder of this document as the CAB-BATT. The CAB-BATT consists of a door and a backbox, as shown in Figure 1. The door is permanently hinged left. The backbox can be placed on the floor directly underneath the CAB enclosure to which it supplies battery backup or it can be mounted on a flat surface with four user- supplied bolts that are a maximum of 3/8 inch in diameter. CAB-BATT KNOCKOUTS FOR WIRING CABB-BATT Enclosure is for indoor use only in dry environments. INSTALLATION Prior to installation consider the following: • Weight and size of the enclosure. • Local codes. Install the backbox: 1. Select a clean, dry, shock and vibration free surface. Battery Box Installation Instructions Model CAB-BATT/R Figure 1 CAB-BATT Enclosure Siemens Building Technologies Fire Safety P/N 315-033917-52 2. Position the backbox directly beneath the CAB enclosure to which it will be wired, lining up the knockouts in the CAB-BATT with the knockouts in the CAB enclosure. 3. Position the backbox so that it is clear of obstructions and the front door opens freely. 4. Mark the locations of the two upper mounting bolts of the backbox on the wall. (Refer to Figure 2.) 21.25 in 26.125 in 1.06 in 12.00 in ø0.437 in (2 HOLES) 9.00 in SIEMENS BUILDING TECHNOLOGIES,INC.SIEMENS BUILDING TECHNOLOGIES,INC. MODEL CAB-BATTMODEL CAB-BATT INSTALLATION INSTRUCTIONSINSTALLATIONINSTRUCTIONS P/N 315-033917P/N 315-033917 FLORHAM PARK, NJ, 07932FLORHAMPARK,NJ,07932 5. Drill the two holes located in the previous step and screw in the top bolts, leaving a small gap between the wall and each top bolt. 6. Place the backbox over the two top bolts and allow it to slide down over the bolts. 7. Mark, drill, and install the two bottom bolts in the backbox. 8. Tighten all four bolts securely against the back wall of the backbox. 9. Place the batteries in the bottom of the CAB-BATT. WIRING The main AC power line must be turned OFF prior to installation. Install Wiring Wire in accordance with local codes and NEC 760. 1. Remove the knockouts in the top of the battery box and bottom of CAB enclosure for entry of battery wiring. 2. Connect the Battery Wire Assembly to the batteries in the CAB-BATT. If a longer wire is required, use a minimum of 12 AWG. For FireFinder-XLS, use P/N 465-633943, supplied with the PSC-12 (Refer to Figure 3 and the PSC- 12 Installation Instructions, P/N 315-033060.) For FS-250 or FS-250C, use the Battery Cable Assembly supplied with the FS-250 / FS-250C hardware kit (Refer to Figure 4.) Figure 2 Mounting Holes For CAB-BATT Siemens Building Technologies Fire Safety P/N 315-033917-53 ++--Black Wire 12 in. long wire provided with PSC-12 Red Wire Battery CAB-BATT TYPICAL CAB-2 ENCLOSURE Battery Wire Assembly P/N 465-633943 Battery CC-5 TAMPERSWITCHCC-5 CC-5 PSC-12 RESET POWER MODULE FAIL H - NET FAIL GND FAULT 24V12FAIL 24V 4A FAIL CAN FAIL TB3 +- P4 TB1P5 BATTERY AC TB2 1 ++_ 2 HNGND P9 P12 TB4 _ H N GND 1 H 2 N 3 GND HNGNDH N GND 1 H 2 N 3 GND PTB P4 TB2 P1 P3 P2 P5 TB1 Figure 3 Typical Battery Connections From FireFinder-XLS To CAB-BATT SPECIFICATIONS CAB-BATT: 26-1/8”W x 8-3/8”D x 12”H Siemens Building Technologies, Inc. 8 Fernwood Road Florham Park, New Jersey 07932 Siemens Building Technologies, Ltd. 2 Kenview Boulevard Brampton, Ontario L6T 5E4 Canada P/N 315-033917-5J1FS-NPEFS-NPE(OPTIONAL)FS-NPETX-3 BRDG TX-2 TX-1 BAT.AC POWER TO DISPLAY BOARD BATTERIES FS-DLC ( FS-250) OR FDLC (FS-250C) FS-DACT OR FS-MT FS-MB FUTURE EXPANSION 4- 4+ 3- 3+ 2- 2+ 1- 1+ ++--Black Wire 12” LONG WIRE PROVIDED WITH HARDWARE KIT Red Wire Battery CAB-BATT BATTERY WIRE ASSEMBLY PROVIDED WITH HARDWARE KIT Battery Figure 4 Typical Battery Connections From FS-250 / FS-250C To CAB-BATT Distributed Power Supply − NAC Extender (Model PAD-4 series) 3363 s Industry, Inc. Building Technologies Division s Data Sheet Fire Safety Products FACP Accessories PAD-4 Distributed Power Supply Unit [for UL markets] Notification Appliance Circuit Extender Models PAD-4-ENCL, PAD-4-MB (with FP2011-U1, FP2012-U1 power supplies) Product Overview Used with Siemens − Fire Safety fire alarm control panels (FACPs), the Distributed Power Supply PAD-4 Unit is a NAC expander with a built-in, auxiliary- power output. Each PAD-4 unit distributes additional power in buildings for audible and visual indicators that conform to the Americans with Disabilities Act (ADA). PAD-4 also has the following features:  NACs  Signal-input circuits  Battery-charging circuit  Trouble relays for remote monitoring  Diagnostic light-emitting diodes (LEDs)  Alternating Current (AC) power connection The Siemens NACs, which connect with alarm signaling devices, have been designed to provide the highest level of reliability and performance. Signal coding on the circuits is accomplished through integrated circuits (rather than relays), which eliminates mechanical wear on the output circuits. The PAD-4 unit provides constant 24VDC output voltage to each NAC − independent of voltage fluctuations on the primary or secondary power source. As a result, a larger voltage drop and a greater wire length for each NAC are supported by each PAD-4. Specifications This version of the Siemens Distributed Power Supply Unit can be configured in the following manner that makes the outputs easily programmable:  ‘STEADY’ outputs  Synchronized strobe outputs  American National Standards Institute (ANS I) Temporal 3  ANSI Temporal 4 [for carbon monoxide (CO) alarm signal] There are also two (2) inputs used to control the activation of the four (4) outputs. Programming can be set so one (1) input will silence the audible signal on Siemens Models ‘AS’-series, ‘NS’-series, or ‘ZH’- series horn and horn-strobes while the strobes remain active. ARCHITECT AND ENGINEER SPECIFICATIONS • Multi-module mounting in System 3™ enclosures  Multiple modules share battery set • ADA Compliant • UL 864 9th Edition Listed, UL 1481 Listed; FM (#3010), CSFM (#7315-0067:0268) Approved `Class A’ Adapter Card [Model PAD-4-CLSA] Main Board [Model PAD-4-MB] Unit Enclosure [Model PAD-4-ENCL] • Four (4) ‘Class B’, power-limited notification appliance circuits (NACs) • `Class A’, field-selectable wiring  Each unit can support an optional module (Model PAD-4-CLSA) that converts two (2) built-in ‘Class A’ NACs into four (4) ‘Class A’ NACs • Up to 3 Amps of auxiliary-power output • Optional built-in strobe synchronization  Supports coded audible signals, including Temporal 3, Temporal 4 patterns • Battery supervision and control • ‘Form C’ general Trouble / AC Fail monitoring contact • Power supplies support NAC power  Up to 6A used with Model FP2011-U1  Up to 9A used with Model FP2012-U1 • 24VDC output voltage • Ground-fault detection • Advanced microprocessor control • Uses Flash memory-based system firmware  Optional system-diagnostic and firmware-upgrade tool s Industry, Inc. Building Technologies Division Specifications ─ (continued) Operation of each PAD-4 unit is controlled by firmware stored in Flash memory on the main board, as well as the storage of a 10-event log, which can be viewed via Model PAD-4-FDT. In the event that an upgrade to the system firmware is required, the firmware can be transferred to the system without the replacement of firmware chips. An optional firmware-download software tool, Model PAD-4-FDT, can be used for system- diagnostic testing of the following:  Primary-power voltage readouts  Current draw for power charger  Configuration switch settings  Firmware version  Battery voltage When the tool is in communication with Model PAD- 4-MB, the ‘Test Mode’ LED is illuminated. Model PAD-4-LUA is a USB serial port adapter that is required for tool-kit operation. Each NAC extender supervises a variety of functions including:  Low AC power  Battery-voltage level  Earth ground-fault conditions All power can be directed to two (2) ‘Class A’ or four (4) ‘Class B’ power-limited NACs. Each NAC supports up to 3 Amps per circuit. Either one (1) or two (2) inputs can control four (4) outputs, which are compatible with all Siemens − Fire Safety 24VDC alarm signaling devices. In cases where ‘Class A’ circuits are used, an optional Model PAD-4-CLSA module can be added, providing two (2) additional ‘Class A’ outputs to each PAD-4 unit. Each NAC extender is also capable of operating other parts of a Siemens fire alarm system, such as door holders, via 3 Amps @ 24VDC max of power-limited auxiliary output. When the output activated, the total power available cannot exceed 6 Amps when used with Models FP2011-U1 or 9 Amps when used with FP2012-U1. Trouble conditions are monitored through each unit’s two (2) inputs. In addition, one (1) ‘Form C’ Trouble contact is provided for monitoring each unit that is connected through the input of a Siemens FACP. Therefore, the user has the option of connecting a PAD-4 NAC extender unit into a NAC of a Siemens FACP, or the unit may be monitored with a Model TRI-series monitoring module on a Siemens intelligent fire system. A separate ‘Form C’ Trouble contact is used exclusively with each NAC extender to indicate AC Fail Trouble events on the NAC extender. Each unit is packaged in its own sheet-metal enclosure with sufficient space to house up to 7AH battery sets. The enclosure (Model PAD-4-ENCL) is available in red. The battery charger used in each unit can energize batteries of up to 18AH. Though, when battery sets greater than 7AH are required, the battery set must be housed in a System 3 enclosure or a separate UL Listed battery enclosure. System 3 enclosures may also be used to house multiple Model PAD-4 units in a single enclosure, via the Model S3AP Adapter Plate. Two (2) units are capable of sharing the same battery set when mounted in the same enclosure. Model S3AP can also be used to mount the PAD-4 main board and 170-Watt power supply (Model FP2011-U1) into a PAD-3 enclosure. Each Model PAD-4 unit complies with seismic certification, pursuant to the following:  ASCE Standard 7, 2005 Edition  International Building Code, 2006 Edition  California Building Code, 2007 Edition  ICC-ES AC 156, effective 2007  OSHPD preapproved, under: OSP-0057-10 − OSHPD CAN 2-1708A.5, Rev. 3 Each Model PAD-4-series unit also complies with seismic certification, pursuant to ASC / SEI 7-05, Section 13.2.2, when used with the PAD-4 battery bracket (Model PAD4-BATT-BRKT). C onfiguration Options Option I nput[s] Output Controls Circuit Types 1 Input 1 All outputs ‘Class B’ circuits 2 Input 1 All outputs ‘Class B’ circuits Input 2* Silences horns on Output 1 — 3 Input 1 Outputs 1 and 2 ‘Class B’ circuits Input 2 Outputs 3 and 4 ‘Class B’ circuits 4 Input 1 Output 1 ‘Class B’ circuits Input 2 Outputs 2, 3 and 4 ‘Class B’ circuits 5 Input 1 Outputs 1 through 4 ‘Class A’ circuit pairs 6 Input 1 Outputs 1 through 4 ‘Class A’ circuit pairs Input 2* Silences horns on Output 1 — 7 Input 1 Outputs 1 and 2 ‘Class A’ circuit pairs Input 2 Outputs 3 and 4 ‘Class A’ circuit pairs * denotes when used with Siemens Model ‘AS’,’ NS’ or ‘ZH’–series horn / strobe devices s Industry, Inc. Building Technologies Division Indicator Lights AC Power ON: Green AUX / PS: Yellow Ground Fault: Yellow Output 1 Trouble: Yellow Output 2 Trouble: Yellow Output 3 Trouble: Yellow Output 4 Trouble: Yellow Test Mode: Yellow Technical Data AC Fail Trouble Contact Rating: { ‘Form A’ – Normally Closed (N.C) } 2.0A @ 30VDC, max. [resistive] Basic Trouble Contact Rating: { ‘Form C’ } 2.0A @ 30VDC, max. [resistive] Alarm Current: { for NACs and auxiliary power } 3.0A per circuit, max. 6A, max. {via Model FP2011-U1} 9A, max. {via Model FP2012-U1} Ambient Temperature: 32° ─ 120° F (0° ─ 49° C) Relative Humidity: Up to 93% @ 86° F (30° C); non-condensing Auxiliary Power Circuit: One (1) circuit @ 3A max. Battery Charging Capacity: 18AH Input Circuits / Configurations: Two (2) ‘Class B’ supervised or Two (2) ‘Class A’ supervised Input Current: 7.0mA, max. Input Voltage Range: 16 ─ 33VDC / VFW Installation Environment: Indoor, dry NACs: o Supervised, power-limited o 1.0mA standby current, max. o Four (4) circuits o 2K ohms (+), 8K ohms (-) Total Output Power: 24VDC @ 6 Amps (with Model FP2011-U1); 24VDC @ 9 Amps (with Model FP2012-U1) Output Circuits / Configurations: o Two (2) ‘Class A’; − Up to four (4) ‘Class A’ (via Model PAD-4-CLSA) o Four (4) ‘Class B’; o One (1) Class A, Two (2) Class B; Single-Unit Dimensions: { W -x- H -x- D } 13.5” ―x― 18.75” ―x― 3.25” (34.3 cm. -x- 47.6 cm. -x- 8.3 cm.) Model PAD-4-ENCL Color: Red Model PAD-4-ENCL Temperature and Humidity Range Each PAD-4 Distributed Power Supply Unit is UL 864 9th Edition Listed for indoor dry locations within a temperature range of 120+/-3°F (49+/-2°C) to 32+/-3°F (0+/-2°C) and a relative humidity of 93+/-2% at a temperature of 90+/-3°F (32+/-2°C). Details for Ordering Model Part Number Description PAD-4-ENCL 500-050081 PAD-unit enclosure PAD-4-MB 500-650217 PAD-unit main board FP2011-U1 500-450222 170-Watt power supply FP2012-U1 S54400-Z60-A1 300-Watt power supply — System Kits — Model Part Number Description PAD4-6A S54339-A1-A1 Complete 6A PAD-4 kit with: − One (1) Unit Enclosure, PAD-4-ENCL − One (1) Main Board, PAD-4-MB − One (1) 170W power supply, FP2011-U1 PAD4-6A-CLSA S54339-A2-A1 Complete 6A PAD-4 kit with: − One (1) Unit Enclosure, PAD-4-ENCL − One (1) Main Board, PAD-4-MB − One (1) 170W power supply, FP2011-U1 − One (1) ‘Class A’ Adapter Card, PAD-4-CLSA PAD4-9A S54339-A3-A1 Complete 9A PAD-4 kit with: − One (1) Unit Enclosure, PAD-4-ENCL − One (1) Main Board, PAD-4-MB − One (1) 300W power supply, FP2012-U1 PAD4-9A-CLSA S54339-A4-A1 Complete 9A PAD-4 kit with: − One (1) Unit Enclosure, PAD-4-ENCL − One (1) Main Board, PAD-4-MB − One (1) 300W power supply, FP2012-U1 − One (1) ‘Class A’ Adapter Card, PAD-4-CLSA — Optional Accessories — Model Part Number Description PAD4-BATT-BRKT S54430-B4-A1 Battery bracket for NAC expander PAD-4-LUA S54389-C1-A1 PAD-4 Laptop-Upload Adapter PAD-4-CLSA 500-850254 ‘Class A’ Adapter Card S3AP 500-650257 PAD-4 NAC expander adapter plate (for use with PAD-3 and System 3 enclosures) Note: For the data sheet of the PAD-4 NAC Extender sold in Canada, please see document, 3363C. s Industry, Inc. Building Technologies Division Fire Safety 8 Fernwood Road Florham Park, NJ 07932 Tel: (973) 593-2600 FAX: (908) 547-6877 URL: www.usa.Siemens.com/Fire (SII-FS) Printed in U.S.A. June 2017 Supersedes sheet dated 11/2015 (Rev. 6) Notice: This marketing data sheet is not intended to be used for system design or installation purposes. For the most up-to-date information, refer to each product’s installation instructions. Siemens Building Technologies Division Data Sheet 7326 usa.siemens.com/desigo-fire-safety Architect & Engineer Specifications  4” –x– 40” (10.2 cm. –x– 102 cm.) front-end, backlit liquid-crystal display (LCD) screen  Audible and event-status light-emitting diodes (LEDs)  Scroll buttons to view additional events  Local sounder  Supports ‘Style 4’ or ‘Style 7’ wiring  Built-in transient protection  Mounts in its own enclosure or REMBOX-series enclosure  Optional local-system control  Downloadable firmware  UL864 & CAN / ULC-S576 Listed; FM, CSFM & NYCFD Approved Product Overview The System-Status Display (SSD Series) is a remote light-emitting diode (LED) / liquid-crystal display (LCD) display unit that shows the local status of a Desigo Fire Safety Modular system. A LED will illuminate when Alarm | Supervisory | Trouble and Security events occur on the system. A (4) four-line LCD will give details of the event in alphanumeric form. The display can be toggled to display additional events. Optional remote-system-control capabilities are available. Specifications The SSD Series display has separate LEDs for Alarm | Supervisory | Trouble and Security events on the Desigo Fire Safety Modular system. Each LED will flash when unacknowledged events of that type are present on the system. The LED will change to steady, upon acknowledgment of the event. Also, there are two (2) LEDs that indicate the state of audible circuits on the system: one (1) LED to indicate that the circuits are active and one (1) LED to indicate the circuits have been silenced. The LCD display on the Model SSD-series display has four (4) rows – 40 characters for each row. When the Desigo Fire Safety Modular system is in its normal supervisory state with no events present, the display will annunciate the system ID information, the date and the time of day. When an event occurs on the system, the LCD display will show the event type and address, the time of the event, the custom message for that address, the usage of the device, and whether the event is `acknowledged’ or not. Additionally, the display will show the total number of all types of events present on the system. The display has a backlight feature that operates upon receiving any event information or when any operator buttons are pressed. Desigo® Fire Safety Modular system System-Status Display Series Model SSD, SSD-C and SSD-C-REM Model SSD-C System-Status Display Series Model SSD-C-REM System-Status Display Series Siemens Building Technologies Division –2– usa.siemens.com/desigo-fire-safety Specifications – (continued) A local sounder is included with the Model SSD-series display that operates when any events are displayed on the system. The sounder can be optionally disabled through software programming. Pressing any operator buttons will silence the local sounder when an event is present. The SSD Series display has two (2) display-control buttons that are used to display the next or the previous event information in the sequence, and a local sounder silence button. Programming for the SSD Series display is done with the Zeus-D programming tool. Models SSD-C and Model SSD-C-REM have three (3) additional control buttons for acknowledging events, silencing audible circuits, and resetting the system. Model SSD-C has an integral key switch that enables these control buttons to operate. Model SSD-C-REM is located within a locked cabinet, so no additional key switch is required for enabling the control buttons. The SSD Series display is remotely connected to the H-Net communication bus from any Model NIC-C interface in a Desigo Fire Safety Modular system enclosure using Class B, Style 4 or Class A, Style 7 wiring. 24VDC is required to run the SSD Series display, and can be provided from a Model PSC-12 Power Supply or PSX-12 Power Supply Extender in the Desigo Fire Safety Modular system enclosure. Power from other UL Listed 24VDC power sources is also acceptable. The SSD Series display has screw terminals capable of supporting 12 to 22-gage wires. The H-Net communication from the Desigo Fire Safety Modular system can be terminated on the SSD Series display, or may pass through for communication with other modules. Diagnostic LEDs on the SSD Series display indicate power and communication status. Models SSD and SSD-C can be mounted in a (2) two-gang electrical box or a (4) four-inch square electrical box. No flush- trim kit is required. The unit is approximately 10-1/2“ (26.7cm.) wide, 6-1/8” (15.2cm.) high, and1-1/2” (3.8cm.) deep. The Model SSD-C-REM is mounted in a Model REMBOX2 or Model REMBOX4 Remote Lobby Enclosure, or any CAB enclosure inner door. Model SSD-C-REM requires two (2) module spaces in the remote lobby enclosure, and its bracket supports the mounting of four (4) inner door modules (such as Model SCM-8 or Model LCM-8 modules) below the display. The inner door module spaces are arranged in two (2) rows of (2) two-module spaces. Temperature and Humidity Range Products are UL 864 9th Edition Listed for indoor dry locations within a temperature range of 120+/-3°F (49+/-2°C) to 32+/-3°F (0+/-2°C) and a relative humidity of 93+/-2% at a temperature of 90+/-3°F (32+/-2°C). Siemens Building Technologies Division –3– usa.siemens.com/desigo-fire-safety Electrical Ratings NOTE: An auxiliary-regulated, power-limited power supply may be used to provide power to Model SSD. The power supply must be UL Listed for Fire- Protection Signaling Application. Be sure to also include Model SSD-C in the battery calculations. NOTE: An auxiliary-regulated, power-limited power supply may be used to provide power to Model SSD. The power supply must be UL Listed for Fire- Protection Signaling Application. NOTE: An auxiliary-regulated, power-limited power supply may be used to provide power to Model SSD-C-REM. The power supply must be UL / ULC approved for Fire Protection Signaling Application. Be sure to also include Model SSD-C-REM in the battery calculations. MODEL OR TYPE PART NUMBER PRODUCT SSD 500-034170 System-Status Display SSD-C 500-648733 System-Status Display [with control] SSD-C-REM 500-634773 System-Status Display [with control for remote-lobby enclosure] REMBOX2 500-633772 Small Remote-Lobby Enclosure REMBOX4 500-633914 Large Remote-Lobby Enclosure BCM 500-033320 Blank Control Module Plate SSD-C TYPICAL 200mA (max) at 24 VDC INPUT VOLTAGE 24 VDC (Nominal) ( 31 VDC max ) filtered SSD / SSD-INTL TYPICAL 200mA (max) at 24 VDC INPUT VOLTAGE 24 VDC (Nominal) ( 31 VDC max ) filtered SSD-C-REM TYPICAL 200mA (max) at 24 VDC INPUT VOLTAGE 24 VDC (Nominal) ( 31 VDC max ) filtered Details for Ordering NOTICE – The information contained in this data-sheet document is intended only as a summary, and is subject to change without notice. The product(s) described here has/have a specific instruction sheet(s) that cover various technical, limitation and liability information. Copies of install-type, instruction sheets – as well as the General Product Warning and Limitations document, which also contains important d ata, are provided with the product, and are available from the Manufacturer. Data contained in the aforesaid type of documentation should be consulted with a fire-safety professional before specifying or using the product. Any further questions or assistance concerning particular problems that might arise, relative to the proper functioning of the equipment, please contact the Manufacturer. Desigo® Fire Safety Siemens Industry, Inc. Building Technologies Division 8 Fernwood Road • Florham Park, NJ 07932 Tel: (973) 593-2600 October 2017 ─ New Issue (Rev. 0 ) Siemens Data Sheet 6156 Smart Infrastructure - Building Products usa.siemens.com/fire Desigo® Fire Safety Specialized Devices Models FDBZ492, FDBZ492-HR, FDBZ492-R and FDBZ492-PR (with FDBZ-WT and FDBZ492-RTL) FDBZ-series of air-duct housings [FDBZ492, FDBZ492 -HR, FDBZ492-R & FDBZ492-PR] Architect & Engineer Specifications  Four (4) models available  Addressable and conventional with and without relays  Compatible with Siemens ─ Fire Safety conventional and addressable fire- alarm control panels (FACPs)  Magnet test feature with the Model OP121 conventional detector  Design for air-velocity range of 100 to 4,000 feet-per-minute (fpm)  Robust, compatible conventional remote indicator test switch that incorporates tri -color light-emitting diode (LED)  Clear housing cover with smoke test port on cover for quick identification of detector type  Removable via four (4) captive-thumb screws (no tools required)  Includes a smoke / aerosol detector test port  Optional NEMA 4X-reinforced, stainless - steel and watertight enclosure available, Model FDBZ-WT  No tools required for cover removal, sampling and exhaust-tube installations  Trouble-event activation upon front- cover removal  Alarm LED visible from front  Self-contained model available with ‘on - board’ power supply for conventional detectors  Expanded temperature range  Relay models available  UL268A Listed, ULC-S529 Listed  FM (#3010), CSFM (#3240-0067:0265) Approved Product Overview The Siemens ─ Fire Safety Model ‘FDBZ’-series of air-duct-detector housings are designed for use with Siemens Model ‘H’-series, ‘FD’-series and Model OP121 detectors. (see: Details for Ordering for a complete list of compatible devices). Designed for installation directly to heating, ventilating and air-conditioning (HVAC) duct systems, the Model ‘FDBZ’-series of duct housings complies with National Fire Protection Association Standard (NFPA) No.’s 72 and 90A, and is Underwriters’ Laboratories Listed. When equipped, the air-duct detector housing will signal the presence of smoke being carried through the duct system. Air-duct detectors are not intended to be substituted for open-area detection. Notes: Most conventional time-control equipment guarantee only one (1) detector per zone when the detector’s operated relay function is critical. The connection of a remote lamp and a remote relay −per detector − is allowed. Refer to the installation manual of the respective conventional FACP. With either the Desigo® series or FireFinder® XLS series of FACPs, up to 252-addressable detectors with relays per circuit may be used. The connection of an intelligent remote lamp (ILED) and a remote relay is allowed for each detector simultaneously. Specifications The Model ‘FDBZ’-series of air-duct housings are uniquely designed to use with the photoelectric detector. Sensitivity of Models PE-11, PE-11C, OP121 conventional detectors can be verified for calibration via LED visual status or a Model RSAW-11, Model RSAC-11 or FDBZ492-RTL multi-color remote lamp. A green flash indicates the detector has passed its self-test. Amber indicates a Trouble condition, and red indicates an Alarm event. Sensitivity for Models FP-11, HFP-11, SFP-11, HFPO-11, SFPO-11 FDO421, FDOOT441 and FDOOTC441 intelligent detectors is verified from the multi-color LED of the respective detector, or its sensitivity reading may be printed by command from the corresponding FACP to an optional printer. Siemens Smart Infrastructure - Building Products –2– usa.siemens.com/fire Specifications (cont.) The remote alarm indicator (Model FDBZ492-RTL) allows for manual testing via a key-switch for conventional and addressable detectors, as well as the conventional and addressable air-duct housing with relay. Model FDBZ492-RTL, which mounts remotely from the conventional and addressable air-duct housing, allows for manual relay-output control. The duct-detector remote indicator key-switch also indicates the current state of the detector. The watertight housing (Model FDBZ-WT), which allows the air-duct detector housing to be installed inside the separate NEMA 4X enclosure, is for installations for either an outdoor area or in environments where excessive moisture is prevalent. Each detector unit employs a cross-sectional sampling principle of operation. Inlet sampling tubes are available in four (4) lengths (see: Sampling Tube Selection Table ). Outlet sampling tubes are one (1) common length and draw. A continuous, cross-sectional sample of air moves through the duct. Stratification or skin affect phenomenon that occurs in the duct can prevent smoke (especially in large ducts) from reaching a spot-type detector. In addition, the unique design of the sampling chamber ensures uniform sensitivity in air velocities, ranging from a low of 100 fpm to as high as 4,000 fpm. Each air-duct housing comes with three (3) wiring entry ports: ▪ Two (2) 3/4” conduit knockouts ▪ One (1) 1/2” conduit opening The inlet sampling tube length is determined by the width of the air duct being protected. The inlet tube ─ greater than and nearest to the duct width ─ should be used (see: Sampling Tube Selection Table ). The inlet tube can then be trimmed at the job site to the exact width of the duct. The outlet sampling tube for all ducts ─ irrespective of width ─ has a fixed length of approximately 5.5 inches (14cm.), and is supplied with the air-duct housing. Note: When the use of a remote relay is required, order Model FDBZ492 -R for conventional systems; Model FDBZ492-HR for addressable systems. When required, a separate watertight enclosure (Model FDBZ -WT), which is designed to contain the air-duct housings is available. (For full details, refer to installation instructions for the respective air -duct housing.) Note: When a self-contained duct detector with power supply is required, order Model FDBZ492 -PR. (For full details, refer to installation instructions - part number A6V10330327.) Sampling Tube Selection Table Duct Width Sampling Tube (Model No.) For duct widths 6” to 1’ ST-10 For duct widths 1’ to 3’ ST-25 For duct widths 3’ to 5’ (requires support) ST-50 For duct widths 5’ to 10’ (requires support) ST-100 Maintenance of the detector is easily accomplished via the removal of the duct-housing sampling chamber cover. The detector, which plugs into the housing, is easily removed for cleaning or replacing by a trained technician. All that is necessary for installation of the air-duct detector is the cutting of three (3) small holes for the Sampling Tube installation (template included), and the drilling of two (2) holes for mounting the air-duct housing. The unit is then easily mounted in place, and connection made to the existing wires or terminals ─ if optional accessories are utilized. No mechanical tools are required for removing the cover or connecting the sampling and exhaust tubes to an air-duct housing. Models ST-50 and ST-100 require support. However, Model ST-100 is shipped in two (2) 5-ft. (152 cm.) pieces with a coupling for field assembly. Siemens Smart Infrastructure - Building Products –3– usa.siemens.com/fire Operation Based on the monitoring results, the LED indicator flashes the following colors based on the following conditions: *LED can be turned OFF. Please follow the corresponding description of the panel used. Flash Color Condition Flash Interval (in seconds) Green*: Normal supervisory operation. Smoke sensitivity is within rated limits. 10 Yellow: Detector is in Trouble condition, and needs either repair or replacement. 4 Red: Alarm condition. 1 No Flash: Detector is not powered. ─ ─ Operating Temperature Ranges: +32°F (0°C) to 120°F (49°C) Sampling Tube Pressure Range of Differences: > 0.01 inches - < 1.2 inches of water column Relative Humidity: 0 - 95%; non-condensing Air Pressure No effect Altitude Range: No limitations Air-Duct Velocity: 100 ─ 4,000 ft. / min (0.51─ 20m / sec) Dimensions: (H -x- W -x- D) Rectangular: 14.38” -x- 5” -x- 2.5” (37 cm. -x- 12.7 cm. -x- 6.36 cm.) Square: 7.75” -x- 9” -x- 2.5” (19.7 cm. -x- 22.9 cm. -x- 6.36 cm.) Detector Weight: 1.8 Lbs. (0.82 Kg.) ▪ Short-Return (outlet) Tube ▪ Stopper ▪ #12 + 3/4” Sheet-Metal Screws ▪ Mounting Template Note: Detector and Sampling Tube to be purchased separately. Minimum hardware required: − one (1) Air-Duct Housing Assembly − one (1) Sampling Tube − one (1) Detector Technical Data Physical Properties Air Duct Housing Hardware Package Siemens Smart Infrastructure - Building Products –4– usa.siemens.com/fire Model or Type Part Number Description FDBZ492 S54319-B22-A1 A two-wire addressable or conventional duct detector (without relays) designed for direct use on heating, ventilating and air-conditioning (HVAC) air-duct systems. When equipped, the air-duct detector housing will signal the presence of smoke being carried through the duct system. For use with the following Models: ▪ OP121 ▪ FP-11 ▪ HFP-11 ▪ HFPO-11 ▪ PE-11 ▪ FDO421 ▪ FDOOT441 ▪ FDOOTC441 ▪ PE-11 C ▪ SFP-11 ▪ SFPO-11 FDBZ492-HR S54319-B23-A1 A two-wire addressable duct detector (with relays) designed for direct use to HVAC air - duct systems and works with the Remote Test Switch (FDBZ492-RTL). This part has a programmable relay base, and when equipped, the addressable air -duct detector housing will signal the presence of smoke being carried through the duct system. For use with the following Models: ▪ FDO421 ▪ FDOOT441 ▪ FDOOTC441 ▪ FP-11 ▪ HFP-11 ▪ HFPO-11 ▪ SFPO-11 ▪ SFP-11 FDBZ492-R S54319-B24-A1 A two-wire conventional duct detector with relays designed for direct use on HVAC air - duct systems. This detector has a relay base, and when equipped with conventional air- duct housing, will signal the presence of smoke being carried through the duct system. For use with the following Models : ▪ PE-11 PE-11 C ▪ OP121 FDBZ492-PR S54319-B25-A1 A four-wire conventional duct detector with relays and a built-in power supply. Housing is designed for direct use to HVAC air-duct systems. It has a relay base with a built-in power source. When equipped with conventional air-duct housing, this duct detector will signal the presence of smoke being carried through the duct system. For use with the following Models: ▪ PE-11 PE-11 C ▪ OP121 FDBZ492-RTL S54319-S27-A1 Device is used for manual testing via a key -switch for duct-housing Models FDBZ492 -R, FDBZ492-PR and FDBZ492-HR. Device mounts remotely from the conventional and addressable air-duct housing, allowing for manual relay -output control. The duct-detector remote key-switch also indicates the current state of the detector. For use with the following Models: ▪ FDBZ492-HR ▪ FDBZ492-R ▪ FDBZ492-PR FDBZ-WT S54319-B26-A1 An optional, separate watertight NEMA 4X enclosure (Model FDBZ -WT) that provides added watertight protection for any of the Model FDBZ492 -series duct housings. The duct housing fits into the separate 4X enclosure. This pa rt allows the air-duct detector housing to be installed in the separate enclosure, and can be used in either an outdoor area or in environments where excessive moisture is prevalent. For use with the following Models: ▪ FDBZ492 ▪ FDBZ492-R ▪ FDBZ492-HR ▪ FDBZ492-PR ST-10 500-649710 Sampling tube for Ducts 6” to 1’ ST-25 500-649711 Sampling tube for Ducts over 1’ to 3’ ST-50 500-649712 Sampling tube for Ducts 3” to 5’ ST-100 500-649713 Sampling tube for Ducts 5’ to 10’ Details for Ordering Note: Model names in Red for use in Canada. . NOTICE – The information contained in this data -sheet document is intended only as a summary, and is subject to change without notice. The product(s) described here has/have a specific instruction sheet(s) that cover various technical, limitation and liability information . Copies of install-type, instruction sheets – as well as the General Product Warning and Limitations document , which also contains important data , are provided with the product, and are available from the Manufacturer. Data contained in the aforesaid type of documentation should be consulted with a fire-safety professional before specifying or using the product. Any further questions or assistance concerning particular problems that might arise, rela tive to the proper functioning of the equipment, please contact the Manufacturer. Desigo® Siemens Industry, Inc. Smart Infrastructure - Building Products 8 Fernwood Road • Florham Park, NJ 07932 Tel: (973) 593-2600 August - 2021 (Rev. 5) THIS PAGE INTENTIONALLY LEFT BLANK FOR DUPLEX PRINTING Siemens Data Sheet 6152 Smart Infrastructure - Building Products usa.siemens.com/fire Desigo® Fire Safety Detectors and Peripherals Photoelectric Smoke Detector Model FDO421 Model FDO421- Photoelectric Smoke Detector Architect & Engineer Specifications  UL 268 7th edition Listed  Built-in ISOtechnology™  252 Isolation devices per SLC  Compatible with `H’-series devices on the same loop (with Desigo Fire Safety series fire-alarm control panels)  Compatible with Model DPU (device programmer / loop tester)  Each detector is self-testing: - self-monitored for sensitivity with UL Listed limits - complete diagnostics performed every 10 seconds  Polarity insensitive via SureWire™ technology  Functions with Model DB-11–series mounting bases  Tri-color detector-status light-emitting diode (LED) with 360 ° view  Field-selectable application - sensitivity profiles  Remote sensitivity - measurement capability  Utilizes advanced, microprocessor-based signal processing  Extended temperature-and-humidity operating range  Automatic environment compensation  Superior electromagnetic interference (EMI) and radio-frequency interference (RFI) immunity  Restriction of Hazardous Substances (RoHS compliant)  UL Listed | CSFM Approved - UL 268: `Open Area Smoke Detection’ - UL 268A (Duct) - `In-duct housing’ use - UL 268A (Duct) - `Direct-in-Duct’ use - ULC-S531: `Open Area Smoke Detection’ - CSFM | File: 7272-0067:0258 Product Overview The Photoelectric Smoke Detector (Model FDO421) uses state-of-the-art microcontroller circuitry and surface-mount technology for maximum reliability. Model FDO421 incorporates an optical sensor using a light- scattering detection principle. The device utilizes advanced software algorithms to analyze the signals, and provides highly stable and accurate smoke detection. Model FDO421 also uses state-of-the-art microprocessor circuitry with error check; detector self-diagnostics, and supervision programs. Each detector is UL 268 7th edition listed incorporating advanced built-in ISOtechnology™ - True Class-X SLC operation (use is optional) greatly improving system reliability and circuit integrity while providing advanced addressable fault finding. The unit fits into one (1) wall-or-ceiling footprint, and only occupies one (1) address on the signal-line circuit (SLC). Model FDO421 is a plug-in, two-wire, addressable photoelectric smoke detector whose value is increased with built-in ISOtechnology feature. Model FDO421 is Underwriters’ Laboratories Listed [UL268A Listed for direct in-air duct usage]. Each detector consists of a dust-resistant photoelectric chamber and microprocessor-based electronics with a low-profile plastic housing. Every Model FDO421 fire detector is shipped with a protective dust cover. Operation Model FDO421 is a wide-spectrum, photoelectric smoke detector that incorporates an infrared light-emitting diode (IRLED), as well as a light- sensing photodiode. Under normal conditions, light transmitted by the LED is directed away from the photodiode and scattered through the smoke chamber in a controlled pattern. The smoke chamber is designed to manage light dissipation and extraneous reflections from dust particles or other non-smoke, airborne contaminants in such a way as to maintain stable, consistent detector operation. When smoke enters the detector chamber, light emitted from the IRLED is scattered by the smoke particles and is received by the photodiode (see: images on page 2). Siemens Smart Infrastructure - Building Products –2– usa.siemens.com/fire Sensitivity Settings Application Parameter Sets Model FDO421 provides four (4) pre-programmed sensitivity parameter sets that can be selected by the Siemens fire- alarm control panel in order to match the expected application or environmental conditions: • Sensitive • Standard • Robust • Air-duct Sensitive: This application parameter set is practically suitable for areas where few misleading sources of false alarm are present , and is appropriate where priority is given to detecting open fires as soon as possible (e.g. – typically a clean application with controlled environmental conditions). Standard: This application parameter set, which is ideal for normal office | hotel-lobby-type applications, is the default setting. Robust: This application parameter set offers improved resistance to false alarms in areas where misleading sources, such as cigarette smoke or exhaust fumes, may cause a nuisance alarm. Air-Duct: This application parameter set is used when the detector is used a UL268A (DI) compliant, direct in-air duct application without a duct housing. Model FDO421 does not require a field sensitivity test. Model FDO421 is UL Listed as a self-testing device and complies with NFPA 72 as a self-monitoring detector and control-panel arrangement. This parameter set is also used when Model FDO421 is used in air-duct housings (Models FDBZ492 and FDBZ492-HR). A quick visual inspection is sufficient to indicate the conditio n of Model FDO421 at any time. If more detailed information is required, a printed report can be provided from the compatible FACP, indicating the status and settings assigned to each individual detector. When Model FDO421 moves to `Alarm’ mode, the detector will flash RED and continue flashing until the system is reset at the FACP. At that same time, any user-defined, system-alarm functions programmed into the system are activated. Model FDO421 contains a tri-color LED indicator, capable of flashing any one (1) of three (3) distinct colors: GREEN | YELLOW | RED. During each flash interval, the microprocessor-based detector monitors the following scenarios: • Smoke sensitivity is within the range indicated on the nameplate label • Smoke in its sensing chamber • Internal sensors and electronics are functional 1. Labyrinth 2. Optical transmitter 3. Optical receiver 1. Dust cover 2. Photoelectric smoke detector 1 . 2 . Model FDO421- Siemens Smart Infrastructure - Building Products –3– usa.siemens.com/fire Sensitivity Settings (continued) Based on the results of the monitoring, the LED indicator flashes the following: FLASH COLOR CONDITION FLASH INTERVAL [in seconds] GREEN: Normal supervisory operation. Smoke sensitivity is within rated limits. 10 YELLOW: Detector is in trouble and needs replacement. 4 RED: `Alarm’ condition 1 NO FLASH: Detector is not powered. –  denotes LED can be turned O FF Please follow the corresponding description of the panel used. A quick visual inspection is sufficient to indicate the condition of the detector at any time. If more detailed information is required, a printed report can be provided from the respective Desigo Fire Safety Modular | FireFinder XLS/V | FC/FV20–series FACP that indicates the status and settings assigned to each individual detector. Installation All Model FDO421 intelligent, addressable detectors use a surface-mounting base (Model DB-11 or DB-11E), which mounts on a 4-inch (10.2 cm.) octagonal, square or single -gang electrical back box. The base utilizes screw-clamp contacts for electrical connections and self -wiping contacts for increased reliability. The Model DB-11 detector base can be used with the optional Siemens Model LK-11 detector locking kit, which contains 50 detector locks and an installation tool to prevent unauthorized removal of the detector head. Model DB- 11 has aesthetically conducive plugs to cover the outer mounting -screw holes. Model FDO421 may be installed on the same initiating circuit with the Siemens Model `H’-series detectors [when used with Desigo Fire Safety Modular | FireFinder XLS/V | FC/FV20–series FACPs] – • XTRI series interface modules • HFP-11, HFPT-11 detection devices • HTRI series interface modules • HCP output-control module • HMS & XMS series manual stations • HZM conventional zone module Each detector, which is shipped with a protective dust cover, consists of the following: • Built-in ISOtechnology for True-Class-X SLC performance • Dust-resistant photoelectric chamber • Microprocessor-based electronics with a low-profile plastic housing All Model FDO421 intelligent, addressable detectors are approved for operation with the Underwriters’ Laboratories-specified temperature range of 32° to 120° (0° to 49°C). (See: installation manual P/N ─ A6V10323928 for further details) Application Data Installation of Model FDO421 smoke detectors require a two-wire circuit. In many retrofit cases, existing wiring may be used. `T-tapping’ is permitted only for Style 4 (Class B) wiring. Model FDO421 is polarity insensitive, which can greatly reduce installation and debugging times. When operating in NFPA 72 Class-X applications SLC polarity must be maintained to support up to 252 isolation ready devices per loop. When used in mixed mode a maximum of 30 non- isolated devices between isolation devices (wired in polarity -insensitive mode). See control panel install document for further details. Model FDO421 detectors can be applied within the maximum 30-feet center spacing (900 sq. ft. areas,) as referenced in NFPA 72.This application guideline is based on ideal conditions − specifically, smooth ceiling surfaces, minimal air movement, and no physical obstructions between potential fire sources and the actual detector. Do not mount detectors near ventilation or heating and air conditioning outlets. Exposed joists or beamed ceilings may also affect safe spacing limitations for detectors. Should questions arise regarding detector placement, observe NFPA 72 guidelines. Good fire-protection-system engineering and common sense dictate how and when fire detectors are installed and used. Contact your local Siemens − Fire Safety distributor or sales office whenever you need assistance applying Model FDO421 in unusual applications. Be sure to follow NFPA guidelines and UL Listed / ULC Listed installation instructions − included with every Siemens − Fire Safety detector − and local codes as for all fire protection equipment. Dimensional Data NOTICE – The information contained in this data -sheet document is intended only as a summary, and is subject to change without notice. The product(s) described here has/have a specific instruction sheet(s) that cover various technical, limitation and liability information . Copies of install-type, instruction sheets – as well as the General Product Warning and Limitations document , which also contains important data , are provided with the product, and are available from the Manufacturer. Data contained in the aforesaid type of documentation should be consulted with a fire-safety professional before specifying or using the product. Any further questions or assistance concerning particular problems that might arise, relative to the proper functioning of the equipment, please contact the Manufacturer. Field-Device Programmer / Test Unit Model FDO421 is compatible with the Siemens field-device programmer / test unit (Model DPU), which is a compact, portable menu-driven accessory for electronically programming and testing these addressable detectors promptly and reliably. For instance, the field technician selects the accessory’s program mode, and enters the desired address. Model DPU eliminates the need for cumbersome, unreliable mechanical programming methods (e.g. – dials and rotary switches), and reduces installation and service costs by electronically programming and testing the detector prior to installation. When set in `test’ mode, Model DPU will perform a series of diagnostic tests without altering the address or other stored data, allowing technicians to determine if the detector is operating properly. Each field-device programmer / test unit operates on AC power or rechargeable batteries, providing flexibility and convenience in the programming / testing of fire -safety equipment from practically any location. Additionally, with the use of a Model DPU unit, there is no longer a cause for concern with any vibration, corrosion and other deteriorating conditions that can accompany the vitality of electro-mechanical-addressing mechanisms. Each detector fits into one (1) wall-or-ceiling footprint, and only occupies one (1) address on the signal-line circuit (SLC). Technical Data S OPERATING TEMPERATURE: +32° – +120°F (0° – +49°C) RELATIVE HUMIDITY: 0 – 95% (non-condensing) AIR PRESSURE: No effect AIR VELOCITY: 0 − 4,000 feet-per-minute (fpm) (0 – 20 meters-per-second) INPUT VOLTAGE RANGE: 16VDC – 30VDC `ALARM’ CURRENT, MAX.: 410μA `STANDBY’ CURRENT, MAX.: 250μA MAXIMUM SPACING: 30–ft. centers (900 sq. ft.), per NFPA 72 DETECTOR WEIGHT: 0.317 Lbs. (0.144 kg.) MECHANICAL PROTECTION GUARD: UL and ULC Listed (with STI Guard Model ST I-9604) SENSITIVITY RANGE: 1.41 - 3.76 % / ft obs. (Nominal 2.0 % / ft. obs.) MODEL OR TYPE DATA SHEET PANEL XLS 6300 FireFinder® (fire) XLSV 6340 FireFinder (fire w/ voice) DESIGO MODULAR 7300 Desigo Modular (overview) FC2005 6813 Desigo Fire Safety 50-point addressable FC2025 6815 Desigo Fire Safety 252-pt. addressable (fire ) FC2050 Desigo Fire Safety 504-pt. addressable (fire ) FV2025 6821 Desigo Fire Safety 252-point addressable (fire w / I ntelligent Voice Communication [I VC]) FV2050 504-pt. addressable (fire w / I ntelligent Voice Communication [I VC]) MODEL OR TYPE PART NUMBER PRODUCT FDO421 S54320-F4-A1 Photoelectric Smoke Detector Compatible Devices: MODEL OR TYPE PART NUMBER PRODUCT DB-11 500-094151 De tector Mounting Base DB-11E 500-094151E Detector Base, small DB2-HR S54370-F12-A1 De tector Mounting Base with Relay RL-HC 500-033230 Remote Alarm Indicator: 4” (10.2 cm) octagon - box mount, red RL-HW 500-033310 Remote Alarm Indicator: single- gang box mount, red FDBZ492 S54319-B22-A1 Addressable Air-Duct Housing FDBZ492-HR S54319-B23-A1 Addressable Air - Duct Detector with Relay LK-11 500-695350 Base Locking Kit See: www.STI-USA.com for further details on ordering Model ST I-9604 In Canada order: MODEL OR TYPE PART NUMBER PRODUCT DB-11C 500-095687 Detector Mounting Base, ULC Listed Details for Ordering Panel Compatibilities Desigo® Fire Safety Siemens Industry, Inc. Smart Infrastructure - Building Products 8 Fernwood Road • Florham Park, NJ 07932 Tel: (973) 593-2600 July -2021 (Rev. 11) Siemens Smart Infrastructure - Building Products Datasheet 6153 usa.siemens.com/fire Desigo® Fire Safety Detectors and Peripherals Multi-Criteria Fire | CO Detector [with ASAtechnology™] Model FDOOTC441 Model FDOOTC441 Multi-Criteria Fire | CO Detector [with ASAtechnology] Architect & Engineer Specifications UL 268 7th edition Listed, ULC Listed; FM (#3230, #3210), CSFM (#7272-0067:0258) Approved Built-in ISOtechnology™ Competitive 10-year CO sensor lifetime Advanced multi-criteria fire detector that has optical thermal and CO sensors Differentiates between deceptive phenomena and an actual fire (nuisance- alarm avoidance) Compatible with `H’-series devices on the same loop of Desigo Fire Safety FACPs Enhanced detection via forward-and- backward light-scattering technology Supervisory feature for temperature and CO - concentration-threshold monitoring Complies with NFPA 76 (Telco standard) as `VEWFD’ high-sensitivity detector UL Listed and FM Approved as a multi- criteria and `VEWFD’ fire detector Low-temperature warning for sprinkler systems, per NFPA 25 UL 268A Listed for direct air-duct use (4,000 FPM) UL 2075 and NFPA 72 requirements for sensitivity self-monitoring Remote sensitivity-measurement capability Tri-color detector-status light-emitting diode (LED) with 360 ° view Polarity insensitive via SureWire™ Responds to both flaming and smoldering-fire signatures Supervisory temperature- monitoring feature Automatic environment compensation Meets UL, NFPA 72 requirements for sensitivity self-monitoring Compatible with: -Model DB-11—series mounting bases -Model DPU (device programmer / loop tester) Restriction of Hazardous Substances (RoHS compliant) Product Overview Model FDOOTC441 is an advanced, multi-criteria fire | CO detector that incorporates a redundant optical / thermal sensor. Additionally, Model FDOOTC441 utilizes ASAtechnology™ a distinctive forward / backward, light-scattering technology that provides high-tech, unparalleled fire detection to the widest range of fire types allowing the detector to distinguish non-threatening deceptive phenomena. Each Model FDOOTC441 unit is UL 268 7th edition listed incorporating advanced built-in ISOtechnology™ - True Class-X SLC operation (use is optional) greatly improving system reliability and circuit integrity while providing advanced addressable fault finding. The unit may be programmed as a high-sensitivity detector, with a 0.2 %/ft Pre- Alarm threshold and 1.0 %/ft Alarm threshold thus meeting the requirements of NFPA 76 Standard for the Fire Protection of Telecommunications Facilities as a Very Early Warning Fire Detector (VEWFD). Each FDOOTC441 detector offers a complete and contemporary solution to meet fire and CO life-safety gas-detection specifications. Multi-Criteria Fire / CO Detector detectors can be field programmed for simultaneous and / or independent functionality, depending upon the precise customer and application requirements. For example, the detector can simultaneously utilize the optical and heat sensors for enhanced fire detection (multi criteria), as well as provide independent outputs for CO gas life-safety and heat detection. Any combination of the sensors is possible. Each detector is very versatile, and meets the following fire-industry standards: •Multi-criteria fire detector (UL 268 7th edition) •Carbon Monoxide (CO) gas detector (UL 2075) •Heat detector (UL 521) with five (5) possible field -selectable temperatures; combined with four (4) rate -of-rise options •Direct, in-duct (plenum) detector (UL 268A) •Supervisory monitoring for CO levels and temperature ranges •NFPA 76 (Telco Standard) as VEWFD •Low -temperature warning signal at 40°F (4.4°C) for sprinkler systems, per NFPA 25 / NFPA 72 For instance, the signals from the detector’s sensors are monitored and processed via the ASA–patented algorithm technology, which combines the signals into a neural network to create an intelligent, multi-criteria addressable detector. Siemens Smart Infrastructure - Building Products –2– usa.siemens.com/fire Product Overview – (continued) The encompassing result is an intelligent detector that provides enhanced detection capability to a wide range of products of combustion – while offering unsurpassed rejection to nuisance-alarm sources, including: dust | steam | cooking aerosols and other deceptive phenomena that could cause false alarms. It is known at Siemens as the “No-false-alarm guarantee”. Since Model FDOOTC441 is a two-wire, addressable device, it is then able to function as a multi-purpose detector – satisfying the revised requirements of UL 268 7 th edition using smoke, heat and CO gas detection in a singular, aesthetically pleasing package. Comparable to other multi-functional detectors, Model FDOOTC441 also serves as a very cost-effective, viable detection solution that saves on product | installation | maintenance costs. The unit’s value is multiplied with built-in ISOtechnology the True Class-X - NFPA 72 compliant SLC isolation feature supporting up to 252 isolation ready devices per loop. When used in mixed mode a maximum of 30 non-isolated devices between isolation devices (wired in polarity-insensitive mode). Each detector fits into one (1) wall-or-ceiling footprint, and only occupies one (1) address on the signal-line circuit (SLC). A patented forward-and-backward, light-scattering technology, which can distinguish both small and large products of combustion, operates at the core of each Model FDOOTC441 intelligent, addressable CO -with-ASA sensor. Each Model FDOOTC441 detector provides an eco-friendly solution to legacy ionization detectors - eliminating the need for a radioactive source, along with inevitable HAZMAT-disposal requirements. Therefore each detector is capable of detecting both smoldering and flaming fires ─ all in ecologically efficient manner ─ and is a valid, RoHS-compliant (Restriction of Hazardous Substances) detection alternative to legacy i onization detectors. Two (2) thermal sensors, as well as an electromechanical CO sensor, are included, making e ach Model FDOOTC441 detector a robust, reliable device suitable for the most challenging applications. Additionally, Model FDOOTC441 also works as a carbon-monoxide (CO) life-safety gas detector, compliant with NFPA 72 and UL2075. Operation Forward-and-Backward Light-Scattering Technology The high-quality, optical-electronic measuring chamber for each Model FDOOTC441houses the following components:  Two (2) optical transmitters  Two (2) thermal sensors  One (1) optical receiver  One (1) CO sensor The transmitters illuminate the smoke particles from different angles: one sensor creates forward scatter, and the other sensor creates backward scatter. The scattered light subsequently reaches the receiver (photodiode) and generates a measurable electric signal. The combination of a forward-and-backward scatter facilitates optimum detection, as well as differentiates between light-and-dark particles / particle size. This type of detection creates standardized, responsive behavior, therefore optimizing the differentiation between wanted signals and deceptive phenomena. Additionally, the heat sensors make it possible to detect fires without smoke generation. The CO sensor enables faster detection of fires with incomplete combustion, as well as fires with the development of high levels of CO. The combination of optical, thermal and CO signals optimizes detection reliability. Additionally, this scenario generates the following advantages: ✓ Early detection of all fire types of fire ─ whether they generate light -or-dark smoke, or no smoke ✓ The fire detector can be operated at a lower sensitivity level, thus achieving a higher immunity against false alarms that may otherwise be caused by cold aerosols (e.g . ─ by smoking, electrical welding, etc.) In the case of an open fire, the smoke sensitivity is heightened by a temperature increase – a detection-reliability level that is comparable to a wide-spectrum smoke detector – that can be achieved and maintained. Model FDOOTC441 Forward-and-Backward Light-Scattering Technology (with CO sensor) 4. Forward scatterer 5. Labyrinth 6. CO sensor 1. Heat sensors 2. Receiver 3. Backward scatterer In the case of an open fire, the smoke sensitivity is heightened by a temperature increase – a detection-reliability level that is comparable to a wide-spectrum smoke detector – that can be achieved and maintained. Siemens Smart Infrastructure – Building Products –3– usa.siemens.com/fire Operation – (continued) Field-Device Programmer / Test Unit Model FDOOTC441 is compatible with the Siemens field-device programmer / test unit (Model DPU), which is a compact, portable menu-driven accessory for electronically programming and testing these addressable detectors promptly and reliably. For instance, the field technician selects the accessory’s program mode, and enters the desired address. Model DPU eliminates the need for cumbersome, unreliable mechanical programming methods (e.g. – dials and rotary switches), and reduces installation and service costs by electronically programming and testing the detector prior to installation. When set in `test’ mode, Model DPU will perform a series of diagnostic tests without altering the address or other stored data, allowing technicians to determine if the detector is operating properly. Each field-device programmer / test unit operates on AC power or rechargeable batteries, providing flexibility and convenience in the programming / testing of fire -safety equipment from practically any location. Additionally, with the use of a Model DPU unit, there is no longer a cause for concern with any vibration, corrosion and other deteriorating conditions that could negatively affect any electro-mechanical-addressing mechanism. Field-selectable application profiles Model FDOOTC441 provides 26 user-friendly, field-selectable application profiles, identified with universally known names (e.g. ─ hotel | Telco | office | parking garage | dormitory | data center, etc.) Refer to installation manual: P/N ─ A6V10324657 for a complete list and description of application profiles. Due to generic-name classifications, no cross-reference tables are required as the application name resides in the panel’s configuration tool. This user-friendly feature ─ along with the algorithms provided by ASAtechnology ─ provides a reliable, field-configurable detector suitable for an array of applications. Field-selectable temperature settings Model FDOOTC441 provides five (5) field-selectable temperature thresholds, ranging from 135°F to 175°F (57°C to 79°C), with fixed and rate-of-rise options. These ranges provide maximum flexibility to program and to easily adjust the temperature settings that suit multi-application needs with a building or in changing environmental conditions. Model FDOOTC441 can be configured to provide a low-temperature warning signal at 40°F (4.4°C). Additionally, Model FDOOTC441 occupies only one (1) address on the SLC and provides a CO cell end-of-life warning and fault condition meeting NFPA 72 and UL 2075 requirements. This configuration (along with connection to a compatible Desigo Fire Safety Modular | FireFinder XLS/V | FC/FV20–series FACP) meets NFPA 72 requirements for sprinkler-temperature monitoring, and serves to prevent water freezing inside pipes, relative to water-based suppression systems. Ambient supervisory feature for temperature -threshold ranges, relative to Carbon Monoxide (CO) Another significant characteristic for Model FDOOTC441 CO detectors lies in the supervision of ambient temperatures. A specified, unique warning point at a customized temperature threshold ranging from -4°F to 120°F (-20°C to 49 °C) can be set manually. This feature is practical for monitoring of machinery; special processes, or for environments where maintaining a temperature is critical as an early-warning supervisory signal. Optionally, Model FDOOTC441 also provides supervision of the carbon -monoxide (CO) level selected by the customer. The CO supervision is provided in addition to the normal UL2075 and NFPA 72 alarm levels, and is user-customized for special applications. The range for configuration of each Model FDOOTC441 device to a compatible Siemens FACP is 30 – 600 parts-per-million (PPM). CO Detection In addition to the multi-criteria functionality, each Model FDOOTC441 detector provides an independent CO life-safety signal that meets the requirements of NFPA 72 and UL2075 and meets CO-sensitivity limits under UL2034 Standard. Additionally, Model FDOOTC441 detectors functions from a reliable electrochemical CO cell, transmitting CO concentration on an independent signal separate from the fire -detection signals to the FACP. This method is especially useful for any building that uses fossil-burning fuel sources, due to the potential of increased CO intoxication risk. Some application examples include: hotel | heating rooms | indoor parking lots and automotive workshops | combustion power plants | chemical labs | production sites. Self-monitoring for smoke-sensor sensitivity Model FDOOTC441 provides an automatic self-monitoring sensitivity check that complies with the NFPA 72 sensitivity requirements. When connected with a compatible FACP, it provides automatic, dynamic sensitivity verification within the agency-listed-and-approved limits. Besides checking for sensor integrity and automatic environmental compensation, Model FDOOTC441 provides a display and report of sensitivity in percent-per-foot (or percent-per-meter) at the FACP. Siemens Smart Infrastructure - Building Products –4– usa.siemens.com/fire Operation – (continued) Profile Overview Each Model FDOOTC441 intelligent detector contains one (1) tri-color LED indicator, capable of flashing any one (1) of three (3) distinct colors: GREEN, YELLOW, or RED. During each flash interval, the microprocessor-based detector monitors the following: • Smoke in its sensing chamber • Smoke sensitivity is within the range indicated on the nameplate label • Internal sensors and electronics Based on the results of the monitoring, the LED indicator flashes the following: FLASH COLOR CONDITION FLASH INTERVAL [in seconds] GREEN: Normal supervisory operation. Smoke sensitivity is within rated limits. 10 YELLOW: Detector is in trouble and needs replacement. 4 RED: Alarm condition 1 NO FLASH: Detector is not powered. –  denotes LED can be turned OFF Please follow the corresponding description of the panel used. A quick visual inspection of the detector can be done at any time since the appropriate color is displayed via the LED indicator found on the detector’s faceplate. Installation All Model FDOOTC441 intelligent, addressable detectors use a surface -mounting base (Model DB-11 or DB-11E), which mounts on a 4-inch (10.2 cm.) octagonal, square or single-gang electrical back box. The base utilizes screw-clamp contacts for electrical connections and self-wiping contacts for increased reliability. The Model DB-11 detector base can be used with the optional Siemens Model LK-11 detector locking kit, which contains 50 detector locks and an installation tool to prevent unauthorized removal of the detector head. Model DB-11 has decorative plugs to cover the outer mounting -screw holes. Model FDOOTC441may be installed on the same initiating circuit with the Siemens Model `H’-series detectors [when used with Desigo Fire Safety Modular | FireFinder XLS/V | FC/FV20–series FACPs] – • HFP-11, HFPT-11 • Model `XTRI’-series interfaces • Model `HTRI’-series interfaces • Model HCP output-control detection devices • Model `HMS’-series manual stations • Model `HZM’-series of addressable, conventional zone modules Each detector, which is shipped with a protective dust cover, consists of the following: • Dust-resistant photoelectric chamber • Solid-state, non-mechanical thermal sensor • CO sensor • Microprocessor-based electronics with a low-profile plastic housing All Model FDOOTC441 intelligent detectors are approved for operation with the Underwriters’ Laboratories - specified temperature range of 32° to 120° (0° to 49°C) ─ depending on heat-detector configuration (see: installation manual P/N ─ A6V10324657 for further details). Mounting Diagrams | Dimensio ns 1. Model FDOOTC441 addressable detector 2. Protective dust cover (included) Model FDOOTC441 Model FDOOTC441 [with Model DB-11 detector base] Model FDOOTC441 [with Model DB-11E detector base] Siemens Smart Infrastructure - Building Products –5– usa.siemens.com/fire Application Data Installation of Model FDOOTC441 intelligent, addressable detector requires a two-wire circuit. In many retrofit cases, existing wiring may be used. `T-tapping’ is only allowed for Style 4 (Class B) wiring. Model FDOOTC441 is polarity insensitive, thus reducing installation and debugging times. Model FDOOTC441 detectors can be applied within the maximum 30-feet center spacing (900 sq. ft. areas,) as referenced in NFPA 72. This application guideline is based on ideal conditions − specifically, smooth ceiling surfaces, minimal air movement, and no physical obstructions between potential fire sources and the actual detector. Do not mount detectors in close proximity to ventilation or heating and air conditioning outlets. Exposed joists or beamed ceilings may also affect safe spacing limitations for detectors. Should questions arise regarding detector placement, observe NFPA 72 guidelines. Good fire-protection-system engineering and common sense dictate how and when fire detectors are installed and used. Contact your local Siemens − Fire Safety distributor or sales office whenever you need assistance applying Model FDOOTC441 in unusual applications. Be sure to follow NFPA guidelines and UL Listed / ULC Listed installation instructions − included with every Siemens − Fire Safety detector − and local codes as for all fire protection equipment. Technical Data OPERATING TEMPERATURE: +32° – +120°F (0° – +49°C) HEAT DETECTOR RANGE: +135° – +175°F (+57° – +79°C) PROGRAMMABLE SUPERVISORY TEMPERATURE WARNING: -4° – +120°F (-20° – +49°C) (available with compatible FACPs) PROGRAMMABLE SUPERVISORY CO-GAS WARNING: 30 – 600 ppm (available with compatible FACPs) DETECTOR SENSITIVITY RANGE: UL Listed: 0.88 to 3.35% / ft. NFPA 76 (Telco) VEWFD: 0.2% / feet Pre-alarm; 1.0% / feet Alarm AIR VELOCITY: 0 − 4,000 feet-per-minute (fpm) 0 − 4,000 fpm Open Area: Direct-in-duct: AIR PRESSURE: No effect ACTIVE, STA NDBY CURRENT: 0.75 mA APPLICATION PROFILES: 26 (field-configurable) CO CONCENTRATION RESPONSE TIMES 70±5 PPM in 60 – 240 min. 150±5 PPM in 10 – 50 min. 400±10 PPM in 4 – 15 min. NOTE: meets UL2075 Standard, and has been tested to the sensitivity limits defined in UL2034 Standard. Additionally complies with NFPA 72 code RELATIVE HUMIDITY: 0 – 95% (non-condensing) Approvals | Standards FACTORY MUTUAL (FM) 3210, 3220 CALIFORNIA STATE FIRE MARSHAL (CSFM) 7272-0067:0260 UNDERWITERS LABORATORES (UL | ULC) UL268 UL2034 UL268A UL2075 UL521 ULC-S524 NAT IONAL FIRE PROTECTION AGENCY NFPA 25 NFPA 72 NFPA 76 FIELD-SELECTABLE TEMPERATURE PROFILES FIXED TEMPERATURE: 135°F (57.2°C) 145°F (62.8°C) 155°F (68.3°C) 165°F (73.9°C) 175°F (79.4°C) FIXED TEMPERATURE + RATE-OF-RISE: (R-O-R) 135°F (57.2°C) + R-o-R, 15°F (-9.4°C) 175°F (79.4°C) + R-o-R, 15°F (-9.4°C) 135°F (57.2°C) + R-o-R, 20°F (-6.6°C) 175°F (79.4°C) + R-o-R, 20°F (-6.6°C) FIELD-SELECTABLE ALARM-THRESHOLD PROFILES THRESHOLD: 2.5% / feet 3.0% / feet THRESHOLD, VERIFIED: 2.5% / feet 3.0% / feet Panel Compatibilities MODEL OR TYPE DATA SHEET PANEL XLS 6300 FireFinder® (fire) XLSV 6340 FireFinder (fire w/ voice ) DESIGO MODULAR 7300 Desigo Modular (overview) FC2005 6813 Desigo Fire Safety 50-point addressable FC2025 6815 Desigo Fire Safety 252-pt. addressable (fire ) FC2050 Desigo Fire Safety 504-pt . addressable (fire ) FV2025 6821 Desigo Fire Safety 252-point addressable (fire w / Intelligent Voice Communication [I VC]) FV2050 Desigo 504-pt. addressable (fire w / Intelligent Voice Communication [I VC]) MODEL OR TYPE PART NUMBER PRODUCT FDOOTC441 S54320-F8-A1 Multi-Criteria Fire | CO Detector with ASAtechnology Compatible Devices: MODEL OR TYPE PART NUMBER PRODUCT DB-11 500-094151 Detector Mounting Base DB-11E 500-094151E De tector Base, small DB2-HR S54370- F12-A1 De tector Mounting Base with Relay RL-HC 500-033230 Remote Alarm Indicator: 4” (10.2 cm) octagon -box mount, red RL-HW 500-033310 Remote Alarm Indicator: single-gang box mount, red LK-11 500-695350 Base Locking Kit See: www.STI-USA.com for further details on ordering Model ST I-9604 In Canada order: MODEL OR TYPE PART NUMBER PRODUCT DB-11C 500-095687 Detector Mounting Base, ULC Listed Details for Ordering Thermal Ratings NOTICE – The information contained in this data -sheet document is intended only as a summary, and is subject to change without notice. The product(s) described here has/have a specific instruction sheet(s) that cover various technical, limitation and liability information . Copies of install-type, instruction sheets – as well as the General Product Warning and Limitations document , which also contains important data , are provided with the product, and are available from the Manufacturer. Data contained in the aforesaid type of documentation should be consulted with a fire-safety professional before specifying or using the product. Any further questions or assistance concerning particular problems that might arise, relative to the proper functioning of the equipment, please contact the Manufacturer. Desigo® Fire Safety Siemens Industry, Inc. Smart Infrastructure – Building Products 8 Fernwood Road • Florham Park, NJ 07932 Tel: (973) 593-2600 October - 2020 (Rev. 8) Detector Bases [‘DB’ Series] 6161 s Industry, Inc. Building Technologies Division s Data Sheet Fire Safety & Security Products Specialized Detection Devices ‘DB’ Series Detector Bases Models DB2-HR, DB-11 and DB-11E ARCHITECT AND ENGINEER SPECIFICATIONS  Each detector base is compatible with Model ‘H’, “11” and “121” series of conventional detectors  All bases compatible with the optional Model LK-11 detector-locking kit  Each detector base also functions with the addressable Model ‘H’ series, as well as Models FDO421, FDOT421, FDOOT441, FDOOTC441 and FDT421 intelligent devices  Model DB2-HR is also compatible with ASAtechnology detectors  Model DB2-HR has backwards compatibility with Siemens Model 'H'-series intelligent detectors  Models DB-11 and DB-11E mount on a 4-inch square, octagon or single-gang electrical box  Model DB-11 has plugs to cover the outer-mounting screw holes  Model DB2-HR mounts on a 4’’-square, double- gang electrical box Product Overview The detector bases are low-profile, surface-mounting bases used on various Siemens ─ Fire Safety conventional and addressable detectors. Model DB2-HR, which is a redesign of Model DB-HR, is compatible with the standard, addressable type of intelligent detectors, as well as those detection devices that operate with ASAtechnology™. Additionally, Model DB2-HR is backward compatible with the Siemens Model 'H'-series intelligent detectors and detector-assigned FACPs. Model DB2-HR can also operate with Siemens' 50-point addressable; 252-point addressable; 504-point addressable, and FireFinder® XLS fire systems. A relay output from the fire detector base for signaling other devices is provided by Model DB2-HR. The detector bases use screw-clamp contacts for electrical connections and self-wiping contacts for better reliability. Further, the bases can be used with the optional Model LK- 11 detector locking kit, which contains 50 detector locks and an installation tool, to prevent unauthorized removal of the detector head. Specifications Models DB-11 and DB-11E are the standard bases for Model ’H’-series “11” and Model “121”-series conventional detectors, as well as the Model ’H’-series addressable detectors. Model DB-11 has a 6-inch (15.2 cm) diameter. The diameter for Model DB-11E is 4.5 inches (11.4 cm). Specifications ─ (continued) Moreover, Models DB-11 and DB-11E mount on a 4’’-square, (10.2 cm) octagon or single-gang box. Model DB-11 has integral, decorative plugs to cover the outer screw holes. However, Model DB2-HR mounts on a double-gang, 4-inch (10.2 cm.) square electrical box. Dimensions Note: Model DB-11E base detector has a diameter dimension of 4.5’’ (11.4 cm.). Model DB-11 Model DB-11E Model DB2-HR Notes: The Module Barrier (shown to the right) must be used when Model DB2-HR relay contacts are connected to non-power-limited circuits. Break apart the barrier to the correct size and shape for either the 4-inch square or double-gang box. Install the barrier diagonally into the back box to create two (2), separate compartments with the back box, in order to separate the wires. Mounting Diagram Model DB2-HR Model DB-11  UL 268 Listed,ULC-S529 Listed; FM, CSFM and NYC Fire Department Approved s Industry, Inc. Building Technologies Division Fire Safety 8 Fernwood Road Florham Park, NJ 07932 Tel: (973) 593-2600 FAX: (908) 547-6877 URL: www.usa.Siemens.com/Fire (SII-FS) Printed in U.S.A. Fire Safety 2 Kenview Boulevard Brampton, Ontario L6T 5E4 / Canada Tel: (905) 799-9937 FAX: (905) 799-9858 September 2012 Supersedes sheet dated 4/12 (Rev. 1) Wiring Diagrams Note: The illustration above is typical wiring for Models DB-11 and DB-11E (using Models PE-11, PE-11T, DT-11, OP121, OH121, and HI121 detectors). Note: The illustration above is typical wiring for Models DB-11 and DB-11E (using Models FP-11, FPT-11, FS-DP, FS-DPT, and FS-DT detectors). Note: The illustration above is typical wiring for Models DB-11 and DB-11E (using Models HFP-11 Series and SFP-11 Series detectors). Note: The illustration above is typical wiring for Model DB2-HR for polarity-insensitive detectors). Details for Ordering Model Number Part Number Description AD2-P 500-649706 Air-Duct Housing AD2-PR 500-649707 Air-Duct Housing with Relay DB-11 500-094151 Low-Profile Surface-Mount Base DB-11C 500-095687 Low-Profile Surface-Mount Base [Canada] DB-11E 500-094151E Smaller-Diameter Detector Base DB-HR 500-033220 Relay Base for ‘H’-Series Intelligent Detector DB2-HR S54370-F12-A1 Relay base compatible with ‘S’-Line and ‘C’-line detectors; backwards compatible with Model ‘H’-series detectors DT-11 500-095430 135°F {57.2°C}Low-Profile Thermal Detector DT-11C 500-095983 Low-Profile Thermal Detector [Canada] FDO421 S54320-F4-A1 Photoelectric Smoke Detector FDOT421 S54320-F6-A1 Addressable Multi-Criteria Fire Detector FDT421 S54320-F5-A1 Thermal (Heat) Detector FDOOT441 S54320-F7-A1 Multi-Criteria Fire Detector with ASAtechnologyTM FDOOTC441 S54320-F8-A1 Multi-Criteria Fire / CO Detector with ASAtechnologyTM LK-11 500-695350 Base Locking Kit for Model ‘11’-series detectors Notice: This marketing data sheet is not intended to be used for system design or installation purposes. For the most up-to-date information, refer to each product’s installation instructions. Model Number Part Number Description FP-11 500-095112 FirePrintTM Intelligent Detector FP-11C 500-095112C FirePrintTM Intelligent Detector [Canada] FPT-11 500-095918 Thermal Detector FPT-11C 500-095918C Thermal Detector [Canada] HFPO-11 500-034800 FS-250 Addressable Detector HFP-11 500-033290 FirePrintTM Detector HFPT-11 500-033380 Thermal Detector HI121 S54372-F3-A1 Heat Detector OH121 S54372-F2-A1 Multi-Sensor Smoke Detector OP121 S54372-F1-A1 Photoelectric Smoke Detector PE-11 500-094150 Conventional Photoelectric Smoke Detector PE-11T 500-095150 Photoelectric Smoke Detector with 135°F {57.2°C} Thermal Sensor SFP-11 500-33290C Photo / Thermal Detector [Canada] SFPO-11 500-34800C Photo Detector [Canada] SFPT-11 500-033380C Detector Package [Canada] Model ABHW-4B Audible (Sounder) Base 6159 s Industry, Inc. Building Technologies Division s Data Sheet Fire Safety Products Detection Bases Intelligent Audible (Sounder) Base [with Loop-Power Option] Model ABHW-4B Product Overview The Model ABHW-4B Audible (Sounder) Base from Siemens — Fire Safety is an intelligent, supervised and addressable detector base designed for use in standard applications in which an audible notification device is required. The Model ABHW-4B base generates a 3,000 Hz audio signal that complies with NFPA 72 Standard. When used with a Desigo intelligent detector, Model ABHW-4B ─ which is UL / ULC Listed ─ has the option of being powered directly from a signal line circuit (SLC) in a two-wire configuration. In turn, this connection feature gives each audible (sounder) base the distinction of being the first base of its kind to attain agencies’ approval. The loop-power feature and advanced configuration options contained with each audible (sounder) base are not available when a Siemens Model ‘H’-series detector is used. Conversely, Model ABHW-4B will function similar to that of a Model ADBH-11 audible base when a Model ‘H’ or ‘S’-series detector is used. The innovative loop-power option provides easier two-wire connection for new or expansion applications where additional wiring or power options are limited. Additionally, Model ABHW-4B can be powered in a traditional four-wire configuration, utilizing a notification- appliance circuit (NAC); a Siemens PAD-series NAC extender; Model ZIC-4A, or any UL Listed, 24VDC regulated power supply. Note: See the Model ABHW-4B Installation and Operation Manual (IOM: A6V10405587) for further details. Model ABHW-4B provides six (6) field-configurable tone patterns: two (2) volume levels are used with compatible Siemens intelligent, addressable detectors and FACPs. Steady; Temporal 3 pattern; Temporal 4 pattern; Temporal 4 with low-power; March Time 120 and Canadian March Time 30 are supported by each audible (sounder) base. Audible (sounder) bases wired in the same device loop circuit are fully synchronized with the Desigo Fire Safety S- Line and C-Line detectors, and support Siemens Remote Lamps, Models RL-HC and RL-HW. When used in conjunction with agency-listed / compatible Siemens fire components, Model ABHW-4B may be used in lieu of a single / multiple station smoke alarms to achieve enhanced, system-level functionality. • Innovative two-wire, loop-power option • Highly flexible programming and configuration options with independently controlled outputs by device • Provides six (6) field-configurable audible-tone patterns: − Steady − American National Standards Institute (ANSI) Temporal 3 − ANSI Temporal 4 (Carbon Monoxide [CO]) − March time 120 (and Canadian March time 30) • Synchronization by loop • Power options include: − NACs − Loop (two-wire) − Siemens PAD-series NAC Extenders − Model ZIC-4A (for FireFinder® XLS FACPs) − Any other UL Listed, 24VDC regulated power supply ARCHITECT AND ENGINEER SPECIFICATIONS ABHW-4B (Back View) ABHW-4B (Front View) • Compatible with Desigo® Fire Safety intelligent devices and Siemens ‘H’-series and ‘S’-series addressable detectors • Standard 3,000 Hz Buzzer tone • UL268, UL464 & UL2075 Listed, ULC-S525 / -S529 Listed; FM (#3150, 3230 & 3010) & CSFM (#7300-0067:0271) Approved s Industry, Inc. Building Technologies Division Fire Safety 8 Fernwood Road Florham Park, NJ 07932 Tel: (973) 593-2600 FAX: (908) 547-6877 URL: www.usa.Siemens.com/Fire (SII-FS) Printed in U.S.A. Fire Safety 1577 North Service Road East Oakville, Ontario L6H 0H6 / Canada Tel: [905] 465-8000 URL: www.Siemens.CA March 2016 Supersedes sheet dated 3/2015 (Rev. 4) Specifications Each audible (sounder) base consists of a standard Siemens — Fire Safety Series ‘11’ detector-base layout — combined with supportive circuitry for Desigo Fire Safety and Model ‘HFP / ‘SFP’-series of addressable detectors. Model ABHW-4B houses a pre-wired, audible (sounder) device capable of generating a 3,000 Hz tone that provides a signal up to 85dBA at 10 feet (3.1m) for localized annunciation. Several options are available to provide power to the Model ABHW-4B audible base. Additionally, all Model ABHW-4B bases are capable of sounding simultaneously, individually or in any combination — depending upon the system configuration used on a Siemens FACP. Note: For power and wiring options, see IOM: A6V10405587. Model ABHW-4B is a UL / ULC Listed supplementary smoke-detection device that meets or exceeds the 85dB at 10 ft. (3.1m) audibility requirement specified in UL268, ULC-S525, ULC-S529 — as well as UL464 / UL2075, except for 520 Hz, low-frequency tones. Compatibility with s FACPs Model ABHW-4B functions with the following panels: FACP System Type FireFinder® XLS Person Machine Interface (PMI) v10.02 (or later) Zeus Custom-Configuration Software v10.02 (or later) Device Loop Card (Model DLC) v6.01 (or later) Model FC2005 Desigo 50-point addressable FACP v01.04.20 (24), Software-tool v01.02.16 (53) Models FC2025 / FC2050 Software-tool v6.0.0R1 (or later) Application Data The smoke detectors used with Model ABHW-4B are subject to the maximum 30 ft. center spacing (900 sq. ft.) as referred to in the National Fire Protection Association Standard 72. This spacing, however, is based on ideal conditions ─ namely, smooth ceiling; no air movement, and no physical obstructions between the fire source and the device. The center-spacing format should be referred to as a guide for detector-installation layout. Do not mount detectors in areas close to ventilating or air-conditioning outlets. It is mandatory for NFPA 72 guidelines to be applied to detector placement and spacing. Technical Data Connections: Admissible Cross- Section Cable: 12 ─ 18 AWG (American Wire Gauge) Design: Two (2) back-end blocks of up to four (4) screw terminals on each side Technical Data – (continued) Electrical: Operating Voltage: Loop Power: 16 ─ 33 VDC External Power: 16 ─ 33 VDC Supervisory Current: (max) From SLC Loop: 250 μA From External Source: 20 μA Alarm Current: (RMS max) Loop Power: High dBA: 7.5 mA Low dBA: 4.5 mA External Power: High dBA: 8.0 mA Low dBA: 3.5 mA Physical: Operating Temperature: 32° ─ 120°F (0° ─ 49°C) Operating Humidity: 10 ─ 95%, non-condensing Sound Output: (max) High: > 85 dB Low: > 75 dB Mounting Box: 4-inch (10.2 cm.) square gang box Note: A 4” (10.2 cm.) octagon box is not compatible with Model ABHW-4B. Details for Ordering Model Part Number Description ABHW-4B S54320-F13-A1 Audible (Sounder) Base [with Loop-Power Option] ABHW-4BZ S54320-F13-A2 Buzzer-Version Audible Base [3KHz tone – C.O.O. USA] Compatible Intelligent Detectors Model Part Number Description FDO421 S54320-F4-A1 Optical Detector FDT421 S54320-F5-A1 Heat Detector FDOT421 S54320-F6-A1 Optical / Heat Detector FDOOT441 S54320-F7-A1 Dual-Optical Heat Detector FDOOTC441 S54320-F8-A1 Dual Optical Heat (w/ CO) Detector Compatible Remote Lamps Model Part Number Description RL-HW 500-033310 Remote Alarm Lamp, Wall RL-HC 500-033230 Remote Alarm Lamp, Ceiling Compatible ‘H’ / ‘S’ Series Detectors Model Part Number Description HFP-11 500-033290 ‘H’-Series Optical / Heat Detector HFPT-11 500-033800 ‘H’-Series Heat Detector HFPO-11 500-034800 ‘H’-Series Optical Detector SFP-11 500-033290C ‘S’-Series Optical / Heat Detector SFPT-11 500-033800C ‘S’-Series Heat Detector SFPO-11 500-034800C ‘S’-Series Optical Detector Notes: Models SFP-11, SFPO-11 and SFPT-11 detectors are approved exclusively in Canadian installations. Model ‘H’/ ‘S’-series bases are limited in audible-base functionality. Contact Technical Support at 1-800-248-7976 for further details. Notice: This marketing data sheet is not intended to be used for system design or installation purposes. Siemens Data Sheet 6169 Building Technologies Division usa.siemens.com/fire Product Overview The Siemens – Fire Safety Intelligent Remote Lamps (Models ILED-XC | ILED-XW) are specifically tailored for use with initiating devices that are concealed or otherwise not easily within view (e.g. – above suspended ceilings; under sub-floors, in unexposed ventilating ducts, normally locked vaults or closed rooms, etc.) The Intelligent Remote Alarm Lamps can connect to Siemens addressable fire-alarm control panels (FACPs). Model ILED-XC is mounted on a 4-inch (10.2 cm.) octagon outlet box. Model ILED-XW is fastened on a single-gang electrical box. The module uses one (1) address on the loop. 127(: Refer to installation manual: P/N – A6V101055484 to ensure Model ILED-XC | ILED- XW compatibility with the Siemens FACPs intended for use in the given application. Models ILED-XC and ILED-XW provide intelligent built-in, dual isolation, meeting Class X (Style 7) survivability requirements for shorts while providing reliable alarm communication to the Siemens FACP. Up to 190 isolators are allowed per loop and up to 30 devices can be connected between isolators (via wiring in a polarity-insensitive mode). The devices between isolators can be CH’-series or later CX’ generation devices. Specifications The isolation feature found on the Intelligent Remote Alarm Lamps gives information as to the location of the short. When a short occurs, the panel can identify the short automatically, and the module recognizes the short location (in front of the device or behind the device). Overall, the dual, built-in isolators improve the diagnostics and area of the short and report when a Class X module is misconfigured. The modules are configurable by compatible panel(s) in an isolator (polarity sensitive) or non isolator (polarity insensitive) mode. When a Model ILED-X-series lamp is configured as an isolator it may serve a dual purpose by simultaneously functioning as an input / output device and an isolator. Advanced troubleshooting is provided by compatible panels by identifying when an ILED-X-series device is configured as an isolator but is wired incorrectly in a polarity-insensitive mode. Although there is no regulatory limitation for mounting the lamps, be advised that Model ILED-XC is often ceiling mounted, and Model ILED-XW is intended for wall mounting. These intelligent remote lamps can be mounted on a Siemens compatible-panel device loop. Each LED can be controlled by FACP logic ņ even on different device loops or on another panel in the network configuration ņ since Model ILED-XC or Model ILED-XW is given its own unique address. Peripheral and Detection Devices Initiating Device Intelligent Remote Alarm Lamps Models ILED-XC | ILED-XW Model ILED-XC Remote Alarm Lamp, Ceiling Architect & Engineer Specifications †Multi-color intelligent light-emitting diode (ILED) mimics the detector: -Illuminates in any variation of GREEN | AMBER | RED †Dual, built-in isolators †Meets Class X (Style 7) survivability requirements †Low current draw †Restriction of Hazardous Substances (RoHS) compliant †Additional-accessory capability: -when used an audible base or relay base †Wall and ceiling lamps can be addressed and independently controlled by fire-alarm control panel (FACP) logic †Ceiling and wall can be mounted anywhere on a device loop : -e.g. – communication loop or the wiring on that loop †UL864 | UL2572 | UL2017 Listed; CAN/ULC-S527 & CAN/ULC-S576 Listed -File S24304, Vol. 3 Model ILED-XW Remote Alarm Lamp, Wall 127I&(±7KHLQIRUPDWLRQFRQWDLQHGLQWKLVGDWDVKHHWGRFXPHQWLVLQWHQGHGRQO\ DVDVXPPDU\DQGLVVXEMHFWWRFKDQJHZLWKRXWQRWLFH 7KHSURGXFW V GHVFULEHGKHUHKDVKDYHDVSHFLILFLQVWUXFWLRQVKHHW V  WKDWFRYHUYDULRXVWHFKQLFDOOLPLWDWLRQDQGOLDELOLW\LQIRUPDWLRQ &RSLHVRILQVWDOOW\SHLQVWUXFWLRQVKHHWV±DVZHOODVWKH*HQHUDO3URGXFW :DUQLQJDQG/LPLWDWLRQVGRFXPHQWZKLFKDOVRFRQWDLQVLPSRUWDQWGDWD DUHSURYLGHGZLWKWKHSURGXFWDQGDUHDYDLODEOHIURPWKH0DQXIDFWXUHU 'DWDFRQWDLQHGLQWKHDIRUHVDLGW\SHRIGRFXPHQWDWLRQVKRXOGEHFRQVXOWHG ZLWKDILUHVDIHW\SURIHVVLRQDOEHIRUHVSHFLI\LQJRUXVLQJWKHSURGXFW $Q\IXUWKHUTXHVWLRQVRUDVVLVWDQFHFRQFHUQLQJ SDUWLFXODUSUREOHPVWKDWPLJKWDULVHUHODWLYHWRWKH SURSHUIXQFWLRQLQJRIWKHHTXLSPHQWSOHDVHFRQWDFW WKH0DQXIDFWXUHU Operation Field-Device Programmer / Test Unit Each Remote Alarm Lamp is programmed with the Siemens field-device programmer / test unit (Model DPU), which is a compact, portable and menu-driven accessory for electronically programming and testing Siemens peripheral modules and devices promptly and reliably. For instance, the field technician selects the accessory’s program mode, and enters the desired address. Vibration, corrosion and other conditions that deteriorate mechanical-addressing mechanisms are no longer a cause for concern. Each remote alarm lamp is connected to Model DPU with the programming cable provided with the tester. This programming cable (P/N 110-694927) utilizes two (2) clip connectors to attach to a Model ILED-XC | Model ILED-XW lamp. 127(: Since the Class X Intelligent Remote Alarm Lamps are advanced initiating devices, the latest Model DPU firmware update is required. When set in Ctest’ mode, Model DPU will perform a series of diagnostic tests without altering the address or other stored data, allowing technicians to determine if the detector is operating properly. Each field-device programmer / test unit operates on AC power or rechargeable batteries, providing flexibility and convenience in the programming / testing of fire- safety equipment from practically any location. Additionally, with the use of a Model DPU unit, there is no longer a concern with any vibration, corrosion and other deteriorating conditions that compromises the vitality of a mechanical-addressing mechanism. Application Note Models ILED-XC and ILED-XW can also be utilized as a second accessory of a detector when assigned to respond to detectors that have remote relay or audible bases. Temperature and Humidity Range The Remote Alarm Lamps are UL Listed |ULC Listed. Environmental operating conditions for each Remote Lamp is 32ºF (0ºC) to 120ºF (49ºC) with a relative humidity of no greater than 95%, non-condensing. Technical Data 23(5$7I1* 92/7$*(5$1*(9'&±9'& R(/$7I9( H80I'I7< ± QRQFRQGHQVLQJ C$&7I9(’25C67$1'%<’ &855(170$; ȝ$ LI1(SI=(6 $0(5I&$1:I5( G$8*( $:*  $:*PD[ $:*PLQ 02'(/ 25 7<3( 3$57 180%(5352'8&7 ILED-XCS54370-B6-A1 IQWHOOLJHQW5HPRWH /DPS&HLOLQJ ZLWKEXLOWLQLVRODWRU ILED-XW S54370-B5-A1 IQWHOOLJHQW5HPRWH /DPS:DOO ZLWKEXLOWLQLVRODWRU  DPU 500-033260 'HYLFH3URJUDPPHU 7HVW8QLW Ceiling | Wall Remote Alarm Lamps Details for Ordering 1.ILED-XC faceplate 2.Single-gang switchbox (user supplied) 3.Blank, single-gang plate Siemens Industry, Inc. Building Technologies Division 8 Fernwood Road ‡ Florham Park, NJ 07932 Tel: (973) 593-2600 September 2017 ņ1HZIVVXH (5HY) 1 2 3 127(7KHVLQJOHJDQJHOHFWULFDOER[ VHHQLQWKHLQWKHIDUULJKW&*, LVVXSSOLHGE\RWKHUV %2  Siemens Data Sheet 6167 Smart Infrastructure – Building Products usa.siemens.com/fire Product Overview The Siemens – Fire Safety XTRI-series Intelligent Interface Modules are designed to provide the means of interfacing direct shorting devices to the fire-alarm control panel (FACP) SLC. All modules take up one (1) address on the loop. Each XTRI-series interface module provides the “built -in” ISOtechnology feature - intelligent dual isolation meeting NFPA 72 Class X (Style 7) wiring requirements. Up to 252 isolators per loop and up to 30 devices between isolators (wired in polarity - insensitive mode). Additionally, the devices between isolators can either be ‘H’-series or the more contemporary ‘X’-series detection devices. Specifications The Siemens – Fire Safety XTRI-series Intelligent Interface Modules are available in three (3) individual types:  One (1) Dual-Input: XTRI-D  Two (2) Single-Inputs: XTRI-R (with relay) | XTRI-S − The single-input versions are each designed to monitor a normally open (N.O) or (N.C) normally closed dry contact XTRI-D | XTRI-R | XTRI-S incorporates ISOtechnology – the configurable, built -in dual isolator function. Additionally, an XTR I-series interface module supports NFPA 72 Class X (Style 7) survivability requirements for shorts while providing reliable alarm communication to the Siemens FACP. The isolation feature found on the XTR I-series Intelligent Interface Modules gives information as to the location of the fault. When a short occurs, the panel can identify the fault automatically, and the module recognizes the short location (in front of the device or behind the device). Overall, the built-in isolators improve the diagnostics and location of the problem, including a short. The modules are configurable by a Siemens compatible FA CP (or panels) in an isolator (polarity sensitive) or non-isolator (polarity insensitive) mode. When a XTRI- series interface module is configured as an isolator, that module has the capacity of functioning as both an in/out device, as well as an isolator. Advanced troubleshooting is provided by compatible panels by identifying when a XTR I-series interface module is configured as an isolator, but is wired incorrectly in a polarity-insensitive mode. Each Model XTR I-series device has a multi-color LED that flashes when GREEN operating in Normal mode; AMBER if the unit is in a `Trouble’ condition, and RED to indicate a change of status. Model XTRI-S This single-input interface module can only monitor and report the status of a N.O. or N.C. contact . Peripheral and Detection Devices Initiating Devices Intelligent Device Interface Modules Model XTR I-D | XTRI-R | XTRI-S Model XTRI-D | XTRI-R | XTRI-S Intelligent Device Interface Module  Built-in dual isolators: - Modern technology supports comprehensive system-and- interface communication - Allows up to 190 isolators per loop and 30 devices between isolators  Dual input on Model XTRI-D, via a single address  Integral single-pole, double-throw (SPDT) relay on Model XTRI-R: - Up to 4 Amps.  Meets Class X (Style 7) survivability requirements  Low current draw  Polarity insensitive (in non-isolation mode) via SureWire™ technology: - Modern technology supports comprehensive system and interface communication  Multi-color light-emitting diode (LED) indicates system status: - GREEN | AMBER | RED  Mounts in a 4-inch (10.2 cm.) square, 2–¼” (5.7 cm.) deep single-gang or double-gang back box  Non-obstructive front-end access to programming port and wiring terminals  Device Programmer | Test Unit programs and verifies address, as well as tests device functionality  Restriction of Hazardous Substances (RoHS) compliant  UL864 | UL2572 | UL2017 Listed; CAN/ULC-S527 & CAN/ULC-S576 Listed - File S24304, Vol. 3 Architect & Engineer Specifications  Siemens ISOtechnology™ - Provides “True Class – X” operation to NFPA 72 SLC field wiring requirements - Supports 252 ISOtechnology ready devices per loop, and in mixed mode up to 30 devices between isolated devices  Dual input on Model XTR I-D, via a single address  Integral single-pole, double-throw (SPDT) relay on Model XTR I-R: - Up to 4 Amps.  Low current draw  Polarity insensitive (in non-isolation mode) via SureWire™ technology: - Modern technology supports comprehensive system and interface communication  Multi-color light-emitting diode (LED) indicates system status: - GREEN | AMBER | RED  Mounts in a 4-inch (10.2 cm.) square, 2– ¼” (5.7 cm.) deep single-gang or double-gang back box  Non-obstructive front-end access to programming port and wiring terminals  Device Programmer | Test Unit programs and verifies address, as well as tests device functionality  Restriction of Hazardous Substances (RoHS) compliant  UL864 | UL2572 | UL2017 Listed; CAN/ULC- S527 & CAN/ULC-S576 Listed - File S24304, Vol. 3 Siemens Smart Infrastructure – Building Products –2– usa.siemens.com/fire Spe cifications – (continued) Mounting Data Model XTRI-R Through the use of an addressable ‘Form C’ relay, the Model XTRI-R relay and contact device input are controlled at the same address. The relay and input contact can be controlled as a separate function from a Siemens compatible FACP. The relay is typically used where control or shunting of external equipment is required. Model XTRI-D Model XTRI-D is a dual-input module that is designed to supervise and monitor two (2) sets of dry contacts. Model XTRI-D only requires one (1) address, but responds independently to each input. Model XTR I-D is ideal for monitoring a water-flow switch and its respective valve tamper switch. Operation Field-Device Programmer / Test Unit Siemens – Fire Safety innovative technology allows Model XTRI-series intelligent interface modules to be programmed via the Siemens field-device programmer / test unit (Model DPU), which is a compact, portable and menu -driven accessory for electronically programming and testing Siemens peripheral modules and devices promptly and reliably. For instance, the field technician selects the accessory’s program mode, and enters the desired address. Model XTRI-series interface module is connected to Model DPU with the programming cable provided with the tester. N OTE: Since the XTRI-series of interface modules are advanced initiating devices, the latest Model DPU firmware update is required. Model DPU eliminates the need for cumbersome, unreliable mechanical programming methods (e.g. – dials and rotary switches), and reduces installation and service costs by electronically programming and testing the module prior to installation. When set in `test’ mode, Model DPU will perform a series of diagnostic tests without altering the address or other stored data, allowing technicians to determine if the module is operating properly. Each field-device programmer / test unit operates on AC power or rechargeable batteries, providing flexibility and convenience in the programming / testing of fire-safety equipment from practically any location. Additionally, with the use of a Model DPU unit, there is no longer a cause for concern with any vibration, corrosion and other deteriorating conditions that could negatively affect any electro-mechanical-addressing mechanism. Compatibilities Siemens `X’ modules may be used along with Model `H’-series intelligent detectors; Model `HMS’-series addressable manual stations, or any other `H’-series addressable intelligent module (e.g. Model HZM or Model HCP). Additionally the X- series modules are compatible with all Desigo and Cerberus Pro detectors and peripherals of the same circuit. Interspersing `X’ & `H’-series devices on the same loop is mostly permitted, but there are exceptions: Models HLIM (isolation module) and SBGA-34 (audible base) cannot be used with `X’ devices on the same loop. Model XTRI-D | XTRI-R | XTR I-S Intelligent Device Interface Module 1. 4” (10.2 cm.) square box | 2– 1/8” (5.4 cm.) back box 2. 3.5” (8.9 cm.) double -gang back box 3. 5” (12.7 cm.) square switch plate, (supplied) 1 . NOTES: Each interface module mounts directly to a user- supplied switchbox. The electrical boxes, seen above, are supplied-by -others (BO). Models XTRI-D, XTRI-R and XTRI-S mount directly onto a 4-inch (10.2 cm.) square, 2 ¼‘’ (5.7 cm.)–deep box back box, or to a user-supplied double-gang 3 ½” deep back box. A 5” (12.7 cm.) square, off-white faceplate is included in each shipment of a Siemens Model XTRI-series module. 2 . 3 . 3 . NOT ICE – The information contained in this data -sheet document is intended only as a summary, and is subject to change without notice. The product(s) described here has/have a specific instruction sheet(s) that cover various technical, limitation and liability information . Copies of install-type, instruction sheets – as well as the General Product Warning and Limitations document, which also contains important data , are provided with the product, and are available from the Manufacturer. Data contained in the aforesaid type of documentation should be consulted with a fire-safety professional before specifying or using the product. Any further questions or assistance concerning particular problems that might arise, relative to the proper functioning of the equipment, please contact the Manufacturer. Temperature and Humidity Range Models XTRI-D | XTRI-R | XTRI-S intelligent interface modules are UL Listed | ULC Listed. Env ironmental operating conditions for each interface module is 32ºF (0ºC) to 120ºF (49ºC) with a relative humidity of no greater than 95%, non-condensing. LED Indicators Electrical Ratings FLASH COLOR CONDITION FLASH INTERVALS [in seconds] GREEN: Normal supervisory operation 10 YELLOW: Device is in trouble and needs to be replaced 4 RED: Locate | `Alarm’ 1 Output Device (XTRI-R only) 10 NO FLASH: Power is not being received / Replacement is needed – OPERATING VOLTAGE RANGE: 13VDC – 32VDC RELATIVE HUMIDITY: 0 – 95% (non-condensing) `ACTIVE’ OR `STANDBY’ CURRENT, MAX.: 500μA LINE SIZES AMERICAN WIRE GAUGE (AWG) 14 AWG, max. 18 AWG, min. CURRENT DRAW, MAX | AVG. XTRI-S 650μA XTRI-R 750μA XTRI-D 950μA MODEL OR T YPE PART NUMBER PRODUCT XTRI-S S54370-B3 -A1 Single Input Module XTRI-R S54370-B1 -A1 Single Input Module (with relay) XTRI-D S54370-B2 -A1 Dual Input Module DPU 500-033260 Device Programmer / Test Unit RELAY RATINGS: (for Model XTRI-R) RESISTIVE: 4 Amps | 125 VAC 4 Amps | 30 VDC 3.5A, 120 VAC (0.6 pF) 3.0A, 30 VDC (0.6 pF) INDUCTIVE: 2.0A, 120 VAC (0.4 pF) 2.0A, 120 VAC (0.35 pF) 2.0A, 30 VDC (0.35 pF) NOTE: Refer to installation manual: P/N – A6V101055479 to ensure Model XTRI-D | XTRI-R | XTRI-S compatibility with the Siemens FACPs intended for use in the given application. Siemens Industry, Inc. Smart Infrastructure - Building Products 8 Fernwood Road • Florham Park, NJ 07932 Tel: (973) 593 -2600 October - 2020 (Rev. 3) Details for Ordering Siemens Smart Infrastructure -Building Products –1– Datasheet 6364 usa.siemens.com/fire Product Overview The XMS-Series of manual pull stations are a complete addressable and conventional pull station portfolio that include single action, double action, and metal versions. The addressable versions feature built-in Class X (Style 7) isolation capability for increased system survivability. All models feature a T-45 reset key to match the fire alarm panel enclosure. Addressable models also feature a tri-color status LED to indicate normal, alarm, and trouble status. All modules utilize one address. The manual stations can be commissioned non-isolation (polarity insensitive) or isolation “X-Series” modes of operation. Specifications Models XMS-S, XMS-D, and XMS-M are compatible with Siemens FACPs. The Model XMS-S is a single action pull station in a plastic housing that requires one action by the user to initiate the alarm. The Model XMS-D is a double action pull station in a plastic housing that requires two actions by the user to initiate an alarm. The Model XMS-M is a single action pull station in a metal housing that requires one action by the user to initiate the alarm. These models are field installed addressable devices containing advanced control panel communication technology. The XMS-Series manual pull stations feature a "maintenance trouble" that places the fire alarm panel into a trouble condition if an XMS is accidentally left in an armed status when the cover is removed for maintenance work. This technology provides two-direction communication with the control panel. To reset the stations, insert the Siemens T45 key provided into the key lock and turn the key 10-15 degrees counter-clockwise as the arrow shows. The cover will move upward to the normal position. Rotate the key clockwise and remove key from the lock. At Normal position the top of the Cover is flush with the top surface of the Base. Reset the Fire Alarm Control Panel to clear the alarm. The XMS-S, XMS-D, and XMS-M manual stations operate with the Desigo Fire Safety Modular / Cerberus PRO Modular via the XDLC. These devices can be wired in either Isolation Mode or Polarity Insensitive Mode Wiring. The XMS-S/XMS-M manual station front cover has a recess pocket to pull down and locks in position after the alarm is initiated. The XMS-D manual station has an additional lever labeled “PUSH HERE THEN” to get access to the front cover pocket to initiate the alarm. Peripheral and Detection Devices Initiating Devices XMS-Series Manual Pull Stations Models XMS-S | XMS-D | XMS-M Model OH921 Multi-Criteria Fire Detector Architect & Engineer Specifications  Built-in loop isolation: ▪ Meets Class X (Style 7) survivability requirements ▪ Supports up to 190 X-Series isolation peripherals per loop and 30 addressable devices  Low current draw  Polarity insensitive (in non-isolation mode) via SureWire technology  Multi-color status LED  T-45 reset key  Reduced mounting depth for compatibility with single gang electrical boxes for retrofit applications  Trouble indication during service and maintenance  Single action, double action, and metal versions available  Portuguese and Spanish versions available  RoHS compliant  UL38 Listed Model XMS-D Siemens Smart Infrastructure -Building Products –2– usa.siemens.com/fire Model or Type Part Number Description XMS-S S54321-F7-A1 Addressable Single Action Manual Pull Station with Isolation XMS-D S54321-F8-A1 Addressable Double Action Manual Pull Station with Isolation XMS-M S54321-F19-A1 Addressable Single Action Metal Pull Station with Isolation XMS-SP S54321-F9-A1 Addressable Single Action Manual Pull Station with Isolation - Portugese Text XMS-DP S54321-F10-A1 Addressable Double Action Manual Pull Station with Isolation - Portugese Text XMS-SE S54321-F11-A1 Addressable Single Action Manual Pull Station with Isolation - Spanish Text XMS-DE S54321-F12-A1 Addressable Double Action Manual Pull Station with Isolation - Spanish Text XMH-501 S54321-F18-A1 Conventional Double Action Manual Pull Station for Agent Release XMS-501 S54321-F16-A1 Conventional Double Action Manual Pull Station XMS-51 S54321-F15-A1 Conventional Single Action Manual Station with Auxiliary Relay and Key Switch SMBOX- XMP S54321-F20-A1 Surface Mounting Backbox for X-Series Manual Stations APLT-XMP S54321-F21-A1 Adapter Plate for X-Series Manual Stations to Legacy Surface Backboxes 4DGBOX- XMP S54321-F22-A1 Adapter Plate for X-Series Manual Stations to 4" and Double-Gang Backboxes Operating Voltage Range 13 - 32VDC Max Average Operating Current @ 24v: 500µA Operating Temperature Range 32° ─ 120°F (0° ─ 49°C) Operating Humidity Range 0 ─ 95%, RH Construction: High impact polycarbonate plastic Aluminum Shipping weight: 1.0 lbs Dimensions: 5.50” H x 4.0” W x 1.250” D Compliance: ADA Compatible electrical boxes: 2-1/2” deep 1 -gang box Mounting Diagram Technical Data Physical Properties Details for Ordering NOTICE – The information contained in this data -sheet document is intended only as a summary, and is su bject to change without notice. The product(s) described here ha s/hav e a specific instruction sheet (s) that cover various technical, limitation and liability information . Copies of install-type, instruction sheets – as well as the General Product Warning and Limitations document, which also contains important data , are provided with the product, and are available from the Manufacturer. Data contained in the aforesaid type of documentation should be consulted with a fire-safety professional before specifying or using the product. Any further questions or assistance concerning particular problems that might arise, rela tive to the proper functioning of the equipment, please contact the Manufacturer. Siemens Industry, Inc. Smart Infrastructure - Building Products 8 Fernwood Road • Florham Park, NJ 07932 Tel: (973) 593-2600 December - 2019 (New Issue) ‘Z’ Series Notification Appliances 2584 s Industry, Inc. Building Technologies Division s Data Sheet Fire Safety Products Notification Appliances ZH & ZR – Strobes, Horns, & Horn / Strobes Application: Indoor Product Overview – Strobes can be synchronized using the Siemens DSC sync modules, the Siemens 50-point, 252-point and 504-point addressable fire alarm control panels (FACPs), as well as with:  FireFinder® XLS and MXL® FACPs  PAD-3 or PAD-4™ NAC Extenders with built-in sync protocol – Selectable Continuous Horn or Temporal (Code-3) Tones with 90 or 95 dBA selectable setting (Series ‘ZH’) – Ceiling-mount models feature field-selectable Candela settings of 15/30/75/95cd and 115/177cd – Wall-mount models feature field-selectable Candela settings of 15/30/75/110cd and 135/185cd – Base plate is protected by a disposable cover, and the appliances can quickly snap onto the base after the walls are painted – Strobes produce one (1) flash per second – ``Special Applications” listed with Siemens panels – EZ Mount Universal Mounting Plate (Model ZB Series)  uses single plate for ceiling and wall mount installations – EZ Mount design  with separate base plate  provides ability to pre-wire the base and test the circuit wiring before the walls are covered – UL Listed & ULC Listed, FM (#3028994) Approved; CSFM Approved (Series ‘ZH’: #7125-0067:0248 –> Fire Alarm Devices For The Hearing Impaired) CSFM Approved (Series ‘ZR’: #7125-0067:0252 –> Fire Alarm Devices For The Hearing Impaired) – ADA / NFPA compliant Specifications • General – Audible/Visual notification appliances are listed for indoor use only – Appliances are listed under UL Standard 1971 (Standard for Safety Signaling Devices for Hearing Impaired) and UL Standard 464 (Fire Protective Signaling) – Appliances use a universal back plate, which allows mounting to a single-gang, double-gang, 4-inch-square (10.2 cm.), 4”-octal (10.2 cm.), or a 3-1/2” (8.9 cm.) octal backbox – Two-wire configurations allows capability for directly connecting appliances to the mounting back plate – Continuity check will occur for entire NAC circuit prior to attaching any audible / visual-notification appliances – A cover fits over the mounting plate for protection to dust and other outside elements  Cover is easily removed when the appliance is installed over the back plate – Removal of an appliance will result in a Trouble condition by the Siemens Fire Alarm Control Panel (FACP) ZR Series ZR & ZH (for mounting) ZH Series s Industry, Inc. Building Technologies Division Specifications – (continued) • Strobes and Audible Strobe Combinations – Strobe appliances produce a minimum flash rate of 60 flashes per minute (one [1] flash per second) over the Regulated Input Voltage Range, and incorporate a Xenon flashtube enclosed in a rugged Lexan® lens – Strobes are available with two (2) or four (4) field-selectable settings in one (1) unit, and are rated – per UL 1971 – for up to: • 15/30/75/110cd for wall mounted • 135/185cd for wall mounted • 15/30/75/95cd for ceiling mounted • 115/177cd for ceiling mounted – Strobes operate over an extended temperature range of 32°F to 120°F (0°C to 49°C), and be listed for maximum humidity of 95% RH – Strobe inputs are polarized for compatibility with standard reverse-polarity supervision of circuit wiring by a Siemens FACP • Audible and Audible / Strobe Combinations – Horns and horn / strobes are listed for Indoor use under UL Standard 464 – Horns are able to produce continuous synchronized output or a Temporal Code-3 synchronized output – Horns have at least two (2) sound-level settings of 90 and 95 dBA • Synchronization Modules – The strobe portion, when synchronization is required, is compatible with the Siemens DSC sync modules; the Siemens 50-point, 252-point and 504-point addressable FACPs, as well as with:  FireFinder® XLS and MXL® FACPs  PAD-3 or PAD-4™ NAC Extenders with built-in sync protocol – The strobes will not drift out of synchronization at any time during operation – Audibles and strobes are able to synchronize on a two-wire circuit with the capability to silence the audible, if required – Strobes revert to a non-synchronized flash-rate, if the sync module or power supply should fail to operate (i.e. – contacts remain closed) – All notification appliances are listed for Special Applications:  Strobes are designed to flash at 1-flash-per-second minimum over their ``Regulated Input Voltage Range”  Note: NFPA-72 specifies a flash rate of 1-to-2 flashes per second, and ADA Guidelines specify a flash rate of 1-to-3 flashes per second  All candela ratings represent minimum-effective Strobe intensity, based on UL Standard 1971  Series ZH Strobe products are listed under UL Standards 1971 and 464 for indoor use with a temperature range of 32°F to 120°F (0°C to 49°C) and maximum humidity of 93% (± 2%)  Series ZH horns are listed under UL Standard 464 for audible signal appliances (Indoor use only) Mounting Diagram (Shown In Inches) s Industry, Inc. Building Technologies Division Mounting Diagram Technical Data ZH Horn: Wall and Ceiling Mount Operating Voltage (Special Application) Per UL 464 Input Voltage Low* High* DC 16.0 – 33.0VDC 0.018 0.044 FWR 16.0 – 33.0VRMS 0.045 0.075 * Current draw is the same for the Continuous Horn, Code 3 Horn, and March Time settings ZH Horn / Strobe Series: Wall Mount Current Ratings (AMPs) MAXIMUM RMS Current – with High dBA Setting Input Voltage 15cd 30cd 75cd 110cd 135cd 185cd DC 16.0 – 33.0VDC 0.078 0.113 0.195 0.259 0.371 0.506 FWR 16.0 – 33.0VRMS 0.141 0.200 0.302 0.406 0.521 0.722 Current Ratings (AMPs) MAXIMUM RMS Current – with Low dBA Setting Input Voltage 15cd 30cd 75cd 95cd 135cd 185cd DC 16.0 – 33.0VDC 0.070 0.107 0.188 0.246 0.324 0.455 FWR 16.0 – 33.0VRMS 0.123 0.179 0.290 0.391 0.497 0.699 ZR Strobe Series: Wall Mount Current Ratings (AMPs) Strobe Setting – (cd) Input Voltage 15cd 30cd 75cd 110cd 135cd 185cd DC 16.0 – 33.0VDC 0.064 0.098 0.175 0.233 0.318 0.445 FWR 16.0 – 33.0VRMS 0.108 0.164 0.268 0.368 0.482 0.684 ZR Strobe Series: Ceiling Mount Current Ratings (AMPs) Strobe Setting – (cd) Input Voltage 15cd 30cd 75cd 95cd 115cd 177cd DC 16.0 – 33.0VDC 0.069 0.111 0.200 0.264 0.318 0.445 FWR 16.0 – 33.0VRMS 0.117 0.180 0.297 0.398 0.482 0.684 ULC Directional Characteristics -3 dBA 35 degrees left; 40 degrees right -6 dBA 55 degrees left; 65 degrees right ZH Horn / Strobe Series: Ceiling Mount Current Ratings (AMPs) MAXIMUM RMS Current – with High dBA Setting Input Voltage 15cd 30cd 75cd 95cd 115cd 177cd DC 16.0 – 33.0VDC 0.087 0.131 0.222 0.292 0.371 0.506 FWR 16.0 – 33.0VRMS 0.149 0.216 0.331 0.436 0.521 0.722 Current Ratings (AMPs) MAXIMUM RMS Current – with Low dBA Setting Input Voltage 15cd 30cd 75cd 95cd 115cd 177cd DC 16.0 – 33.0VDC 0.075 0.121 0.213 0.277 0.324 0.455 FWR 16.0 – 33.0VRMS 0.131 0.195 0.319 0.421 0.497 0.699 ZH and ZH-MC Series: Wall and Ceiling Mount dBA Sound Output Description Volume Reverberant Per UL 464 16.0 VDC 24.0 VDC 33.0 VDC Continuous Horn Low 77 81 83 High 83 87 90 Code 3 Horn (or March Time)** Low 72 76 79 High 79 82 86 dBA Sound Output Description Volume Reverberant Per ULC-S525-99 20.0 VDC 24.0 VDC 31.0 VDC Continuous Horn Low 88 90 91 High 93 95 96 Code 3 Horn (or March Time)** Low 88 90 91 High 93 95 96 ** Available only in sync mode. s Industry, Inc. Building Technologies Division Fire Safety 8 Fernwood Road Florham Park, NJ 07932 Tel: (973) 593-2600 FAX: (908) 547-6877 URL: www.usa.Siemens.com/Fire (SII) Printed in U.S.A. Fire Safety 1577 North Service Road East Oakville, Ontario L6H 0H6 / Canada Tel: [905] 465-8000 URL: www.Siemens.CA August 2016 Supersedes sheet dated 6/2015 (Rev. 5) Technical Data – (continued) Notes: 1. Strobes will produce 1 flash per second over the Input Voltage range. 2. These horn/strobe models are UL Listed to operate over a Voltage Range Limit from 16.0VDC to 33.0VDC for 24VDC applications using filtered DC or unfiltered Full-Wave-Rectified (FWR) input voltage. 3. All models are UL Listed for indoor ceiling use with a temperature range of +0oC to +49oC (+32oF to +120oF) and maximum humidity of 93% +/- 2% RH. The effect of shipping and storage temperatures will not adversely affect the performance of the appliance when stored in original cartons, and is not subjected to either misuse or improper handling of shipment. Details for Ordering ─ (Including Mounting Options & Agency Approvals) Model Part Number Description Mounting Options* UL ULC FM CSFM ZH-R 500-636159 Z Horn: Red B,D,E,F,X     ZH-W 500-636160 Z Horn: White B,D,E,F,X     ZH-MC-R 500-636161 Z Horn: Multi Candela (Wall), Red B,D,E,F,X     ZH-MC-W 500-636162 Z Horn: Multi Candela (Wall), White B,D,E,F,X     ZH-HMC-R 500-636163 Z Horn: Hi Multi Candela (Wall), Red B,D,E,F,X     ZH-HMC-W 500-636164 Z Horn: Hi Multi Candela (Wall), White B,D,E,F,X     ZH-MC-CR 500-636165 Z Horn: Multi Candela (Ceiling), Red B,D,E,F,X     ZH-MC-CW 500-636166 Z Horn: Multi Candela (Ceiling), White B,D,E,F,X     ZH-HMC-CR 500-636167 Z Horn: Hi Multi Candela (Ceiling), Red B,D,E,F,X     ZH-HMC-CW 500-636168 Z Horn: Hi Multi Candela (Ceiling), White B,D,E,F,X     ZR-MC-R 500-636169 Z Strobe: Multi Candela (Wall), Red B,D,E,F,X     ZR-MC-W 500-636170 Z Strobe: Multi Candela (Wall), White B,D,E,F,X     ZR-HMC-R 500-636171 Z Strobe: Hi Multi-Candela (Wall), Red B,D,E,F,X     ZR-HMC-W 500-636172 Z Strobe: Hi Multi-Candela (Wall), White B,D,E,F,X     ZR-MC-CR 500-636173 Z Strobe: Multi Candela (Ceiling), Red B,D,E,F,X     ZR-MC-CW 500-636174 Z Strobe: Multi Candela (Ceiling), White B,D,E,F,X     ZR-HMC-CR 500-636175 Z Strobe: Hi Multi Candela (Ceiling), Red B,D,E,F,X     ZR-HMC-CW 500-636176 Z Strobe: Hi Multi Candela (Ceiling), White B,D,E,F,X     ZB-R 500-636193 Accessory ─ (Includes base, dust cover, mounting screws and installation sheet)     ZB-W 500-636194 Accessory ─ (Includes base, dust cover, mounting screws and installation sheet)      = Listed / Approved * = Refer to data sheet #: 2585 for detailed mounting options Notice: This marketing data sheet is not intended to be used for system design or installation purposes. For the most up-to-date information, refer to each product’s installation instructions. Agency Approvals AS / AH Series Notification Appliances 2578 s Industry, Inc. Building Technologies Division s Data Sheet Fire Safety Products Notification Appliances AS & AH – Audible Horn | Strobe / Audible Horn Appliances Application: Indoor / Outdoor Product Overview – Fast installation with In / Out screw terminals using #12 to #18 AWG wires – Synchronization can be done via the Siemens 50-point, 252-point and 504-point fire alarm control panels (FA CPs), as well as with:  FireFinder® XLS and MXL® FACPs  PAD-3 or PAD-4™ NAC Extenders with built-in sync protocol  Siemens Dual Sync (DSC) modules – Selectable Continuous Horn or Temporal (Code 3) – Wall mounts are available with field-selectable Candela settings: 15/30/75/110cd or 135/185cd – Ceiling-mount models are available with field-selectable Candela settings: 15/30/75/95cd or 115/177cd (multi-Candela ceiling models) – Three (3) field -selectable dBA settings of 90/95/99 dBA Anechoic in both tones – Weatherproof wall-mount models are available with field-selectable Candela settings: 135/185cd – Weatherproof ceiling-mount models are available with field-selectable Candela settings: 115/177cd – UL Listed & ULC Listed; FM (#3150) and CSFM Approved (#7125-0067:0247 –> Fire Alarm Devices For The Hearing Impaired) – ADA / NFPA / UFC / ANSI compliant Specifications – Notification appliances are Siemens Series ‘AS’ Audible Horn | Strobe appliances and Series ‘AH’ Audible Horn appliances or approved equals – Series ‘AS’ Audible Horn | Strobes are listed for UL Standard 1971 (Emergency Devices for the Hearing-Impaired for Indoor Fire Protection Service) – Series ‘AH’ Audible Horns are UL Listed under Standard 464 (Fire Protective Signaling) – All inputs are compatible with standard reverse polarity supervision of circuit wiring by the Siemens Fire Alarm Control Panel (FACP) – The audible portion of each appliance has a minimum of three (3) field-selectable setti ngs for dBA Anechoic levels, as well as a choice of continuous or temporal (Code 3) audible outputs – The strobe portion of each appliance produces a flash rate of one (1) flash-per-second over the Regulated Input Voltage Range, and incorporate a Xenon flashtube enclosed in a rugged Lexan® lens AS-MC-CW AS-MC-R AH-R AH-W s Industry, Inc. Building Technologies Division Specifications – (continued) – Series ‘AS’ Horn | Strobe appliances are of low current design – Strobe intensity (where Multi-Candela appliances are specified) is easily controlled by field-selectable settings, and is rated per UL Standard 1971 for:  15/30/75/110cd  135/185cd – When synchronization is required, Series ‘AS’ horn | strobe appliances are compatible wi th the Siemens 50-point, 252-point and 504-point fire alarm control panels (FACPs), as well as with:  FireFinder® XLS and MXL® FACPs  PAD-3 or PAD-4™ NAC Extenders with built-in sync protocol  Siemens DSC modules – The strobes will not drift out of synchronization at any time during operation – The strobes will revert to a non-synchronized flash-rate, if the sync module or Power Supply should fail to operate (i.e. – contacts remain closed) – The appliance is also designed so that the audible signal may be silenced while maintaining strobe activation when used with Siemens synchronization – The Series ‘AS’ Horn | Strobe and Series ‘AH’ Horn appliances incorporate a Patented Universal Mounting Plate that allow mounting to a single-gang, double-gang, 4-inch (10.2 cm.) square, Siemens SHBBS-Series surface backbox – All notification appliances are listed for Special Applications:  Strobes are designed to flash at 1-flash-per-second minimum over their “Regulated Input Voltage Range”  Note: NFPA-72 specifies a flash rate of 1-to-2 flashes per second, and ADA Guidelines specify a flash rate of 1-to-3 flashes per second  All Candela ratings represent minimum-effective Strobe intensity, based on UL Standard 1971 Mounting Diagram Mounting Options (Shown In Inches) (Shown In Inches) s Industry, Inc. Building Technologies Division Technical Data AS-MC Series: Wall Mount Current Ratings (AMPs) MAXIMUM RMS Current – with Hi dBA Setting Input Voltage 15cd 30cd 75cd 110cd DC 16.0 – 33.0VDC 0.094 0.133 0.212 0.283 FWR 16.0 – 33.0VRMS 0.134 0.191 0.307 0.405 Current Ratings (AMPs) MAXIMUM RMS Current – with Med dBA Setting Input Voltage 15cd 30cd 75cd 110cd DC 16.0 – 33.0VDC 0.079 0.117 0.202 0.269 FWR 16.0 – 33.0VRMS 0.119 0.183 0.292 0.397 Current Ratings (AMPs) MAXIMUM RMS Current – with Low dBA Setting Input Voltage 15cd 30cd 75cd 110cd DC 16.0 – 33.0VDC 0.073 0.112 0.193 0.260 FWR 16.0 – 33.0VRMS 0.112 0.176 0.287 0.393 AS-MC-C Series: Ceiling Mount Current Ratings (AMPs) MAXIMUM RMS Current – with Hi dBA Setting Input Voltage 15cd 30cd 75cd 95cd DC 16.0 – 33.0VDC 0.101 0.147 0.235 0.303 FWR 16.0 – 33.0VRMS 0.144 0.202 0.324 0.424 Current Ratings (AMPs) MAXIMUM RMS Current – with Med dBA Setting Input Voltage 15cd 30cd 75cd 95cd DC 16.0 – 33.0VDC 0.085 0.130 0.213 0.285 FWR 16.0 – 33.0VRMS 0.132 0.185 0.312 0.414 Current Ratings (AMPs) MAXIMUM RMS Current – with Low dBA Setting Input Voltage 15cd 30cd 75cd 95cd DC 16.0 – 33.0VDC 0.079 0.120 0.210 0.279 FWR 16.0 – 33.0VRMS 0.122 0.180 0.308 0.409 AS-HMC Series : Wall and Ceiling Mount Current Ratings (AMPs) MAXIMUM RMS Current – with Hi dBA Setting Input Voltage 115cd 135cd 177cd 185cd DC 16.0 – 33.0VDC 0.356 0.356 0.488 0.488 FWR 16.0 – 33.0VRMS 0.499 0.499 0.705 0.705 Current Ratings (AMPs) MAXIMUM RMS Current – with Med dBA Setting Input Voltage 115cd 135cd 177cd 185cd DC 16.0 – 33.0VDC 0.361 0.361 0.493 0.493 FWR 16.0 – 33.0VRMS 0.509 0.509 0.716 0.716 Current Ratings (AMPs) MAXIMUM RMS Current – with Low dBA Setting Input Voltage 115cd 135cd 177cd 185cd DC 16.0 – 33.0VDC 0.356 0.356 0.499 0.499 FWR 16.0 – 33.0VRMS 0.488 0.488 0.705 0.705 AS -HMC-C Series , Weatherproof: Ceiling Mount Current Ratings (AMPs) MAXIMUM RMS Current – with Hi dBA Setting Input Voltage 115cd 177cd DC 16.0 – 33.0VDC 0.546 0.742 FWR 16.0 – 33.0VRMS 0.546 0.742 Current Ratings (AMPs) MAXIMUM RMS Current – with Med dBA Setting Input Voltage 115cd 177cd DC 16.0 – 33.0VDC 0.509 0.716 FWR 16.0 – 33.0VRMS 0.509 0.716 Current Ratings (AMPs) MAXIMUM RMS Current – with Low dBA Setting Input Voltage 115cd 177cd DC 16.0 – 33.0VDC 0.488 0.705 FWR 16.0 – 33.0VRMS 0.488 0.705 AS-HMC Series , Weatherproof: Wall Mount Current Ratings (AMPs) MAXIMUM RMS Current – with Hi dBA Setting Input Voltage 135cd 185cd DC 16.0 – 33.0VDC 0.356 0.488 FWR 16.0 – 33.0VRMS 0.499 0.705 Current Ratings (AMPs) MAXIMUM RMS Current – with Med dBA Setting Input Voltage 135cd 185cd DC 16.0 – 33.0VDC 0.361 0.493 FWR 16.0 – 33.0VRMS 0.509 0.716 Current Ratings (AMPs) MAXIMUM RMS Current – with Low dBA Setting Input Voltage 135cd 185cd DC 16.0 – 33.0VDC 0.356 0.499 FWR 16.0 – 33.0VRMS 0.488 0.705 AS-75 Series, Weatherproof: Wall & Ceiling Mount Current Ratings (AMPs) MAXIMUM RMS Current – with Hi dBA Setting Input Voltage 30cd / 180cd (per UL1971) 115cd (per UL1638) DC 16.0 – 33.0VDC 0.178 0.178 FWR 16.0 – 33.0VRMS 0.249 0.249 Current Ratings (AMPs) MAXIMUM RMS Current – with Med dBA Setting Input Voltage 30cd / 180cd (per UL1971) 115cd (per UL1638) DC 16.0 – 33.0VDC 0.164 0.164 FWR 16.0 – 33.0VRMS 0.239 0.239 Current Ratings (AMPs) MAXIMUM RMS Current – with Low dBA Setting Input Voltage 30cd / 180cd (per UL1971) 115cd (per UL1638) DC 16.0 – 33.0VDC 0.159 0.159 FWR 16.0 – 33.0VRMS 0.233 0.233 s Industry, Inc. Building Technologies Division Technical Data AH Series: Wall-only Mount UL Current Ratings (AMPs) Average Current Volume Levels Low Medium High DC 16.0 – 33.0VDC 0.021 0.043 0.080 FWR 16.0 – 33.0VRMS 0.041 0.051 0.090 AH Series: Wall-only Mount ULC Current Ratings (AMPs) Average Current Volume Levels Low Medium High 20.0 VDC 0.014 0.020 0.035 24.0 VDC 0.017 0.025 0.050 31.0 VDC 0.021 0.030 0.065 AH Series AH Series Description UL / ULC dBA Sound Output Reverberant [Per UL464 @ 10 Ft.] Anechoic [Per ULC-S525-99] Volume Levels 16VDC 24VDC 33VDC 20VDC 24VDC 31VDC Continuous Horn Low 80 83 86 88 90 92 Medium 85 88 91 90 95 97 High 88 91 93 92 97 99 Code 3 Horn or March Time** Low 75 79 82 88 90 92 Medium 80 84 86 90 95 97 High 84 87 90 92 97 99 ** Available in sync mode only Note : These notification appliances are UL Listed as “Special Application”. They are intended to be used only with Siemens notification appliances. AS Weatherproof Series UL / ULC Models and Ratings Model* Operating Voltage (Special Application) Per UL 1638, UL1971 and UL464 (VDC/VRMS) Voltage Range Per CAN/ULC-S525-99 / S526-02 (VDC/VRMS) UL Rated Strobe Candela (cd) ULC Rated Light Output (cd) At – 40°C, per UL1638 UL1971 AS-75-R-WP 16.0 – 33.0 20.0 – 33.0 115 30 / 180 * 30 AS-75-CR-WP 16.0 – 33.0 ~ 115 30 / 180 * ~ AS-HMC-C-WP* 16.0 – 33.0 ~ 50 / 75 115 / 177 ~ AS-HMC-WP* 16.0 – 33.0 ~ 65 / 90 135 / 185 ~ * Available in red or white. AS-MC and AS-HMC Series UL Listed Ratings Model* Operating Voltage (Special Application) Per UL 1971 (VDC / VRMS) Strobe Candela (cd) AS-HMC 16.0 - 33.0 135 / 185 AS-MC 16.0 - 33.0 15/30/75/110 AS-MC-C 16.0 - 33.0 15/30/75/95 dBA Sound Output Description Volume Reverberant Per UL 464 16.0 VDC 24.0 VDC 33.0 VDC Continuous Horn Low 80 83 86 Medium 85 88 91 High 88 91 93 Code 3 Horn (or March Time)** Low 75 79 82 Medium 80 84 86 High 84 87 90 ** Available only in sync mode. Notes: 1. Strobe will produce 1 flash-per-second over the Input Voltage range. 2. This strobe/horn model meets the required light distribution patterns defined in UL 1971. 3. This model is UL Listed for indoor use with a temperature range of +32ºF to +120ºF (0ºC to +49ºC) and maximum humidity of 93% + 2% RH. The effect of shipping and storage temperatures will not adversely affect the performance of the appliance when it is stored in the original cartons, and is not subjected to either misuse or improper handling of shipment. ULC Directional Characteristics -3 dBA: 48 degrees left, 41 degrees right -6 dBA: 50 degrees left, 58 degrees right s Industry, Inc. Building Technologies Division Details for Ordering ─ (Including Mounting Options & Agency Approvals) Agency Approvals Model Part Number Wall Mount Ceiling Mount Description Mounting Options* UL ULC FM CSFM AS-MC-R 500-636010 YES – AS Horn | Strobe: Multi-Candela, Red A,B,D,E,F,G,J,N,R,X     AS-MC-W 500-636011 YES – AS Horn | Strobe: Multi-Candela, White A,B,D,E,F,G,J,N,R,X     AS-HMC-R 500-636012 YES – AS Horn | Strobe: Hi Multi-Candela, Red A,B,D,E,F,G,J,N,R,X     AS-HMC-W 500-636013 YES – AS Horn | Strobe: Hi Multi-Candela, White A,B,D,E,F,G,J,N,R,X     AS-MC-CR 500-636006 – YES AS Horn | Strobe: Multi-Candela Ceiling, Red A,B,D,E,F,G,J,N,R,X     AS-MC-CW 500-636007 – YES AS Horn | Strobe: Multi-Candela Ceiling, White A,B,D,E,F,G,J,N,R,X     AS-HMC-CR 500-636008 – YES AS Horn | Strobe: Hi Multi-Candela Ceiling, Red A,B,D,E,F,G,J,N,R,X     AS-HMC-CW 500-636009 – YES AS Horn | Strobe : Hi Multi-Candela Ceiling, White A,B,D,E,F,G,J,N,R,X     AS-HMC- CR-WP 500-636181 – YES AS Horn | Strobe : Hi Multi-Candela Ceiling Weatherproof, Red I, GG, HH   –  AS-HMC- CW-WP 500-636182 – YES AS Horn | Strobe : Hi Multi-Candela Ceiling Weatherproof, White I, GG, HH   –  AS-HMC- R-WP 500-636183 YES – AS Horn | Strobe : Hi Multi-Candela Wall Weatherproof, Red I, GG, HH   –  AS-HMC- W-WP 500-636184 YES – AS Horn | Strobe : Hi Multi-Candela Wall Weatherproof, White I, GG, HH   –  AS-75-R-WP 500-636016 YES – AS Horn | Strobe: 75CD Weatherproof, Red I, GG, HH     AS-75- CR-WP 500-636015 – YES AS Horn | Strobe: 75 CD Ceiling Weatherproof, Red I, GG, HH     AH-R 500-636003 YES YES AH Horn, Red A,B,D,E,F,G,J,N,R,X     AH-W 500-636004 YES YES AH Horn, White A,B,D,E,F,G,J,N,R,X     AH-R-WP 500-636005 YES YES AH Horn: Weatherproof, Red K, GG, HH     NOTE: There are no regulatory restrictions in mounting Siemens Series ‘AH’ Horn-only Appliances to either wall or ceiling applications. However, Siemens Series ‘AS’ Horn | Strobe Appliances are regulatory- specific to the mounting options described above, based upon the appearance of FIRE, text shown on the sides of certain Siemens Series ‘AS’ faceplates. *= Refer to data sheet #: 2585 for detailed mounting options Agency listed / approved =>  Notes: 1. Models AS-75-WP and AS-75-R-WP do not provide a 75cd setting. 2. The Listed Candela ratings are as follows:  115cd, per UL1638, outdoor  30cd, per UL1971, indoor ─ The indoor usage is also rated 180cd when measured directly on axis s Industry, Inc. Building Technologies Division Fire Safety 8 Fernwood Road Florham Park, NJ 07932 Tel: (973) 593-2600 FAX: (908) 547-6877 URL: www.usa.Siemens.com/Fire (SII) Printed in U.S.A. Fire Safety 1577 North Service Road East Oakville, Ontario L6H 0H6 / Canada Tel: [905] 465-8000 URL: www.Siemens.CA September 2015 Supersedes sheet dated 5/2015 (Rev. 5) Notice: This marketing data sheet is not intended to be used for system design or installation purposes. For the most up-to-date information, refer to each product’s installation instructions. ‘08 Series Notification Appliances 2585 s Industry, Inc. Building Technologies Division s Data Sheet Fire Safety Products Notification Appliances Mounting Options Mounting Diagrams | Mounting Matrixes | Mounting Notes ARCHITECT AND ENGINEER SPECIFICATIONS s Industry, Inc. Building Technologies Division Mounting Options – (continued) s Industry, Inc. Building Technologies Division Mounting Options – (continued) s Industry, Inc. Building Technologies Division Mounting Matrix (by Series) Series ST-WP (1), AS-WP (2), AH-WP (3), MTH and SET-WP (4) Series AS / AH Series B6 Series B10 Series CH Series HS Series LFS Series MBDC Series MH Series MH115 Series MTH Series NH / NS Series S-HQ Series SE-C Series SE Series SEH Series SEF Series SEFH Series SET / SET (Wall Mount) Series SET-C Series SETSF Series SETSF-B Series ST Series ST-MC-RETRO Series ZH / ZR (A) Universal Mounting Plate (included with AS series devices)   (B) 1-GANG −x− 3-1/2” Deep - Flush (BO)      (C) 1-GANG −x− 1-3/4” Deep - Surface (BO)  (D) 4” −x− 4” −x− 1.5” Deep - Flush (BO)            (E) 4” −x− 4” −x− 2.125” Deep - Flush (BO)                 (F) 2-GANG −x− 3.5” Deep - Flush (BO)       (G) 2-GANG −x− 1.75” Deep - Surface (BO)    (I) WPBBS-R Weatherproof Backbox for AS-WP 2 (J) BBS Surface (SP)       (K) WBBS Weatherproof (SP) 3       (L) ISP-S2 Surface Adapter  (M) MT-SUR-BOX Surface & Weatherproof (SP) 4    (N) DBBS Surface (SP)          (O) Retrofit Plate     (P) SBBS Surface (SP)              (Q) 4” –x– 4” –x– 2.125” Box [with 1.5” Extension Ring- Flush (BO) ]           (R) SFPS Semi-Flush Plate (SP)              (S) APS Adapter Plate (SP)      (T) WPSBBS-R Weatherproof Backbox for ST-WP 1 (U) 5” Square Backbox w/ Extension Ring, Flush (BO) W         (V) SSB-4 Ceiling Support Bridge E    (W) 4.6875” –x– 4.6785” –x– 2.125” Deep Surface (BO) A (X) SHBBS (SP) Shallow Surface T      (Y) SERS Semi-Flush Extension Ring (Retrofit Appl.) H       (Z) SBLS-2 Surface (SP) E     (AA) SPSB Backbox for SE Speaker R   (BB) SPSSB Backbox for `SEH’ | `SEFH’ Hi-Fidelity Speakers and `SE’ Series Speaker / Strobes P    (CC) SP Ceiling Support Bridge R  (DD) Ceiling Speaker Backbox O  (EE) SPEXT Extension Ring O  (FF) ZB F  (GG) WFPS Plate 1, 2, 3, 4   (HH) WFPAS Plate  (I I ) LFSBB Backbox  Data Sheet Number – 2578 2571 2571 2572 2576 2578 2570 2575 2574 2579 - and - 6634 2577 2586 2580 2580 2589 2582 2590 2581 2581 2583 2583 2573 2570 2584 s Industry, Inc. Building Technologies Division Mounting Notes Caution: The mounting options figures show the maximum number of field wires (conductors) that can enter the back box used with each mounting option. If these limits are exceeded, there may be insufficient space in the back box to accommodate the field wires and stresses from the wires could damage the product. Although the limits shown for each mounting option comply with the National Electrical code (NEC), Siemens recommends use of the largest backbox option and the use of approved field wires whenever possible to provide additional wiring room for easy installation and minimum stress on the product from wiring. Caution: Check that the installed product will have sufficient clearance and wiring room prior to installing back-boxes and conduit, especially if sheathed multi-conductor cable or 3/4- inch conduit fittings are used. 1. Mounting hardware for each mounting option is supplied. 2. Conduit entrances to the back box should be selected to provide sufficient wiring clearance for the installed product. 3. When extension rings are required, conduit should enter through the back box, not the extension ring. Use Steel City #53151 (1-1/2” deep) or #53171 (2-1/8” deep) extension rings (as noted in the mounting options) or equal with the same cut-out area. 4. When terminating field wires, do not use more lead length than required. Excess lead length could result in insufficient wiring space for the appliance. 5. Use care and proper techniques to position the field wires in the back box so that they use minimum space and produce minimum stress on the product. This is especially important for stiff, heavy gauge wires and wires with thick insulation or sheathing. 6. Do not pass additional wires (used for other than the appliance) through the back box “unless the back box is of a sufficient size to permit additional wiring as described in NEC 314.16 (B)”. Such additional wires could result in insufficient wiring space for the appliance. Note: Due to continuous development of our products, specifications and offerings are subject to change without notice, in accordance with Siemens Industry, Inc. standard terms and conditions. Back Box Mounting Siemens Horizontal, Wall-Mounted Strobe Appliances NFPA-72 (2007) 7.5.4.1* ─ Wall-mounted appliances shall be mounted such that the entire lens is not less than 80 inches (203 cm.) and not greater than 96 inches (244 cm.) above the finished floor or at the mounting height specified using the performance-based alternative 7.5.4.5. 7.5.4.2 ─ Where low ceiling heights do not permit mounting at a minimum of 80 inches (203 cm.), visible appliances shall be mounted within 6 inches (15 cm.) of the ceiling. The room size covered by a strobe of a given value shall be reduced by twice the difference between the minimum mounting height of 80 inches (203 cm.) and the actual, lower mounting height. s Industry, Inc. Building Technologies Division Fire Safety 8 Fernwood Road Florham Park, NJ 07932 Tel: (973) 593-2600 FAX: (908) 547-6877 URL: www.usa.Siemens.com/Fire (SII) Printed in U.S.A. Fire Safety 1577 North Service Road East Oakville, Ontario L6H 0H6 / Canada Tel: [905] 465-8000 URL: www.Siemens.CA August 2016 Supersedes sheet dated 6/2016 (Rev. 8) Back box Mounting Options* Series `AS’| `AH’ Audible Strobe Series ST- MC-RETRO (Flush and Surface Retrofit Plate ) Series ‘NS’ Horn Strobe Series `ST’ and `Z’ Strobe Series `MTH’ Multi-tone 80 IN. 6 IN. 80 IN. 6 IN. 80 IN. 6 IN. 80 IN. 6 IN. 80 IN. 6 IN. (B) 1-Gang –x– 2” Deep - Flush (BO) 77 1/2” 8 1/2” 78 3/8” 7 5/8” 79 1/8” 6 7/8” (D) 4” –x– 4” –x–1.5” Deep - Flush (BO) 77” 9” 83 15/16” 77 7 /8 1/8” 78 5/8” 7 3/8” 79 15/16” 6 1/16” 6 1/16” (E) 4” –x– 4” –x– 2.13” Deep - Flush (BO) 77” 9” 83 15/16” 77 7/8” 8 1/8” 78 5/8” 7 3/8” 79 15/16” 6 1/16” 6 1/16” (F) 2-Gang –x– 3.5” Deep - Flush (BO) 77 1/2” 8 1/2” 78 3/8” 7 5/8” 79 1/8” 6 7/8” 80 9/16” 5 7/16” 5 7/16” (G) 2-Gang –x– 1.75” Deep - Surface (BO) 77 1/2” 8 1/2” 78 3/8” 7 5/8” 79 1/8” 6 7/8” 80 9/16” 5 7/16” 5 7/16” (M) MT-SUR-BOX Surface and Weatherproof (SP) 79 3/8 ” 6 5/8” 6 5/8” (P) SBBS Surface (SP) 79 1/4” 6 3/4” 6 3/4” (U) 5”–square Back box with Extension Ring, Flush (BO) 69 1/2” 8 1/2” 83 7/16” 77 3/8” 7 5/8” 78 1/8” 6 7/8” 79 7/16 ” 5 9/16” 5 9/16” (X) SHBBS (SP) Shallow Surface 76 1/2” 9 1/2” 77 3/8” 8 5/8” 78 1/8” 7 7/8” (Z) SBL2S Surface (SP) 78” (FF) ZB 78 1/8” 7 7/8” * Measured from Bottom of Back box More Back box Mounting Options* Series ‘CH’ Chime Strobe Series ‘SET-V’ Speaker Strobe Series ‘SEF-C’ Speaker Strobe Series ‘SET-C’ Speaker Strobe 80 IN. 6 IN. 80 IN. 6 IN. 80 IN. 6 IN. 80 IN. 6 IN. (P) SBB Surface (SP) 77 3/4” 8 1/2” 79 3/16” 6 13/16” 77 3/4” 8 1/4” 77 3/4” 8 1/4” (Q) 4” x 4” x 2.125” Box w/ 1.5” Extension Ring - Flush (BO) 77 1/2” 7 1/2” 80 6” 78 1/2” 7 1/2” 78 1/2” 7 1/2” (U) 5” Square Back box with Extension Ring - Flush (BO) 78” 7” 79 1/2” 5 1/2” 78” 7” 78” 7” (X) SHBB (SP) Shallow Surface – – – – – – – – – – – – – – – – (Y) 4” x 4” x 1.5” Box w/ 1.5” Extension-Ring Plate - Flush (BO) 78 1/2” 7 1/2” 80” 6” – – – – – – – – * Measured from Bottom of Back box Notes: (BO) = By Others (SP) = s Product Notice: This marketing data sheet is not intended to be used for system design or installation purposes. For the most up-to-date information, refer to each product’s installation instructions. MH20845 ® Sealed Rechargeable MODEL PS-1270 F1 12 Volt 7.0 Amp. Hr. Battery www.power-sonic.com BATTERYM U S TBER E CYCLEDPb NONSPILLABLE L HT H W 6.35 4.75 3.2 F1 F2 0.8 7.95 6.35 3.4 0.8 Tolerances are +/- 0.04 in. (+/- 1mm) and +/- 0.08 in. (+/- 2mm) for height dimensions. All data subject to change without notice. Physical Dimensions: in (mm) Features Absorbent Glass Mat (AGM) technology for superior performance Valve regulated, spill proof construction allows safe operation in any position Power/volume ratio yielding unrivaled energy density Rugged impact resistant ABS case and cover (UL94-HB) Approved for transport by air. D.O.T., I.A.T.A., F.A.A. and C.A.B. certifi ed U.L. recognized under fi le number MH 20845 • • • • • • Performance Specifi cations Nominal Voltage ........................................................................12 volts (6 cells) Nominal Capacity 20-hr. (350mA to 10.50 volts) ........................................................ 7.00 AH 10-hr. (650mA to 10.50 volts) ....................................................... 6.50 AH 5-hr. (1.2A to 10.20 volts) ............................................................ 6.00 AH 1-hr. (4.5A to 9.00 volts) .............................................................. 4.50 AH 15-min. (14A to 9.00 volts) .................................................................3.50 AH Approximate Weight ........................................................... 4.80 lbs. (2.18 kg) Energy Density (20-hr. rate) ................................ 1.49 W-h/in3 (90.95 W-h/l) Specifi c Energy (20-hr. rate) .............................. 17.50 W-h/lb (38.58 W-h/kg) Internal Resistance (approx.) ...................................................... 23 milliohms Max Discharge Current (7 Min.) ............................................... 21.0 amperes Max Short-Duration Discharge Current (10 Sec.) .................. 70.0 amperes Shelf Life (% of nominal capacity at 68°F (20°C)) 1 Month ...................................................................................................... 97% 3 Months ..................................................................................................... 91% 6 Months .................................................................................................... 83% Operating Temperature Range Charge .. ...........................................................-4°F (-20°C) to 122°F (50°C) Discharge .......................................................-40°F (-40°C) to 140°F (60°C) Case ......................................................................................................ABS Plastic Power-Sonic Chargers ................................................PSC-12800A, 12800A-C PS-1270 www.power-sonic.comTo ensure safe and effi cient operation always refer to the latest edition of our Technical Manual, as published on our website.All data subject to change without notice. Terminals (mm) 12 Volt 7.0 AH L: 5.95 (151) W: 2.56 (65) H: 3.70 (94) HT: 3.86 (98) F1 - Quick disconnect tabs, 0.187” x 0.032”- Mate with AMP. INC. FASTON “187” series F2 - Quick disconnect tabs, 0.250” x 0.032” - Mate with AMP. INC FASTON “250” series • • OR CORPORATE OFFICE • 7550 Panasonic Way • San Diego, CA 92154 • USA • Tel: +1-619-661-2020 • Fax: +1-619-661-3650 CUSTOMER SERVICE Tel: +1-619-661-2030 Fax: +1-619-661-3648 customer-service@power-sonic.com INTERNATIONAL SALES Tel: +1-650-364-5001 Fax: +1-650-366-3662 international-sales@power-sonic.com DOMESTIC SALES Tel: +1-619-661-2020 Fax: +1-619-661-3650 national-sales@power-sonic.com TECHNICAL SUPPORT Tel: +1-619-661-2020 Fax: +1-619-661-3648 support@power-sonic.com Contact Information www.power-sonic.com 0211 1M © 2011. Power-Sonic Corporation. All rights reserved. All trademarks are the property of their respective owners. Charging Cycle Applications: Limit initial current to 2.1A. Charge until battery voltage (under charge) reaches 14.4 to 14.7 volts at 68°F (20°C). Hold at 14.4 to 14.7 volts until current drops to under 70mA. Battery is fully charged under these conditions, and charger should be disconnected or switched to “float” voltage. “Float” or “Stand-By” Service: Hold battery across constant voltage source of 13.5 to 13.8 volts continuously. When held at this voltage, the battery will seek its own current level and maintain itself in a fully charged condition. Note: Due to the self-discharge characteristics of this type of battery, it is imperative that they be charged within 6 months of storage, otherwise permanent loss of capacity might occur as a result of sulfation. Chargers Power-Sonic offers a wide range of chargers suitable for batteries up to 100AH. Please refer to the Charger Selection Guide in our specification sheets for “C-Series Switch Mode Chargers” and “Transformer Type A and F Series”. Please contact our Technical department for advice if you have difficulty in locating suitable models.CapacityRetentionRatio(%)Standing Period (Months) 100 80 60 40 00 2 4 6 8 10 12 14 16 18 20 40oC (104oF) 30oC (86oF)20oC (68oF) 5oC (41oF) Charging is notnecessary unless 100% of capacity is required. Charging beforeuse is necessaryto help recoverfull capacity. Charge may failto restore fullcapacity. Do notlet batteries reachthis state. 100 80 60 40 20 0 0 1 2 3 4 Ambient Temperature 20˚C (68˚F) Float Charging Voltage 2.25 - 2.30 V/Cell RetentionCapacity(%)Years 120 100 80 60 40 20 0 0 200 400 600 800 1000 1200 Number of Cycles 1.Discharge Current 0.2C (Final Voltage 1.7V/Cell) 2.Charge Current:0.1C 3.Ambient Temperature:20oC to 25oC (68oF to 77oF)RetentionCapacity(%)Discharge Depth 30% Discharge Depth 100% Discharge Depth 50% Discharge Characteristics Discharge Time vs. Discharge Current Shelf Life & Storage Life Characteristics in Stand-By Use Life Characteristics in Cyclic Use PS-1270 12 Volt 7.0 AH ® Further Information Please refer to our website www.power-sonic.com for a complete range of useful downloads, such as product catalogs, material safety data sheets (MSDS), ISO certification, etc.. 13.0 12.0 11.0 10.0 9.0 8.0 14.0 Terminal Voltage (V)Ambient Temperature 20oC (68oF) 1.2 2.4 6 12 24 36 48 1 2 4 6 8 10 20 4 0 Discharge Time FinalVoltage min h 0.350.701.4 3.5 7.0 14 0.35 0.70 1.4 3.5 7.0 14 Discharge Current (A) 20 15 10 5 2 1 30 10 5Discharge Time40oC (104oF) 20oC (68oF) 0oC (32 oF)minh10.2V 9.6V 9.0V 8.1V Final Voltage 10.5V Sealed Rechargeable MODEL PS-121000 U 12 Volt 100.0 Amp. Hr. Battery www.power-sonic.com BATTERY M U S T BE R E CYCLEDPb NONSPILLABLE MH20845 ® L HT H W Tolerances are +/- 0.04 in. (+/- 1mm) and +/- 0.08 in. (+/- 2mm) for height dimensions. All data subject to change without notice. Physical Dimensions: in (mm) Features • Absorbent Glass Mat (AGM) technology for superior performance • Valve regulated, spill proof construction allows safe operation in any position • Power/volume ratio yielding unrivaled energy density • Rugged impact resistant ABS case and cover (UL94-HB) • Integrated ABS carrying handles for ease of movement • Approved for transport by air. D.O.T., I.A.T.A., F.A.A. and C.A.B. certified • U.L. recognized under file number MH 20845 Performance Specifications Nominal Voltage .......................................................12 volts (6 cells) Nominal Capacity 20-hr. (5A to 10.50 volts) .............................................. 100.0 AH 10-hr. (9.2A to 10.50 volts) ............................................. 92.0 AH 5-hr. (15.8A to 10.20 volts) ........................................... 79.0 AH 1-hr. (55.2A to 9.00 volts) ............................................. 55.2 AH 15-min. (175A to 9.00 volts) ................................................43.8 AH Approximate Weight ..................................... 68.00 lbs. (30.84 kg) Energy Density (20-hr. rate) ............. 1.86 W-h/in3 (113.45 W-h/l) Specific Energy (20-hr. rate) ............ 17.65 W-h/lb (38.91 W-h/kg) Internal Resistance (approx.) ....................................... 5 milliohms Max Discharge Current (7 Min.) ............................. 300.0 amperes Max Short-Duration Discharge Current (10 Sec.) .. 750.0 amperes Shelf Life (% of nominal capacity at 68°F (20°C) 1 Month ................................................................................. 97% 3 Months ................................................................................ 91% 6 Months ............................................................................... 83% Operating Temperature Range Charge ................................................-4°F (-20°C) to 122°F (50°C) Discharge ............................................-40°F (-40°C) to 140°F (60°C) Case ..................................................................................ABS Plastic Power-Sonic Chargers ...........................................PSC-1210000A-C www.power-sonic.comTo ensure safe and efficient operation always refer to the latest edition of our Technical Manual, as published on our website. All data subject to change without notice. Terminals: in (mm) L: 12.00 (305) W: 6.60 (168) H: 8.15 (207) HT: 8.98 (228) 182217.4 1010998.58.513 182215.9 13 U: Positive Terminal T6 U: Negative Terminal 16 6 M6 • U: Universal terminals: Heavy-duty posts with ‘nut & bolt’ fasteners • T6: Threaded insert w. 6 mm stud fastener PS-121000 12 Volt 100.0 AH CORPORATE OFFICE • 7550 Panasonic Way • San Diego, CA 92154 • USA • Tel: +1-619-661-2020 • Fax: +1-619-661-3650 CUSTOMER SERVICE Tel: +1-619-661-2030 Fax: +1-619-661-3648 customer-service@power-sonic.com INTERNATIONAL SALES Tel: +1-650-364-5001 Fax: +1-650-366-3662 international-sales@power-sonic.com DOMESTIC SALES Tel: +1-619-661-2020 Fax: +1-619-661-3650 national-sales@power-sonic.com TECHNICAL SUPPORT Tel: +1-619-661-2020 Fax: +1-619-661-3648 support@power-sonic.com Contact Information www.power-sonic.com 0114 1M © 2013. Power-Sonic Corporation. All rights reserved. All trademarks are the property of their respective owners. Charging Cycle Applications: Limit initial current to 20A. Charge until battery voltage (under charge) reaches 14.4 to 14.7 volts at 68°F (20°C). Hold at 14.4 to 14.7 volts until current drops to under 1A. Battery is fully charged under these conditions, and charger should be disconnected or switched to “float” voltage. “Float” or “Stand-By” Service: Hold battery across constant voltage source of 13.5 to 13.8 volts continuously. When held at this voltage, the battery will seek its own current level and maintain itself in a fully charged condition. Note: Due to the self-discharge characteristics of this type of battery, it is imperative that they be charged within 6 months of storage, otherwise permanent loss of capacity might occur as a result of sulfation. Chargers Power-Sonic offers a wide range of chargers suitable for batteries up to 100AH. Please refer to the Charger Selection Guide in our specification sheets for “C-Series Switch Mode Chargers” and “Transformer Type A and F Series”. Please contact our Technical department for advice if you have difficulty in locating suitable models.Capacity Retention Ratio (%)Standing Period (Months) 100 80 60 40 00 2 4 6 8 10 12 14 16 18 20 40oC (104oF) 30oC (86oF)20oC (68oF) 5oC (41oF) Charging is not necessary unless 100% of capacity is required. Charging beforeuse is necessaryto help recoverfull capacity. Charge may failto restore fullcapacity. Do notlet batteries reachthis state. Discharge CharacteristicsDischarge Time vs. Discharge Current Shelf Life & Storage PS-121000 12 Volt 100.0 AH ® Further Information Please refer to our website www.power-sonic.com for a complete range of useful downloads, such as product catalogs, material safety data sheets (MSDS), ISO certification, etc.. 13.0 12.0 11.0 10.0 9.0 8.0 14.0 Constant Power Discharge Ratings MODEL FINAL VOLTAGE WATTS PER CELL @ 25° C 5 MIN 10 MIN 15 MIN 20 MIN 30 MIN 45 MIN 60 MIN PS-121000 1.75 550 395 312 267 207 152 128 1.70 586 413 324 277 212 155 129 1.67 605 421 330 283 215 158 130 Terminal Voltage (V)Ambient Temperature 20oC (68oF) 1.2 2.4 6 12 24 36 48 1 2 4 6 8 10 20 4 0 Discharge Time FinalVoltage min h 5.01020 50 100 200 5.0 10 20 50 100 200 Discharge Current (A) 20 15 10 5 2 1 30 10 5Discharge Time40oC (104oF) 20oC (68oF) 0oC (32 oF)minh10.2V 9.6V 9.0V 8.1V Final Voltage 10.5V CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.7165-0067:0508 Page 1 of 3 CATEGORY: 7165 -- FIRE ALARM CONTROL UNIT (COMMERCIAL) LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Model Desigo Fire Safety Modular and Cerbrus Pro Modular fire alarm control unit. Local, auxiliary, remote station (protected premises), proprietary, central station (protected premises), releasing service, waterflow, mass notification and sprinkler supervisory service. Refer to listee's data sheet and control unit's installation instructions for additional detailed product description and operational considerations. System components: PMI-3, GPMI-3 Person Machine Interface FCM 2041-U2, FCM 2041-U3 Operator Interface PSC-12 Power Supply PTB Power Termination Board RPM Remote Printer Interface CRC-6 Relay Card CC-2, -5 Card Cage ZIC-4A Zone Indicating Card DLC Device Loop Card XDLC Device Loop Card MLC MXL Line Loop Driver Card HTSW-1 Tamper Switch NIC-C Network Interface Card 5128, 5129 Silent Knight Dialer/DACT LLM-1 Line Module FCM-6 Fan Control Module SCM-8 Switch Control Module LCM-8 LED Control Module CSB CAN Sounder Board PSX-12 Extender Power Supply SIM-16 Supervised Input Module OCM-16 Output Control Module RNI Remote Network Interface HTRI-M , -S, -D, -R Addressable Monitor Module CAB2-BB, CAB3-BB Enclosure CAB-MP Mounting Plate CAB2-BD, -RD, -XBD Enclosure Door 07-12-2018 July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. Listing No. Page 2 of 3 7165-0067:0508 CAB3-BD, -RD, -XBD Enclosure Door CAB1-TK, CAB1R-TK, CAB2-TK, Enclosure Trim Kit CAB2R-TK, CAB3-TK, CAB3R-TK Enclosure Trim Kit CAB-BATT Battery Box CAB-55-BRKT, CAB-100-BRKT Battery Bracket REMBOX2-MP Mounting Plate REMBOX2, REMBOX2R, REMBOX4, REMBOX4R; Remote System Enclosure REMBOX4-MP Mounting Plate MI-REM Remote PMI PMI-INTL PMI International SSD, SSD-C, SSD-C-REM System Status Display ZIC-2C Dual Channel Audio Card ZIC-8B NAC Card ZIC-SPC Strobe Power Conditioner HZM Conventional Zone module OD-LP, -BP, -GP Door plate ID-SP, -FP Door Plate CAB1, CAB1R Cabinet BP-61, BTX-1, BTX-2, BTX-3 Battery Sets HLIM Loop Isolator Module REL-EOL, EL-33 Resistor Kits ILED-HC, ILED-HW Remote Alarm Lamp CDC-4 Conventional Detector Card XLS-RK19 Rack XDACT-ASSY Mounting Bracket Assembly MPF-RK Front Panel MPR-RK, PTB-RK Back Panels BP-RK Blank Plate SNU Single Node Upload XLS-MSE2-ADPT, XLS-MSE2R-ADPT Enclosure Door Adaptor Kit XLS-MSE3-ADPT, XLS-MSE3R-ADPT Enclosure Door Adaptor Kit XLS-MLE6-ADPT, XLS-MLE6R-ADPT Enclosure Door Adaptor Kit XLS-MME3-ADPT, XLS-MME3R-ADPT Enclosure Door Adaptor Kit XLS-RCC1-ADPT Remote Enclosure Door Kit XLS-RCC13F-ADPT, XLS-RCC13FR-ADPT Remote Enclosure Door Kit VPM VESDA peripheral module VPM-MP mounting bracket VESDA HLI KIT interface XDMC digital audio message card FCA2015-U1 Serial digital alarm communicator transmitter (DACT) RATING:120 VAC Primary Supply Input 24 VDC Output 07-12-2018 July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. Listing No. Page 3 of 3 7165-0067:0508 INSTALLATION: In accordance with listee's printed installation instructions, applicable codes and ordinances, and in a manner acceptable to the authority having jurisdiction. MARKING: Listee's name, model number, electrical rating, and UL label. APPROVAL: Listed as fire alarm control unit for use with optional Voice Communication Accessories (CSFM Listing No. 6912-0067:237) and separately listed compatible initiating and indicating devices. Refer to manufacturer’s Installation Manual for details. This control unit can generate a distinctive three-pulse Temporal Pattern Fire Alarm Evacuation Signal (for total evacuation) in accordance with NFPA 72, 2002 Edition. Strobe devices can be controlled by the ZIC-4A for (synchronized or unsynchronized) operation. The ZIC-4A output can also be configured as connection to municipal tie, releasing service per NFPA 13 and NFPA 2001. This control unit meets the requirements of UL-864, 10th Edition Standard. NOTE: 1. For Fire Alarm Verification Feature (Delay of fire alarm), the maximum Retard/Reset/Restart period must be adjusted to 30 seconds or less. 2. Combined with 7170-0067:236 3. XLDC device loop card provides 4 class A/B/X SLC loops with separately listed X series addressable devices (CSFM Listing No. 7300-0067-0501. 4.The separately listed PAD-5, PAD 5-MB, PAD-5-CLSA, and PAD-5-CDC (CSFM Listing No. 7135-0067:0507) can connect to the Desigo Fire Safety Modular or Cerbrus Pro Modular control unit via the P2 SLC loop. 07-12-2018 July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.7300-0067:0172 Page 1 of 3 CATEGORY: 7300 -- FIRE ALARM CONTROL UNIT ACCESSORIES/MISC. DEVICES LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Control Unit Accessories. Refer to listee's data sheet for additional detailed product description and operational considerations. Accessories are listed as follows: MODELS DESCRIPTION ICP-B6 Intelligent Control Point Module CZM-1, -1B6 Remote Conventional Zone Module FS-CZM Conventional Zone Module ALD-2/ALD-2I Analog Loop Driver Module TSP-40, TSP-40A Logging Printer PSR-1 Remote Power Supply MOI-1/MOI-7 Voice/Annunciator Drive MOD-16 Output Driver NET-4/NET-7/NET-7M Communication Interface MOM-4/MOM-2 Module Card Cage TSW-1 Tamper Switch CMI-300 Modem Interface Module PIM-1 Printer Interface Module PAL-1 Printer CP-2297/CP-2341 Line Suppressor XL Graphic Software MXL-G Graphic Interface PS-5A/-35, -5N/-5N7 Power Supply/Network Node LIM-1 Loop Isolator Module DC-35S Voltage Regulator Module CSG-M Compare Program MMM-1 Coil Cord Microphone TMM-1 Master Telephone Handset TBM-1/TBM-2 Terminal Block Module EL-410C/-410D Signaling Amplifier VSM-1 Visual Switch Module OMM-1/OMM-2 Output Master Module OCC-1/OCC-2 Output Control Card ASC-1/ASC-2 Supervisory Module BTC-1 Backup Tone Card *Rev. 12-23-10 bh July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. Listing No. Page 2 of 3 7300-0067:0172 ACM-1 Audio Control Module CCU/M Pager Interface RDM-PC, -MXL Diagnostic Interface Modules TSM-1 Test Switch Module ZCx-8B-XX/ZCx-4Abxx Control Card Modules ZCT-8 Telephone Module MBR-2/MME-3/MLE-6 Enclosure Backbox MDR-2 Enclosure Door MBR-MP/MBR-3MP Enclosure Plate Insert MHD-X Enclosure Inner Door Panels MDACT Multi-Pont Digital Communicator Transmitter CAB1-COM, CAB1-X Enclosure CAB2, CAB3 Expanded Enclosure HUB-4 Communication Card Module NCCNT-WAN Wide Area Network VSB-1 Inner Door Blank MKB-1/-2/-3 Keypad/Annunciator Modules MID-16 Input Module NIM-1R/REP-1 Network Interface/Repeater NCC/NCC-G, -GL/NCC-T Computer D2300CP, D2300CPS, D2325CPS Fiber Optic Repeater BI-35 Power Supply Interface BC-35 Battery Charger AE-30U Class B Bell Circuit BB-55 Battery Enclosure ALI-8, ALI-8B Remote Phone Enclosure MTE-2 Interface Enclosure ZAC-30 Zone Amplifier Module XLD-1 Analog Loop Driver XED-1/-2 Back Box XEA-1/-2 Adapter Plate ACM-RK/MKB-RK/MMB/RK Rack Mount Kit MOM-RK/MPS-RK/TSP-RK/VSM-RK Rack Mount Kit VFM-1 Fan Control Module MEM-1 Memory Expander Module RCM-1 Distributed Audio Card MSE-3L/-3LR Enclosure Backbox MET-3L/-3LR Flush trim Kit IQ-DFL/-BLANK Dead Front Panel VLM-1 Visual LED Module PLC-4 Power Limited Module DMC-1 Digital Message Card NIM-1M Modem Assembly NIM-1W Network Interface Module NCCNT-G, -GL, -T Network Command Center *Rev. 12-23-10 bh July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. Listing No. Page 3 of 3 7300-0067:0172 DFM, DFM-BRK DNet Fiber Module, Bracket FJ-303, -304 Phone Accessories HCP Intelligent Control Point Module OD-LP, -BP, -GP, -BP-R, -GP-R Outer Door (Black or Red) MOM2-XMP Mounting Plate for MOM2 Module XMI MDACT Interface SSD-INTL, SSD-C-INTL Systems Status Display ALCC Audio Level Conversion Card CAB-BATT, CAB-BATT-R Battery Box Enclosure* CAB-55-BRKT, CAB-100-BRKT Battery Bracket* INSTALLATION: In accordance with listee's printed installation instructions, applicable codes and ordinances and in a manner acceptable to the authority having jurisdiction. MARKING: Listee's name or Siemens, model number, electrical rating and UL label. APPROVAL: Listed as control unit accessories for used with listee's separately listed fire alarm control units. *Rev. 12-23-10 bh July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.7315-0067:0268 Page 1 of 1 CATEGORY: 7315 -- POWER UNITS LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Model PAD-4 distributed power module NAC expander monitors the voltage of its two input circuits to determine when to operate its four notification circuits. It provides one AC Fail and one Trouble Relay as well as an auxiliary power circuit. It can also provide up to 9 amps of 24 VDC power and adds two additional Class A circuits by adding the optional PAD-4-CLSA module. The PAD-4 consists of the following: PAD-4-MB; PAD-4 Main Board PAD4-CLSA; Class A Expander Module FP-2011-U1; 170W Power Supply FP-2012-U1; 300W Power Supply Refer to listee’s installation/operation manual for additional detailed product description and operational considerations. RATING:120/240 VAC, 60/50 HZ, 24 VDC INSTALLATION: In accordance with listee's printed installation instructions, applicable codes & ordinances and in a manner acceptable to the authority having jurisdiction. Unit shall be fully supervised and shall have 24 hr. battery back-up. MARKING: Listee's name, model number, electrical rating, and UL label. APPROVAL: Listed as a notification circuit expander for use with listee's separately listed compatible fire alarm control units. Refer to listee’s Installation Instruction Manual for details 08-20-13 gt July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.7165-0067:0508 Page 1 of 3 CATEGORY: 7165 -- FIRE ALARM CONTROL UNIT (COMMERCIAL) LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Model Desigo Fire Safety Modular and Cerbrus Pro Modular fire alarm control unit. Local, auxiliary, remote station (protected premises), proprietary, central station (protected premises), releasing service, waterflow, mass notification and sprinkler supervisory service. Refer to listee's data sheet and control unit's installation instructions for additional detailed product description and operational considerations. System components: PMI-3, GPMI-3 Person Machine Interface FCM 2041-U2, FCM 2041-U3 Operator Interface PSC-12 Power Supply PTB Power Termination Board RPM Remote Printer Interface CRC-6 Relay Card CC-2, -5 Card Cage ZIC-4A Zone Indicating Card DLC Device Loop Card XDLC Device Loop Card MLC MXL Line Loop Driver Card HTSW-1 Tamper Switch NIC-C Network Interface Card 5128, 5129 Silent Knight Dialer/DACT LLM-1 Line Module FCM-6 Fan Control Module SCM-8 Switch Control Module LCM-8 LED Control Module CSB CAN Sounder Board PSX-12 Extender Power Supply SIM-16 Supervised Input Module OCM-16 Output Control Module RNI Remote Network Interface HTRI-M , -S, -D, -R Addressable Monitor Module CAB2-BB, CAB3-BB Enclosure CAB-MP Mounting Plate CAB2-BD, -RD, -XBD Enclosure Door 07-12-2018 July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. Listing No. Page 2 of 3 7165-0067:0508 CAB3-BD, -RD, -XBD Enclosure Door CAB1-TK, CAB1R-TK, CAB2-TK, Enclosure Trim Kit CAB2R-TK, CAB3-TK, CAB3R-TK Enclosure Trim Kit CAB-BATT Battery Box CAB-55-BRKT, CAB-100-BRKT Battery Bracket REMBOX2-MP Mounting Plate REMBOX2, REMBOX2R, REMBOX4, REMBOX4R; Remote System Enclosure REMBOX4-MP Mounting Plate MI-REM Remote PMI PMI-INTL PMI International SSD, SSD-C, SSD-C-REM System Status Display ZIC-2C Dual Channel Audio Card ZIC-8B NAC Card ZIC-SPC Strobe Power Conditioner HZM Conventional Zone module OD-LP, -BP, -GP Door plate ID-SP, -FP Door Plate CAB1, CAB1R Cabinet BP-61, BTX-1, BTX-2, BTX-3 Battery Sets HLIM Loop Isolator Module REL-EOL, EL-33 Resistor Kits ILED-HC, ILED-HW Remote Alarm Lamp CDC-4 Conventional Detector Card XLS-RK19 Rack XDACT-ASSY Mounting Bracket Assembly MPF-RK Front Panel MPR-RK, PTB-RK Back Panels BP-RK Blank Plate SNU Single Node Upload XLS-MSE2-ADPT, XLS-MSE2R-ADPT Enclosure Door Adaptor Kit XLS-MSE3-ADPT, XLS-MSE3R-ADPT Enclosure Door Adaptor Kit XLS-MLE6-ADPT, XLS-MLE6R-ADPT Enclosure Door Adaptor Kit XLS-MME3-ADPT, XLS-MME3R-ADPT Enclosure Door Adaptor Kit XLS-RCC1-ADPT Remote Enclosure Door Kit XLS-RCC13F-ADPT, XLS-RCC13FR-ADPT Remote Enclosure Door Kit VPM VESDA peripheral module VPM-MP mounting bracket VESDA HLI KIT interface XDMC digital audio message card FCA2015-U1 Serial digital alarm communicator transmitter (DACT) RATING:120 VAC Primary Supply Input 24 VDC Output 07-12-2018 July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. Listing No. Page 3 of 3 7165-0067:0508 INSTALLATION: In accordance with listee's printed installation instructions, applicable codes and ordinances, and in a manner acceptable to the authority having jurisdiction. MARKING: Listee's name, model number, electrical rating, and UL label. APPROVAL: Listed as fire alarm control unit for use with optional Voice Communication Accessories (CSFM Listing No. 6912-0067:237) and separately listed compatible initiating and indicating devices. Refer to manufacturer’s Installation Manual for details. This control unit can generate a distinctive three-pulse Temporal Pattern Fire Alarm Evacuation Signal (for total evacuation) in accordance with NFPA 72, 2002 Edition. Strobe devices can be controlled by the ZIC-4A for (synchronized or unsynchronized) operation. The ZIC-4A output can also be configured as connection to municipal tie, releasing service per NFPA 13 and NFPA 2001. This control unit meets the requirements of UL-864, 10th Edition Standard. NOTE: 1. For Fire Alarm Verification Feature (Delay of fire alarm), the maximum Retard/Reset/Restart period must be adjusted to 30 seconds or less. 2. Combined with 7170-0067:236 3. XLDC device loop card provides 4 class A/B/X SLC loops with separately listed X series addressable devices (CSFM Listing No. 7300-0067-0501. 4.The separately listed PAD-5, PAD 5-MB, PAD-5-CLSA, and PAD-5-CDC (CSFM Listing No. 7135-0067:0507) can connect to the Desigo Fire Safety Modular or Cerbrus Pro Modular control unit via the P2 SLC loop. 07-12-2018 July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.3240-0067:0265 Page 1 of 1 CATEGORY: 3240 -- DUCT SMOKE DETECTOR HOUSING/BASE LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Models FDBZ492, FDBZ492-R, *FDBZ492-PR and FDBZ492-HR air duct housings. Accessories: Model FDBZ492-RTL; Remote alarm indicator Model FDBZ-WT; metal enclosure for indoor wet applications Refer to listee's data sheet for additional detailed product description and operational considerations. RATING:16-27 Vdc INSTALLATION: In accordance with listee's printed installation instructions, applicable codes and ordinances and in a manner acceptable to the authority having jurisdiction. MARKING: Listee's name, model number, electrical rating, and UL label. APPROVAL: Listed as air duct housings for use with listee's separately listed detector heads. *Rev 08-13-13 gt July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.7272-0067:0258 Page 1 of 1 CATEGORY: 7272 -- SMOKE DETECTOR-SYSTEM TYPE-PHOTOELECTRIC LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Models FDO421 and OP921 photoelectric addressable smoke detectors. Models FDOT421 and OH921 photoelectric smoke detector with complementary automatic heat detectors. All models are to be used with liste's separately listed base models DB-11 and DB-11E. Refer to listee's data sheet for additional detailed product description and operational considerations. RATING:13 - 33 VDC INSTALLATION: In accordance with listee's printed installation instructions, applicable codes & ordinances and in a manner acceptable to the authority having jurisdiction. MARKING: Listee's name, model number, and UL label. APPROVAL: Listed as photoelectric type smoke detectors for use with listee's separately listed base models DB-11 and DB-11E (CSFM listing number 7300-0067:134) and listee's separately listed alarm indicator models RL-HC and RL-HW (CSFM listing number 7300-0067:225). 07-12-11 mt July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.7272-0067:0260 Page 1 of 1 CATEGORY: 7272 -- SMOKE DETECTOR-SYSTEM TYPE-PHOTOELECTRIC LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Models FDOOTC441 and OOHC941 Photoelectric smoke/heat/carbon monoxide dectector. Models FDOOT441 and OOH941 Photoelectric smoke/heat detector. *These detectors may be installed with a STI-9604 detector guard (CSFM No. 7300-1416:0100). Refer to listee's data sheet for additional detailed product description and operational considerations. RATING:24 Vdc INSTALLATION: In accordance with listee's printed installation instructions, applicable codes & ordinances and in a manner acceptable to the authority having jurisdiction. MARKING: Listee's name, model number, and UL label. APPROVAL: Models FDOOTC441/OOHC941 listed as photoelectric smoke/heat/carbon monoxide dectector and Models FDOOT441/OOH941 listed photoelectric smoke/heat detector for use with listee's separately listed bases. *These detectors may be installed with a STI-9604 detector guard (CSFM No. 7300-1416:0100). Refer to manufacturer’s Installation Instruction Manual for details. NOTE: The photoelectric type detectors are generally more effective at detecting slow, smoldering fires, which smolder for hours before bursting into flame. Sources of these fires may include cigarettes burning in couches or bedding. The ionization type detectors are generally more effective at detecting fast, flaming fires, which consume combustible materials rapidly and spread quickly. Sources of these fires may include paper burning in a waste container or a grease fire in the kitchen. *Rev 06-20-13 gt July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.7300-0067:0134 Page 1 of 1 CATEGORY: 7300 -- FIRE ALARM CONTROL UNIT ACCESSORIES/MISC. DEVICES LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Models DB4T, DB4TS, DB4F, DB4TF, DB4FS, DB3S, ADB3, ADBX3, DB-HR, DB2-HR, DBX3RS, DB-11, *DB-11E, DB-X11RS, ADBI60, ADB-11, ADBH-11,SBGA-34, ADBX-11 and 8837 detector bases and Model DB-ADPT detector/base adapter. Suitable for use with Models RR2 or RR3 auxiliary relays. Model DB-11 is suitable for use only with Model RR-11 or RR-11F auxiliary relay. Models DB-11 base, ADBH-11 audible base, and DB-HR, DB2-HR relay bases are intended to be used with Models HFP-11, HFPO-11 and HFPT-11 Intelligent Series smoke and heat detectors (CSFM Listing No. 7272-0067:0223 and 7270-0067:0224). Model SBGA-34 audible base is intended to be used with Models HFP-11, HFPT-11, or HFPO-11 detectors (CSFM Listing No. 7272-0067:0223 and 7270-0067:0224), Models FDOT421, FDO421, 0H921 and OP921 detectors (CSFM Listing No.7272-0067:0258), Models FDT421 and HI921 detectors (CSFM Listing No.7270-0067:0262), and Models FDOOT441, FDOOTC441, OOHC941 and OOH941 detectors (CSFM Listing No.7270-0067:0260). Model DB2-HR Relay Base can be used also with Intelligent Series smoke detectors type FDOT421, FDO421, OH921, OP921(CSFM Listing No.7272-0067:0258), FDT421, HI921(CSFM Listing No.7270-0067:0262), and FDOOT441, FDOOTC441, OOHC941, OOH941(CSFM Listing No.7270-0067:0260). Refer to listee's data sheet for additional detailed product description and operational considerations. INSTALLATION: In accordance with listee's printed installation instructions, applicable codes & ordinances and in a manner acceptable to the authority having jurisdiction. Model DB-11, *DB-11E, ADBH-11, SBGA-34, DB-HR and DB2-HR may be installed on the ceiling or on the wall. MARKING: Listee's name or SIEMENS, model number, electrical rating and UL label. APPROVAL: Listed as detector bases for use with separately listed compatible smoke detector heads and fire alarm control units. *Rev. 02-01-19 gt July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.7300-0067:0271 Page 1 of 1 CATEGORY: 7300 -- FIRE ALARM CONTROL UNIT ACCESSORIES/MISC. DEVICES LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Models ABHW-4B and ABHW-4S are both intelligent audible bases which provide 6 selectable tone patterns, 2 volume levels, and 2 different power type of alarm (loop power or external power). The difference between Model ABHW-4B and ABHW-4S is that the Model ABHW-4S is capable of generating a 520Hz Low Frequency audio signal per NFPA 72. Refer to the listee's data sheet for detailed product description and operational considerations. RATING:16 - 33 VDC INSTALLATION: In accordance with the listee’s printed installation instructions, applicable codes and ordinances and in a manner acceptable to the authority having jurisdiction. MARKING: Listee’s name, model number, rating, and UL Label. APPROVAL: Listed as smoke automatic fire detection base for use with separately listed fire alarm heads and control units. Model ABHW-4S is capable of generating a 520Hz Low Frequency audio signal per NFPA 72. Refer to listee’s Installation Instruction Manual for details. 03-25-14 gt July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.7300-0067:0501 Page 1 of 1 CATEGORY: 7300 -- FIRE ALARM CONTROL UNIT ACCESSORIES/MISC. DEVICES LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Models ILED-XC and ILED-XW Intelligent Remote Lamps with Dual Isolators. Model TSM-1X Intelligent Test Switch Module with Dual Isolators. Model XTRI-M Addressable Interface Module with Dual Isolators. Models XTRI-S, XTRI-D and XTRI-R Addressable Switch Interface Modules with Dual Isolators. Refer to listee's data sheet for additional detailed product description and operational considerations. RATING:13-32 Vdc INSTALLATION: In accordance with listee's printed installation instructions, applicable codes and ordinances and in a manner acceptable to the authority having jurisdiction MARKING: Listee's name, model number, electrical rating and UL label. APPROVAL: Listed as fire alarm accessories when used with a separately listed electrically compatible fire alarm control unit. Refer to listee’s Installation Instructions Manual for details 04-12-18 gt July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.7150-0067:0512 Page 1 of 1 CATEGORY: 7150 -- FIRE ALARM PULL BOXES LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Models XMS-S, XMS-D and XMS-M Non-coded addressable manual pull stations. Models XMS-51, XMS-501, XMH-501 Non-coded conventional manual pull stations. Models 4DGBOX and APLT-XMP Adapter plates. Model SMBOX-XMP Backbox. Refer to listee's data sheet for additional detailed product description and operational considerations. RATING:XMS-S, XMS-D, XMS-M; 13-32 Vdc XMS-51, XMS-501, XMH-501; 24 Vdc INSTALLATION: In accordance with listee's printed installation instructions, NFPA 72, applicable codes & ordinances and in a manner acceptable to the authority having jurisdiction. MARKING: Listee's name, model number, electrical rating and UL label. APPROVAL: Listed as manual pull stations for use with compatible listed fire alarm control units. Models XMS-S, XMS-D and XMS-M are for use with listee's Models Desigo Fire Safety Modular and Cerberus PRO Modular fire alarm control units (CSFM 7165-0067:0508). Refer to listee’s Installation Instruction Manual for details. 08-05-19 gt July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.7125-0067:0248 Page 1 of 1 CATEGORY: 7125 -- FIRE ALARM DEVICES FOR THE HEARING IMPAIRED LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Models NH-R, NH-W, NH-CR, NH-CW, ZH-R, and ZH-W horns and models NS-MC-R, NS-MC-W, ZH-MC-R, ZH-MC-W, ZH-HMC-R, AND ZH-HMC-W Horns / Strobes. Models NS-MC-CR, NS-MC-CW, NS-HMC-CR, NS-HMC-CW, ZH-MC-CR, ZH-MC-CW, ZH-HMC-CR, ZH-HMC-CW are horn / strobes for ceiling mount only. Suffix CR or CW are for ceiling and color. Units are synchronized or non-synchronized strobes. Refer to Listee’s data sheet for additional detailed product description and operational RATING:Electrical 16-33VDC/FWR Candela: NS-MC-C, ZH-MC-C = 15/30/75/95 candela NS-HMC-C, ZH-HMC-C = 115 / 177 cd NS-MC, ZH-MC = 15/30/75/110 cd ZH-HMC, = 135 / 185 cd Flash Rate: 60 flashes / minute INSTALLATION: In accordance with Listee’s printed installation instructions, applicable codes & ordinances and in a manner acceptable to the authority having jurisdiction. MARKING: Listee’s name, model number, electrical / candela rating and UL label. APPROVAL: Listed as audible and audible // visual signaling devices for use with separately listed electrically compatible fire control units. Models with strobe lights are suitable for the hearing impaired. For indoor use only. All synchronization strobes shall be used with model DSC sync control module (CSFM listing No. 7300-0067:212). Refer to manufacturer’s installation manual for details Note: These appliances can produce a distinctive three-pulse Temporal Pattern Fire Alarm Evacuation Signal (for total evacuation ) in accordance with NFPA 72, 2002 Edition. NOTE: 09-07-2007 July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.7125-0067:0252 Page 1 of 1 CATEGORY: 7125 -- FIRE ALARM DEVICES FOR THE HEARING IMPAIRED LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Models ST-MC-RETRO-R, ZR-MC-W, ZR-MC-R, ZR-HMC-R, ZR-HMC-W intended for indoor use on walls. Models ST-MC-CW, ST-HMC-CW, ZR-MC-CR, ZR-MC-CW, ZR-HMC-CR, and ZR-HMC-CW multi candela intended for indoor use mounted on the ceiling only. Z -series strobes are intended for use with models ZB-R or ZB-W back boxes. ST - series strobes are intended for use with models SHBBS surface back boxes. Model numbers may be followed by alpha characters indicating lens orientation, lettering, and color. Refer to listee’s data sheet for additional detailed product description and operating considerations. RATING:Electrical 16-33VDC/FWR Candela: ST-MC-RETRO-R 15cd, 30cd, 75cd, 110cd ZR-MC-W, ZR-MC-R 15cd, 30cd, 75cd, 110cd ZR-MC-CR, ZR-MC-CW 15cd, 30cd, 75cd, 95cd ST-MC-CW 15cd, 30cd, 75cd, 95cd ZR-HMC-R, ZR-HMC-W 135/185cd ZR-HMC-CR, ZR-HMC-CW 115/177cd Flash Rate: 60 flashes / minute INSTALLATION: In accordance with Listee’s printed installation instructions, applicable codes & ordinances and in a manner acceptable to the authority having jurisdiction. Models with suffix -W are wall mount only. Models with suffix -C are ceiling mount only. All models are for indoor use only. MARKING: Listee’s name, model number, electrical / candela rating and UL label. APPROVAL: Listed as strobe light suitable for the hearing impaired when used with separately listed electrically compatible fire alarm control units. Refer to listee’s installation instruction manual for details. NOTE: 9-10-2007mt July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. CALIFORNIA DEPARTMENT OF FORESTRY & FIRE PROTECTION OFFICE OF THE STATE FIRE MARSHAL FIRE ENGINEERING - BUILDING MATERIALS LISTING PROGRAM LISTING SERVICE LISTING No.7125-0067:0247 Page 1 of 2 CATEGORY: 7125 -- FIRE ALARM DEVICES FOR THE HEARING IMPAIRED LISTEE:Siemens Industry, Inc. Building Technologies Division8 Fernwood Road, Florham Park, NJ 07932 Contact: Vincent Baroncini (973) 593-2664 Fax (973) 593-6652 Email: vincent.baroncini@siemens.com DESIGN: Models AS-MC, -R, -W, -CR, -CW Horn/multi candela strobes for the gearing impaired, followed by two alpha characters indicating orientation and color. Models AS-HMC, -R, -W, -CR, -CW audible strobes with multi high candela for the hearing impaired followed by one or two alpha characters indicating orientating and color. Models AS-HMC, -R-WP, -W-WP, -CR-WP, -CW-WP outdoor audible strobe high candela for the hearing impaired, followed by one or two alpha characters indicating orientation and color. Suffix -WP indicating weatherproof, for outdoor application. The -WP models must be mounted to the weather proof back box (WPBBS) with suffix designation for color. Models AS-75-R-WP and AS-75-CR-WP Horn/strobe 75 candela, red, weatherproof. For outdoor application, the -WP must be mounted to the weatherproof back box (WPBBS). Models AH, -R, -W, -R-WP Horn only, followed by any suffix alpha characters indicating color, weather proofing (-WP). Refer to the listee's data sheet for detailed product description and operational considerations. RATING:Electrical: 16-33 VDC/VRMS Candela: AS-MC: 15cd, 30cd, 75cd, 110cd AS-MC-C: 15cd, 30cd, 75cd, 95cd AS-HMC: 135cd, 185cd AS-HMC-C-WP: 135/185 cd AS-HMC-C: 115/177cd AS-HMC-WP: 115/177 cd AS-75-R: 30/180 cd AS-75-CR: 30/180cd Flash rate: 60 flashes / minute INSTALLATION: In accordance with listee's printed installation instructions, applicable codes and ordinances and in a manner acceptable to the authority having jurisdiction. Models with suffix -WP are for weather proof and require model WPBBS weather proof back box. MARKING: Listee's name, model number, electrical/candela rating, and UL label. APPROVAL: Listed as audible and audible/visual signaling devices suitable for the hearing impaired when used in conjunction with separately listed electrically compatible fire alarm control units. Refer to listee’s Installation Instruction Manual for details. 09-07-07 mt July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. Listing No. Page 2 of 2 7125-0067:0247 These appliances can generate a distinctive three-pulse Temporal Pattern Fire Alarm Evacuation Signal (for total evacuation) in accordance with NFPA 72, 2002 Edition. NOTE: 09-07-07 mt July 01, 2021Date Issued:Listing Expires June 30, 2022 Authorized By: Fire Engineering Division This listing is based upon technical data submitted by the applicant. CSFM Fire Engineering staff has reviewed the test results and/or other data but does not make an independent verification of any claims. This listing is not an endorsement or recommendation of the item listed. This listing should not be used to verify correct operational requirements or installation criteria. Refer to listee’s data sheet, installation instructions and/or other DAVID CASTILLO,, M.E., F.P.E. OFFICE OF THE FIRE MARSHAL – LA QUINTA 78495 Calle Tampico, La Quinta, CA 92253 • Phone (760) 777-7074 • www.rvcfire.org March 5, 2022 Siemens 6141 Katella Ave #100 Cypress, CA 90630 Re: Fire Alarm System Plan Review – TALUS GOLF CLUBHOUSE FA2022-0005 / 79565 CLUBHOUSE DRIVE, LA QUINTA, CA 92253 The fire alarm system plans you submitted for the above referenced project have been reviewed by Riverside County Fire Department - Office of the Fire Marshal personnel and are approved with the following conditions. 1. For Central Station monitoring service, provide written documentation, at the time of acceptance testing, that there is a contract to provide the runner and maintenance services as required per NFPA 72. 2. The Office of the Fire Marshal staff shall witness the following inspections/tests: a) Rough-Wire Inspection – all wire not in conduit is exposed for inspection. b) Function Test / Start 24-hour Battery - The alarm installer shall provide all needed testing equipment to complete the final alarm inspection. c) 5-Minute Ring-out / Final Acceptance Testing and Certification 3. Provide a completed NFPA 72 Record of Completion that the system has been installed in accordance with the approved plans and specifications as required. 4. Operating, testing, and maintenance instructions, record drawings (“as builds”), site-specific software and equipment specifications shall be provided in a documentation cabinet in compliance with NFPA 72 Section 7.7.2 The Fire Department approved plans and conditions letter must be at the job site. Applicant/installer shall be responsible to contact the Fire Department to schedule inspections. Requests for inspections are to be made at least 48 hours in advance and may be arranged by calling (760)777-7131. All questions regarding the meaning of these conditions should be referred to the Office of the Fire Marshal staff at (760)777-7074. Kohl Hetrick - Fire Safety Specialist 78495 CALLE TAMPICO, LA QUINTA, CA 92253 / 760-777-7000 / INSPECTION HOTLINE: 760-777-7131 RIVERSIDE COUNTY FIRE PROTECTION PLANNING RECORD OF INSPECTIONS / PERMIT CARD THIS CARD IS TO REMAIN ON SITE AT ALL TIMES. INSTALLING CONTRACTOR MUST BE PRESENT FOR ALL INSPECTIONS. SEE NOTES ON REVERSE SIDE. JOB ADDRESS: 79565 CLUBHOUSE DRIVE PERMIT#: FA2022-0005 DATE ISSUED: 3/5/2022 DESCRIPTION: GOLF CLUBHOUSE – MANNUAL ALARM CONTRACTOR: SIEMENS HYDRANT SYSTEM DATE INITIALS SPECIAL SUPPRESSION DATE INITIALS Thrust block pre-pour Door fan test UG rough piping Abort test UG hydro Mechanical shutdown Flush Detector test Final E F Deluge/pre-action SPRINKLER U.G. Final E F Thrust block pre-pour UST/AST TANK UG rough piping Installation UG hydro Removal Flush Emergency shut off Final E F Primary piping FIRE SPRINKLER Secondary piping Weld inspection Dispensers & shear valves Overhead rough piping Final E F Overhead hydro MISC. INSPECTIONS UG flush / OK to connect Spray booths Main drain/inspectors’ test Hood/duct extinguishing High pile storage High pile rack storage In-rack sprinklers H.P. vents/access/corridors Hose racks Tract access/hydrant verification Final E F Access & Address verification HOOD EXTINGUISHING OTHER CONST. PERMIT Detection system Function test Gas/electrical shut-off Nozzle model/placement Fire alarm connection Final E F SPRAY BOOTHS FIRE CODE PERMIT(S) Installation Air flow test Mechanical interlock Extinguishing system Fire alarm connection Final E F FIRE ALARM KNOX SYSTEM Rough-wire inspection Building Knox box Function test Gate access Knox box/padlock Duct detectors/velocity BUILDING INSPECTIONS 24 hr. battery test T/I final Sprinkler monitoring Shell final Final E F Final for occupancy FINAL INSPECTION DATE: INSPECTORS SIGNATURE: **WHEN CALLING FOR AN INSPECTION PLEASE HAVE PERMIT NUMBER READY. SEE NOTES ON REVERSE SIDE** 78495 CALLE TAMPICO, LA QUINTA, CA 92253 / 760-777-7000 / INSPECTION HOTLINE: 760-777-7131 INSPECTION NOTES 1. Sway bracing and hangers will be inspected at the time of rough piping inspection. 2. All required hydrostatic pressure tests shall maintain 200 psi for a 2-hour duration. (EX: Residential Fire Sprinkler Systems) 3. Fire sprinkler system remodels: if indicated on plans or this card, a hydrostatic pressure test shall be required. 4. All underground joints and thrusts blocks shall be exposed and readily visible during the hydrostatic test. 5. Contractor shall supply all testing equipment, access and operating instructions at time of test. 6. All systems shall be inspected, tested, and approved by a Fire Inspector before any work is started that may cause the affected system to be covered or hidden. POLICIES ON FIELD INSPECTIONS A. INSPECTION REQUESTS: Inspections are made subject to availability. Please have the permit number available when scheduling inspections. For City of La Quinta inspections call: (760) 777-7131. B. APPROVED PLANS: Shall be kept on the job site at all times that work is in progress. Work shall NOT commence without approved plans. C. INSPECTION REQUESTS: As required by the California Fire Code, the appropriate installing contractor shall be required to schedule the necessary inspections and be present on site for inspections. D. RE-INSPECTIONS: Will be charged against a permit when an inspection has failed, is not ready, the responsible party not on site or where previously noted corrections have not been completed. E. COMMODITIES: Unless otherwise noted on approved plans or letter of conditions, no commodities shall be entered into the structure until clearance has been granted by the Fire Dept and Building Official. F. OCCUPANCY: Buildings shall NOT be occupied by persons other than construction workers until a Final Fire Clearance has been granted by the Fire Dept and a Certificate for Occupancy has been issued by the Building Official. INSPECTION NOTES: THIS CARD IS REQURIED TO BE POSTED AT THE CONSTRUCTION SITE. THIS CARD AND APPROVED PLANS MUST BE AVAILABLE AT THE CONSTRUCTION SITE FOR ALL INSPECTIONS. THIS PERMIT SHALL EXPIRE AND BECOME NULL AND VOID IF THE WORK AUTHORIZED IS NOT COMMENCED WITHIN 180 DAYS OR IF THE WORK IS SUSPENDED OR ABANDONED FOR A PERIOD OF 180 DAYS OR MORE. THIS PERMIT IS FOR FIRE DEPARTMENT APPROVAL ONLY AND DOES NOT INTEND TO ABROGATE MORE RESTRICTIVE REQUIREMENTS OF OTHER AGENCIES HAVING RESPONSIBILITY.